n j . iciq‘ggfi: ‘3‘ «fig; . N“: 3:. e2» .2 .2 2%.. W; 3%“ ‘*§3%§3a§§kyzx .JT.5 3» z.“ .: ‘?5:.:§" u: 2" _ :QS‘gia‘ 3&5" QJWA;§%w5g&a :Txxhx. .45. .35. 2L ._ ~ ' vi. V, V 1‘“ t" 7".” ‘ ‘31,? .33 $5- 52??? «‘x ~‘ 5“? 3...- 2‘“ f‘ O I ‘5’ 'I‘” . ~ ‘ ‘lruol‘l’. ‘ 3. rm ' COI.-' - 'I. 3:21:55? ’1... . 7‘75. 2:32.; 9s 1: 55:3: _.:..2.3 .Mifi \ ”i Efiwflefi’ 2 T ' \ +y®§ 9 3:: ' < rm}: ,J‘I“ kalfi.-2 .. 0:1]? . ' 3.: \J.“£' :s‘dm”. ..‘A~ 31;. ' ....'?f_: . 3. cw? " . . .ét ‘o', v-2 f3fi~iw ' 31,17,333“: ‘ ‘1“ 'U‘ 7" fia \ U‘ it *aéwxfi 3‘3?- igqug. ; ,,. (gr). 3%,} s'k' :‘DK I “IL-”#45:" ‘xur {Hg/3h,” “£31,“; 0/? {JZ‘ a.” . "/“' {’1‘ 4 ,1. ”if: 45' - .. 1._.“ 5 ’2"? may; '. JF'Eiégkfij 1 ”F5” 2‘ W's ”3’67 " ‘ 3,335,535 "3" Wk?“ ._,5 ‘ ’3929". ‘ fr?» {'7 'Tjfi""f;‘- (5552}‘2‘3- IV C gflagygwfn f5 ,- '. _, J/:)' $311”: ,' {$5.3 (3‘73, 4' 225;? ' '.‘ 4 ‘ r Y '1/ ;7;:’VK‘Z'.55 Jr: 4"?!) .- 335123., 2'22 ;7-3 '2.» ":fil’rLéZ'f'l v. ’ ' . . *1 '“57'1 I 4-"- f u‘,“-""laIu ‘”“fl lfuJ ..J 2..er ,5 nr-V'I’Ec'flv 3! {”3” I I. l "' 1"; '.' . . 75/?) v 5.2.... 22 ”7'52 ’ A ,.._ .5; ,u/ 43,; ”5, an}. . .- -. {no ,5}; '. 0'": I] I. n 2:!“ {’7'} z @522 W- 555542-215”: .375": 237/?" ' 1UP" 5'"?! " " ' . ”kl/.14.! 2, "I, 2' IN'rl f-' ’f’ 503/}. f . M1,]! “(UVIp-G 73”}? 2f- . ' .v '"t/‘fl' 141"" ‘7’" ’ .2 7 2-5.?5, .r I“ If! ”I? W] vi 7?." ~ 7” '3 {é’fifil ' if?!" ' :1l"0‘~r" "'1 fatal 2’3? Aug; .. 3/2". ' $.- 2 ’5'!" 24”?“ "'£'-'r"""5»" ijfilll’rynl «1“, 52‘} {2.3! yr. 3'!!!" . J. . r flf”{ .% fij$gfiI J v ' ' 2:}?! gal"; Léff , . . ‘N’ ‘3 .. ..’_ w;fil"flltM~a‘-“1Kw. ‘- . .- W...‘ *: '.\ ’h‘. m _ .( -; . . “ V -'i j; k 2 I: as,» E 2- ‘ fa»; [:"V?£yv'l.[.., 9"}? '1’?fo .. 3% ’%2a ’1'”“ \u /' II? ”(I 31qu lit/3;, 3/651} ‘3 J)”; g :13), 52% (J " WWW!WM]lifl'flliiiiflllil'lififlfllliflll ; L~ 3 1293 00829 3460 LIBRARY Michigan State University This is to certify that the dissertation entitled Agency, Consequence and Morality presented by Philip Robert West has been accepted towards fulfillment of the requirements for Ph.D. degree in Philosophy [4.“ (me 5.1.1“ Major professor Date '12’169 MS U is an Affirmative Action/Equal Opportunity Institution 0-12771 ————-———-v-- IV1£SI.J RETURNING MATERIALS: Place in book drop to LIBRARIES remove this checkout from " your record. FINES will be charged if book is returned after the date stamped below. m,_0 71i994 i; $51M “ AGENCY, CONSEQUENCE AND MORALITY By Philip Robert West A DISSERTATION Submitted to Michigan State University in pnrtinl fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Department of Philosophy 1987 ,t‘ T.) sill ABSTRACT AGENCY, consequence AND MORALITY By PhilipRohertWeat Thh'uprincipdbvatormalaemantiatormordobligatiomtorbiddanceand pea-mince. Centralaotio-oftheaemaatioaarethatdaainterpretation udthatdtrathmaditMthehtteriaatphinodiatuIn-oltheformer. Preliminarytothed'ncuaionolthomoralcoacepta,however,formal counties for tease, alothic modality and the hriasiu-it—ahoat-that relation hetweeaaceataudtheatataaotdainthoyhriasaboatarepreaented. Obligafiogtorbiddaaooandpam'ndoaarethudefiaodrelativetoagenta ndwhattheyhrhgahoat. Mouspecifically,ageataareaaidtobeobliged, iorbiddeaorpanittedtohriagcutaiaatatoaolaflahaabontjaatincaoe aanctioaingbaahevitabhwolwhattheybringaboatorhilto brhgahoat. Foflowiagthhvarioaaclaaauotiaterpretatioaaiormoral aacriptiouannlatodtooneaaothaandaavwaldooaticparadomare coaddeud. Thaahta-aottholorualapparataa,rehtedbneaare W, including 030b, mt“, collective action, collective ohlbatbmandaeveralior-ddatuuhi-hvolviasaatarallawanddivine action. ItiargudthdbrChrithaMthoappmpriatemetaethical viewiaegoiaticaadoonoeqaeatialiltic. w” M ii tiui pil';i : v I . . a ' I l ‘ I "‘ i‘ll. 't .atlt‘iIlbl 3a.: i”iiu“§i‘l‘i it, “NJ 1.4 I Nuns.“ w ihiii I- o w Jim ‘1‘ Min, wt Hui: Ian M l‘lli.'i"1tti m; L; Unit" 'ctfi r. trim.” v m}! In: ritual vl lt.'oln . m rim' -.; snub-t. wail H «sun-n m Iv-umqm vi 'l‘Hihi ‘Hll ..in.mmwo till"! :- mm inn: lg.;s'1til ,‘I‘t/W’I'Hl .w'hlo.’ ”(3) it."('iii 'td' .1.) "t’l.'w‘| -. [I- Hi? I ' .‘I’ dfijj'ib'll i . . : '. I = '. . w~d=tiuv U4 i"i|H”ih N- untannu. in l‘flb IHtLiunui antida wan»: '\ r-iulhuiw/ * 4 - ~ vnl -H~ NIH-h xII‘r-t Hui! m‘iiiftli; In w-id- wm mu; u w uwntul . I A u ' a a- 0 - n 'v"':t. t-l M'Hui'Vl IHIIH'vto tt-itc‘ ’r‘i. ttutv-IatuIMl lush untitlnm'u'i t|-.nw..iiu-I I '1 l , . Anni-m wt u! Inna "an: P.|n‘:,'~t7 1:!12’I-H mi" 'Hni/ .tmuit; t-M'Ivl I‘Nii It‘ll” it“; o ) vo-‘v m Ms: Hunts may 2 in Hum nirnm *mrlci M ivnmm'rw 'tu u-vlvim in} .I it” 'ch “unit. mul'i I'btil ”will in w it'IEI)vir-il:\'t .ldiJHntli lli’ I.| :uullull'mh‘r- imam in] HIIUIUHWIui‘tlfli in ("welt 'ltut'tbl mt: Entitluiltll timin- mu! van e'.’7~li'f;'ll;él .irmr-tr it'l't’nf inn: tuflmm wn» 01 Ivan.» v1 Nu: ennui-grim. 'm; "HIIII i"-isi"’l dummy”. luau'tut mi' in runs” m u-ui'i .i-i'wiuvnm WRIT-NW! .Huli'nt; ‘wti'miiut ,ItlrliiCH'I-nl'grm“ ,ui-tluj‘w '-t|ii'l.i-ol| intro-111%“: int/lit in". t-hi landfill Hill‘linvm |||.I.tnltn1'i.l‘+i- in ennui ltdwl'V. item .tlutlt-;f.:6i-lh ‘. -;ve--...:. xhihr-i-t-gn nil «It-Mt tnavllli 1 t4 lt-iil it'!ll'."-t- kl H .liutt'bb Ni’lthlltl"l'lt'OIilH'I inlt» ‘E‘IIHJ‘ vi 1i”; ACKNOWLEDGEMENTS Thooonpbtioadnydiuartatioabaotdnouchdvobtomyowndorta, batalaotothoaodothora. Ianoqaciallygratdnltomywfle,fllen Marimwhoaengalareacoaramtandaacrifioumadethecompletion poo-ibis. ThuhabotomyparahflohortandDohUWoat,iorteaching mehothbywordandmplotocliutowhatbtrae. IabothaakJamea M.Grior,Jr.,myfiratpmtauorolphiloaophy,whoaehi¢hacademic ataadudaandhatractionhaveueatlyiaflanoadnyvork. love-pedal gntitadotolnydbutatioadirector,Pmto-orfluhatnudry. D'nca-aiona ofthepmjectwithhhrenltodiananyhnmtaandmptodmany m;toaayaothh¢dhb&noooanyandoutandingotthe philosophical“ Iahoappnciatotharanarthroh-ormchardfiafl, whocardalyreadthalnaa-crbtandoflarednaayhdphlw. TubabbPWHmHWflwhoaadbcdo-doolbctiveaction udooflactiveofligatioaathahtodthaWdChapterFive. Fiaalb,thaahgotonyonthdbutatioaco-Iittoa,fiorhutfieadry, Richandfiall.flaroldWahhudBraoaMihr,MhthaDapartmt ofPhiloaophy,andWillia-Whaba,ProlI-orhthambapartnoat,of MichiganStateUaivuity.Olooaraa,mthoa¢h-ydohtaduatitadeare peat,rqoaaibilityiorthaoptaioaaqoaoadiathodhartatioabmyown. Philip a West 1937, Grand Rapids ~j’"l'/;.l It'll: "Jill Ht.)}’.)l' ‘I. ‘5 " t 1" ’til (it IltllItltal't "I'i but A: llttliflli‘wnun Nil ‘4- H44 thins. qt} [4‘ It! ”it” In! H! if. « ~h.'l:' 'iutl o-uiI'n In" i r! til-t -t '-I-~z‘-t i 4---‘h I'Hl HWH WHIP-W H" ”'04:” r." viia' Ht». i'ilh H1 H1 4‘ 1.0“ . 4I't 1..i.l -'l 'ti’nu N ,0! thi.‘ '7 ' .1 . l " ‘ ‘..‘i|.;i It '3 'It)! ~ .14 .4 tniuii lint. r w. u.. ,ztu 4"] -'ill I'i 1. .:. r :‘h': iii “than... r ~i4h.[- rillmi. nah; I unit 4" Infill M 14’”?! Hi "Lynn." in... if'it-N I" {NH 'tHl ' I r a \ m ‘0 Y H .H m "Twill "Avail! ,Itl'lnwmu‘nl In MMe‘DtHI'I 'r‘tl '.-l ."h .‘WHI' ' :m Mt]. 'oh's i .l‘tw '1 '(H't I“! I"N'.TIH (in. :13; an.“ ”4!! “a! In tum «inn l taut: ' . 9- » o s . . HUM!!!“ i-‘i‘l 4"” 0"“ "l'NHMi 'I'WI 'i 4t i it! W'Hi' U4" ; '1'"pr Jill ‘ i ‘NMHHJ' 6 MILK: l'l'i' ~ul"-I' iatth' I'tl'ul'llu‘ltgtlil {:lt-tlt Hi iHI'H’W‘i H'tti “MN | "‘41-. 'i‘l '4 m" it: .‘t if “KIN’i‘Il 'HI 43:! tltl Q'Hi‘lltiiill moi in ".03.?“ .3 It -~ Hi .rtw'il" us.” i ttii '! l Lamar... in h,i't,.g“’c‘i "viii 'I‘Ifiv‘flq'p. Hut. i .iir'lJ i,i’i‘i““"'illi" -4‘ll"|"“‘{tlh" li'i'ti'wi ’llhttl i "‘Oli- i-ith llgl‘t-rllt'hhl “1' 141341 iiilli‘i'lb". 'HI’ .tsii -:~ Witt" iiiun it) ’I0!H-’.4'...'D~.i wovti t .tirihii Miami 'tn-r aitv'ti «II this mitn‘tiui will t'HJMl t in «2'1! tumutwhl) "iii lwihimnita gintmxii-iu 'vlfl‘villu'n l~tir .Jli‘ll‘ii ”Milt” lllttlin tinilw‘l'v-ui: 'I'illlt‘t 'm 4n 4--.- «Jamil Jinan} lll‘utli‘lwl'vi 'all m ”merit-“i4. ‘l'iiiiu’ ~=vu,-.l Ems ti-ihl", im-mii ”ui‘i inn-.in.i t? ,tuwmm- pi [lei-in"; will m 10.» limit ,unilrgtls'i filibiiiit; lm~ .‘Iti t'VUIiIii in --'o. ~§.ath:hg;‘- ‘1“ rigid. {3” giqmuil "t"! "V1.0!!! 1k! [tail-tilt! i ‘ast‘h' Hr Iii 4;! .H'an lui It ll'-’t'l‘-'l"“"li‘ 'Lil HI i‘vIUH'V“ rituuwlu '4!“ in! (“it'll 3 'V"! .hl'H'r hi]. .l in: a- . it INN. ..l mini! TABLE OF CONTENTS LietoCFigaree L'ltolSylnhob IMMNmm 1. WWNWMW 2. TheAaaeeunentetDeentieLogiee 3. “Wandl’edhleww ChapterOnezTe-eanduodality 1. TnthTe-eandm 2. Methichledality ChapterTwotActioa l. BmWAheu 2. Ammonium a BchctionandTrial 4. AetiequDictoanngfig ChapterTthoaeeqaeaceeaadSaactioa 1. (Jo-enme- 2.8aaetiea ChaptaFmOWForhiddanoeaadPu-Inhioa l. MoralPrep-tbaadflodelw 2. DeenticParadon-e 3. Deentoiechm,DivbeSaaetieaaadMeralAr¢a-ot 4. WW MMCoflectiveActioaandCoflectiveOhhptioa LOhliationfleh 2. WW 3. Aetieafloh ChapterSiacThehm,VolantarhaadDeteI-niniam LActteaPewer 2. Ethic, Divine Power and Prevutabflity 3. PmdeneeandOonflictingOhlhatieal 821832 $3 53632 8223 102 108 109 vi vii 1'll’tl'i‘}’.()') "'U) (I ”ll l Ht',’jl'_"i| l- l I . them: Ir st ' t ‘t’!' 'I'i" u";’ t -M 4l4 ' UK. «N :1 -'-- mu 4 t' . I t 1 I r . | , "I I U. '0 ‘.3 -..‘|f_-r ‘i ’ 'ti'J ’r v H'“ ' i i' in 0 ”ill ““1“ ‘ ‘ - d I 5 e ._ Justuasil. in” war I -v:‘ ‘ ”I n .4 4-I Wan '1‘ v" t4 4 -+ 4" 41a ‘- e H: i I i 'l-O‘J MN 1 vi ' ’ t’ . I.[ at \ t LII‘ ‘ t o a --“"g.o ' t “ I) ’ to.“ a. It ~' l .- (v ‘ ‘ f .. I ‘1. i . - ,. 1| .i’ :t}:.‘ lg”. .vn‘qt.‘ 44. I j't'h. , 1'~‘.,t ' ' 'le " ' v‘. |/' i t " C.‘ .0 . I ' ' t u ”mm m l'l I in” u atvl-tviutilt“i .tlnta.» wt. um. I 'rxtqmt : 0" II ll. 5' .. .' ,It‘ 4 'H10' a‘ti' 4( l' 4 t 9- . . i..-t||¢||‘..'l' 1.1 " t' in H t; "H. 4 ‘91“I0i I l " ‘ a 4.: v'v- “I .n i . ., A, - . i s . ‘ inti: 11'2-’ ‘llgi'v'nid I [hit Ilnllv.’ .1.‘ ' ,‘t It I o;~ l l » u- . i’ If“ I - {tap to « 'r I Il' , i. iii .5 ‘ III “that“! -"!‘i iillt. ttl"!t‘-'.Hl€ ( llzr‘l 4! l (I 8'14...” 1"?! ’ I :t - ' n 'osttl'» a : ‘vlo: -"4'| nu . t ~ H l ‘I 't‘ - ¢~ ' ' .tl‘. -O"' "t‘h’ " 0H. - Notes Appendix A: DBC Appendix B: Theses and Noatheaee Appendix C: Front and Comm 115 118 121 124 ‘ I. ‘1‘ 11” r"of.vli"{',’ .Q“"‘ 'tI’ ., { ,iii 1‘. -i'r:r.ith 'lalltu‘) in”; rl Ta ' ’ til-Hr- u LIST OF FIGURES 1. Lott-Linearity 21 2. Right-Branching 23 3. Histories 24 4. Identical Puts 30 5. Future Pouibility 33 6. Action Wt 36 7. Obligation 66 8. W 74 9. Collective Action 99 10. Action, Cobctive Action and Pouibility 104 11. Divine Actbl 107 i, (Nu INLI ilal .4, 2.3.9.4113» HLJ-I ‘ I 0’ [ti'g’li "1‘1 its "in! 4wl n...” no mun. I m. “humus-r4 (unit 4‘.” ”nth. .lLit I i t In! litx'uitr”.t~.l ’ l‘. 11‘.” a] nu mid”) H-i « :txi-itv‘ ii inn: nut! 4/ "a H- lint unit-e" 4, m r, 7 ,1 43.” 1H! At a....e. I,” B” B." oazlrrm- car-muse: Q H 1'. teesaaaaszafie 19 U 28338838 LIST OF SYMBOLS 'H .i' fiwqu\}__'1t<>J".f'Ww;P'°'U 111 'lr'H ,\ INTRODUCTION 1. RECONSTRUCTIVE ANALYSIS AND THE MORAL CONCEPTS Thiehacoaatrlctioaalaaabfiotthecoaeepuotnoralobligation, noralpenn'ldoaandnoraliorbiddanoe. Itviflhetaheatorgrutedthat conceptealetobeooaetraedupropertieeorrelatiouandthatconoepteare beetclarifiedbyadiqflaydthehehaviorotthefianbticexpleeeionewith whichtheyareauochted. Fammflthooweptdcaainityb anociatedwiththepudicate'badog',anab'fioltheoonceptproueeeeeas aadeutaadhgottheroboftheeeateaceehwhich'badog'oecnrs improves. Inacoaetractioaalualyeb,theeoacepteeademictothe putheoreticalooaeeptaalapparataetargetediorualye'uarechriedbythe articalatioaol-oeeoededyeahetitateeorncoaetnctio-iorthem. The oonoaptatarptedtoranalyfianeo-etimeecaledupficeedaaadtheir Wanda-whoahehaviorbmemactthuthatdtheir When-«mm Mthw-dbywflyins themtacticnhalortheiolnatioadaeateaoeehvolvingtheeahetitnte Wudhydetaiflagtheliaukticmtioubrthefiwiate mthuehyeliniaatiag,unachaapoedhle,hdetelniaateorcoaflicting conventions. Mawwamwmm haveoathetrethoeiabehoodottheeeateaceeiawhichtheyappear,and noethportuttobgicianinhowtherehtioaoleataiheatimpiageeon theeelocatioae. Whethe-oralcoaeeptaantheiocaeofatteation,the 4 n It} ./ . it (Hit “ii ‘iii r 1’ t it 4‘ A“. D 13‘. 1'? 410 t V u- .. -..- at-m lulu w In rm: hunt 'nil ‘ vtr vim”; lmtutl in“ “NW t 4 "Hit Amt mam L.‘ 1.»! :t ' :3! "vi ii! u -l lurid-.6 In! Itiwul I41”; tlwti 'tnat‘h; is tum '.. 140"”!!! I It‘lii ictil‘ 0‘21"” ”Ci‘t‘l 'Itl u‘o' ‘3 "l 4i‘l I'K iflttlifittttt Hi ”I ‘Iih It‘i' l|°o . 1‘. ‘a mam-1.1a ..tr"il"tl:i will in ’hdthii'ki Quit In refitted. 9. hi ivtlitti14 lr'vdl “t 4~4Hlih~4 '14- il‘wti'o- "!i’ it .‘tiiiéinflo Itl'i i"t.i4U4-‘Iti "if; I‘Hui litilifl m ’z‘rtzlih' i,"'ti4la Will in (to- ri'.~tlli r_""i' 8 a... nu; vii-91" ‘Nil mm i--tifiI'-tw‘rh r nu" W until 0. It ti 4hi N It! #‘t'au‘tiu tar. mi? In “Din! ‘hil In Y-t.lrt:t.i"| tisllli 4‘ HI Wm ~ i-H‘t ch; ‘ 'tIv-‘t uii .r‘t' m .m‘ IND-m ilt'wthu B m .r' nzu'mmx viii "3 ""“tllbi : was Ht» timlh‘ ”lid is H “3'th run: :h'ttlt. itilH-‘Q'WII'V! ih‘ ti! mmut‘vlq ' . . ‘ 1 it; ”PM” 'lui o’c.nlivtlli'tln'm‘t In r.‘i'h.lim.t’I illnxtu 'I‘Ltll In H‘tiibiii)"ih imit hm. nimuum'n tulieo muummue WEB air/i511}; 1“} two 47311:! rtrmmw a MI in”! ”4-11 'Hh thiu'w'l‘gikv ‘Hi ‘W-thn .t’iltu'I‘titiUH' in! ull- Until it «is in “iii: that lmw) ‘t'lutll 4-! lulami‘ui MHHH Int'u.I'H¢j/4 Ittrlhuth: win/slmqe‘ ('1. io-chi‘i']:.il r3 Ak‘utli'tfil't ll‘nil lilt«4:'i'llg§|.’--i wunuyng.’ 119.4124” ”HIV-Ain’t ‘Hii QUINN/at! H'!D!I'IIII'|r°. git! fluilts'sfl'tui :3“ '00)} will” ul ..lI‘/- Q“! .1: ”quip"; 11".“ In] e'tlutlu‘vluu‘v 'vllnuzfyui ‘Nil ytatlulft' Iii imts rtluir'e'”u;/‘t rml'llltln't 14o wuzumu'n-aiuu Aide-u»; 4; sit“!!! «at; .‘.!..~.'I'I"t!‘-ii Mnmtt wen .ril Oliutllhr’t -m: why". awn!) w.tl'm§..u 'uil m [Win-midi JiitJo-uk‘s wit. rl‘nitdruistli "u; sum-W ruin 11mm m ”Idliiil‘w'. Mil in tub-int 1-4 iii-m ‘Uil um “mi 5‘ ‘ l -. v-‘t'HI‘HN' I"Hlt-°I.ltl'~ In ‘I‘lithi‘1 “NH 91““ H0 mm! >12”! IN Hus'i-qilll Jaw” it! «z..’na it- h. .-u m] 1|] 'p‘u; rhrrmn‘v inpul 'nil 'H'Nla‘ ruutlllui 'oI‘tttn products of constructive analysis are often called metaethical theorhs or Trnthandtabshoodaress-nticnotio-andsowhenananalysis toes-unwanacconntolthsconditio-andsrwhichssnteaces mtfihgwthmtrnsoshbefitbsaidtoheasemantics torthsconceptstheeapsdoasarea-ociatedwith. Whatiollowsissacha trathconditionalsuaaticstortheuoraioonospts. 'l‘hessvesaltashs involvediatheplesentationwillbedhphyedingreatesdetailshortly. Althoadndeonticiogicsostsuihlyapeehthehtocasontheconcepts olmoraflty,snhdantialdlsnncuugardin¢whatishehganaw-sdconhse mtolthesemandmaheco-Msysteuwithoneuother perilous. Sousdeoaticlogics,lormpls,anoflnedasanalysssot behaviors-Einsteins. Aceosdiagly,sentencesotthetype'pnobkatory', uaflyhanshtdOnmtahsntohaveapmiptiveoshnpeu-ative con-Wrote. Deontthste-olthhsostanoccdoaaflychssmed umd'mmdmm Becausetterhganinpesative andatteringanordascripfionareappmprhtsinshihrchcanstancegthis viewbnotdevoidotattraction. Forbtance,'Itorbidyontocli-bonthe table',or'1tbnotMtoryoatocli-bonthstahie'aadthe ilnperative'Donotchbonthstahls'see-tostandorhlltogether reqsctincthspmpsietyorinpsopsietydthsirattsraace. Bnt,hsolne dsontictheol'haprescrbtiveraharenottheoentcotattntion. Sentences olthetype'pbobligntory'aretaheni-teadtohavean-sertiveor declu-ativelols. Thisdflsnnceoverthsstatudpnsu'iptiverahsinmetaethical analysbapparentlyhvohesoonflctincviewsiathsphflosophyofhnguage. Oatheonehand,son|eregardinlornationconveyuceasoabtoneamong n ., . «2-2141~‘M|i 8» um um. nu. ... Ah... «m nnmh . l'4 Ham '1 ,. uni 'tll-rrcl ‘I lint. m. tlvliu v inn; Imam" ’uiumn-v. 'nn. inaulmid il-lh tlasi'tl. rc'fl't’tlk’ «twin whit! Mann-ant» out in mum-s 118 I'm/in um row-um?! I‘l'i'tuai' - 6 'Ni to! Law. at It 'wii.‘ 10 ”I”! “1!; ’tltnm :‘izgx'! Ilihi'l‘it ultittikltln‘o a: ll IN". di Pia-til I lmlu‘ tilt» inm'awuu “rm Miniserwugf-t mil ennui-u mil In] 41.: Imww. 'ui'l' .r: twin: [Hum 35‘! in} .. vitmmiw lulumimn- lili‘!’ 4:11.13». inn-J. wourrle m io'tll.i-!riit 4.40 at» unit: nt‘v‘nzl wit u! [mun m "'t"'li4l- nil tlu rll'lui 1H.“ m ‘H- It lisitvn'ximb (“uni mu”. 4 I5 'll'uiii/ mm 4 mg“... nut-4i wt in?” me. .41 w‘o'uIfl-ritii» iiuluuvfiw .”i:t1(tiul tn t-th .m. 'HIU littu rm Jr!» muttwmtv': swim" inn. m: twp» ‘vmit In Jump-"o rt. In I‘l'Ilt-nt. mt; [rm-iii” NIH :i-gnhd‘o 'iui ini ’Hltltnit ‘Ntlu”. ramil'vt "IHN' nMI: It :1" Witt mi} in “.1an we ."li-4;!2i:14.'r-I- swim emi-itw 'tuumimi 'tJiHoJ-ut-til 1n "Illuii'lwwlil It “lmi tit (ruin! 'V‘Hi 43‘) i40lt.i'tv..ll (iihs’ H t..:!; m.‘- ’lihl"|‘f‘t.'!'ll Wit: tum fI'l;i’ In mm. m 'Iliiitl'b‘i Haiti'l with. -«l;i;:lt!i' - In» mm m. Bil-"NHL! Wm: H .«tzrsvia Museum" in ’llflui “ii! in Wtiuflr as «'l H HIIhtMIHH'H‘I 1t~3tttflr (It 'Nh'littu’l'gtifl ‘44. "UH-gt! ~51 ii.l"lll h uni'rmu i-lk ‘H-9 II” ‘ilteii' ”1 “LI ittslhii in ,‘t'HtJ-Illl 1rd tl4-H‘arh-‘s. It) Itul'cia Inn m Null 'v N WK 'lfzt malt ne tittiii‘) m um wt -:!4t::-r;tI11-)4l Inn 4 1]" 1:. Wain l'ii' "‘ “hi '” l'flt‘i" UJ "rm->4. ".iuiitl ‘uil flu tiliiii'l lutl u'i" nutcrlme ...l'tr‘ I“ ”Iii '0’015;"'b"“ ‘Ii :11. '0' II ll ' . ‘Iiti' 1*. ’i‘l' “(10"«1 '.‘l" ‘41." i'fllr‘s" "M" ' " "“9! "”3 l" “W“ “M '4'" 'm.‘ r M1 9Iii-iii’4r-eiti .mnumii emu-4' "’r'V-vt‘ HR "4!.Ii u! iwu’lm “filo! ms ”flatnittitio rel cl“ 'ultl ml In 1 . I t Itu’t '*o'lll'it.tr,'- it» it tihi'al” III I-oiit‘ aliivlii4)»-‘t1.. )1. VII?! 34* (”h 1‘. ’l’ .1...“ fl 'tiiii ’4“! A. “I'm; 1" """""i"i'l 7'” “l ”m” ‘ti'd'flutl' '- WWIHINI liltt'u'hnrlt; atrtuuit. ...4'.t-lt .nt nth. at“ ‘totlhdlllitg't Ila-.Efinl'l in L159.“ ...l..., Mud “u" «.5 ii“ severalphilosophicallyimportantroleslangaagehas. Theyevidentlybelieve thataclnsiveattentiontothstnthvaheolanatterance,ortowhata mWMdeaarmandhoresotherkindsof mmd-mwm-dm Moreover, atteruoesahontwhatbohkntory,brhiddsnorpelnhdble,althoagh Mhmmmthshmandnotdedantives unmanmmmmasmmm have-ens. Oatheothsrhand,opponentsolthsloruoia¢podtionssen|tobelisve thatulsuatteranoescanhsconstnnsdasasutiouordsatahthsyarenot a-enahlstophihsnphicalmlyfiandthat-Irtio-anddsaiabmaot psoperiyandeutoodaatilthentrnthconditio-anlaidbare. Toholdthis m,~mumuwmu»mfiw a-srtionadniaLhnt-uebthatothafanctionserenotdvalnswhenit conestophilosophicaluabfi. Aeoadhstothisvisw,thslennotesicof WMMHMMaoh-athm 'Dsanabsis pseasnhdhssebhl'lswiththbsseondview. Moreepeclcaw,theviewespo-sdhsrebobvio-lyshilarto Bohnat’ssnasstioathathpsrativesareualydschratiminm He mummmW-mmwuw ubfl'flmdondbknchudnchhamwflhefilyon', u'flyaantoacapethbhnyoawildoxn. Bohest’ssqasstion Moawtoeo‘snshpentimasdschrativesandcanhecontruted withtherabaaalys’noinoni-criptio-aceordiactowhichthedeciarative noralasatptioasanhdscttreatsdahpuatives. Thhhityhetweuthsanalyfihueandfiohnert’ssaggestionis thatthedeciarativeshessss-fiingthsnoieotinperativesanlikethe n r .. .. to o 1 1| 1... ‘4‘.“ d... r. “if! lil:.ll- lii’ -.‘5 'H-gtb‘itHl it i'w : .H' . n It. vqutlwi'll mt .IJ Quit.) gill.” will Nil "minnow. at? “its“! incl :4 Null-t infiln Wt! -d;gt lulu ho'Ht-tl Ilattn‘l'mtlm- rt .r~!‘-c«.h '4 r‘wlal‘v .I'Hn '94 l/ lbllrli’ lutl: llwtit‘mfifl R‘slnldml ‘t nitt.é'ifi.l it! 2'11“}? '0 "lutllh -II N! r “mm. .‘M evil-11w; 1.. nwii‘wlml .nmb‘iilu a 311d» tin-«iv: . nuswnu :n'. .lmi: in“ law 54mm" qua mi JIlf'i .1 ,ilth lt~ttit.u|4tltx‘1‘4 4N num-um-l. mm mm» 343.324”! 6 ml wimlilnI-i 1mm 1.-:lt Ril’zlimi: .9, 1: I418 ii“ is sutml '~ Ll ‘H'ui ul (it In MI lltml-w-J influx-ml ‘Nl-l In md‘Nl-rj'tn .lomtl 1‘Nlm 'nil ”-3 hui ‘Hh' ("iii .rtltiltinlt "In (ii-.aiirw t; as ir'uiJi-LI-NI ml “5'? R'"t'tfl¢.'i"ol.ill P'Hézii! ital“ 1'1: "us eimewi. lam muni'wre mi: has Haul-rm; immense; m 'tltiwzms uli i541 ul‘ ."th itinl 'ru. 54°54. eaiatu'i tlantl 'll‘nll lihlll in». Mini-mt 'Il't'wgwm 'lnl Ituit'nflrll ml hill "ulti'i'tllil "iliaiwuil lmll m-ei: tut! lrrm 'r-w NW: N l‘ «is: 'IitiI‘J in :mt :m; «mutt nwl 1min» mi) (in ml .m-l ,li'iii‘!l| 1.. autumn In amt it. at 'Htotll 'N'tll Melt HI gtlllun'ni- ririltdltl it." it"w-oittic! ui n-uiiu'. «tn-lute: 'tll'l‘ ."Htifi'l tlits I 0“ 971.11 hiaflbtllttln'v l: ..'.:H..i:£'vg»' Jli‘alliI .I'l4l.t .H'H.’ .N'ti/ Luv-w a-“ it?!» mil m at snarl l‘s-mw ~14; mi minim (l'uuilllu rt «1'in lvvumgw) will mi! ziituiil my» wiccl/ ..t .uaté.‘:k;lx m wu;£c.z..l'wii «iiiu'l ‘ns wucim-v-jwu Hui! u.ni.v"r.;--u.-; or. i‘l‘ttlgiuii in iwmtwnn» mi tglpim "Ii 4W .“It’iz'i"‘-llill '0!” that .‘*i°iitttlr"% 1M .ri'dl’fiilitiav‘v‘t'l fie-«4 iihi‘“. lim "Hull d'uw. lu's time. .I’. ml: tun ul» imt ii" n M: .~ 6: mil in. tit:t$«'°4.:,.:tlrz r Haitian”! 5'1: utv thy llul .llllttl ml] 9.le” M w... mu 2:" 1.. l H’s'lmrn ml mn in... I'a/l.'i?'1£ilb'ti) 43.8 e'wios'iuimt “it‘ll/um» at (MI 8 “Mile. .;.:..ai;i-..i. “it man m ‘.4i.l~In‘-.‘n-; minimums ibi‘tttl in via 3:4”; mm mil “I'M ruptt‘niuu IS in]: ‘3] has“. {It ‘t'lh riiuli-ttl’wtt hilt u; t rum-w. =u:- w 114mm»! but; ~1th animus "alt nwuf'nl JU'MllHHI ‘Hll '-..| 1.,1. HM win-Limb.” 14' ‘Ilu’! 'Hll Enlist-I #9; firm “In o'I'thiLthv‘h '0”, llnl declarativesthatwillbetnatedhereinasfillingtheroleotthemoral ascriptions. Themalascription'Agenta'nobligedtodoX'willbe treatedaseqnivalnttothedsclarative'SonsthincandssiraNewiHhappen toalhslaibtodoX'. Andthbshilarityhtarn-ahsslnaaitesta shihrflyhetweuththuemhdandthatdARAndusonwho snusstsdthatssntenoasetthetype'ltbtorbidd-thatp'heidentified withssntenessdthstyps'flpnthscassthupnnH-Intbneeuary". SinceAndesson’ehplflcationddsonttcbdcidentfieshflh‘ohligation withescapingsanctionospenalty,visnethatress-hlsbbhthbnqectare menu“. Thblahelssufittfihsthspseutationto kilomalthonghthedfluenceswiththsAMWare seven]. Bnmdmbmamtheonditionalanalysbot sentenossdthstypsOpwhflsn-sahnanlsanabbdthenoral concepts. wummuqammama 'nhhalldsonticaflypsrlsctaltcantivepdhbneskh.vh.,that0pis trnsjastinc-sitbtrae'nalthsnorlbhwhichthsnlssbeiag analysedareaahesaallyhflllsd‘. OnesthefldrdubidsntMthe demmibhtu-dthhmtd thanksssusnhtivelyinoledvemiventhatposdhlsworkbareaot Manchu-u). Honsmtstohdthsssdsentioabpeslsctwodds, ntospeahonshplybcatssthosshwhichnowmco-nflsasin dconnhdonwo-Honnoeosdhsbthsnhs. Thbnottobe andustoodasa-gpstionthatohfiationnndioshiddanceanalways ubtivetoappmpriatslyoesanhsdpodtinhehaviosflrebsinoeonen’ght holdHhtika’sviewandso-eseltolnatnrallavthsosymdingtowhich mflohbtionsaadiorhiddanoesanidsntifisdwithpsescriptio-bniltinto n u: 1‘ l 4'4 l thn-l r‘t‘ I” ""hl lWJ-‘Hl ‘Otl mu It‘ll. u~.,~ll| Int 44i- t mu "A an 4.! lr-zuluu r: s- tut-J .. insulin-:5 mmm -s.zl r‘zt-ttt-i-rmt. tlnéltll llm ‘sllmt uiuw ninth-Hum?" ‘Htts'uslwls 911! u! tuwislmwo a. lmwm n in 531mm: mlmn in”! m imam... ruli le|/- ."I' ulo ut «Lufl ml in a n) will: llv't‘ol'tli. ..l./ lu Imll lam. Imus-rm. Mail In” 'Mll nrmtwl Ill'lt-itultr'. l-ufgnit»; ml "4 null noiiminft 4’! 1i” «qu 011! In ew-wu'nw mu twtw'mv ”nemn'wu ‘rt tu-vuuinnu-i anal: m-m mil ei q 13” «Ht mil it. «um-tun» thlN Iliultt'glnlu ,‘JsilllziltJl malltlllwltl maul 'rlliiu-nl) In fluiltnlleblun rmv'l‘l.;l/-_ 'Hm'. an. l'rwle‘n rid! Ill ml ‘il'lill‘v't‘l led! and! .‘hfsfl'ut 1o uuatwurn mime-m dun .t mutant-tawny mil 1~l gyms“ cum-m lu-ifii fit-l'l' lnlqrm lt'ollh'! r-mu-whm .m .luli..t22lltgttilh lltsluueicliuf mil ill!“ run-mind) ‘ull IlLIitUtiu‘b' .NIilal .lm'wm ;., Human; ltwl-iwlfln’! timu 8 cute m 3mm.» in Hutu-«u. at H lt:.~n.t Hill In desk-4t.» 'Ilt‘l't B Stun/Hill ‘JlJlN is" 9'!” mil in I'Hiluttv I: as... m taut elm at qt.) ml! eluwmuwwl .‘tlgilib/x' 1n] .esélimii Nor-mun II 4g-4 Milli ,vl .eldtufl Hitler-N3" «IiImI't'uis t'r'il'wu' Illts‘ditl'rtl' lie at nun vi iJIUIJ mil lite ill mt'li at It 94.1 m l-vm sum ‘:tu‘!4l w‘tlll'l ‘zttll dual” III 3-. at: ,imi’bmebt at mm 10 ml ”at! 9me) Jupitiiul ¢;.t..-‘m'm;|4 rm; bwnugm lt- lunnliiilli‘l filil It) Hill'l‘il fll fil-l'flifl l'I'J'l‘ttl IllFtlHIn-oli in IIHlll.\lI"’HH.li" tun In“ nialmu ‘tlcllé-mn' .lmll "qua; attracted“ zenithl-q with» #:391 'iI-ull Flint)" I’v'ti‘l’hl ‘JliL‘nlm‘mb 9mm his} 0! Plum: «.1..- ll .ll‘iliisluil 8 m7! v.2." ‘Ill “I S mmmnn 'mm Mugs utl ll ml" Ill ‘lel r‘vs'ml thzMI 'ttlu Anny ul U? ml ml ‘06! «i Hal. .r-eiu'l mil in tuttlz'hnm lint/null" 144 t'tl/“ttflflllfl in zit-wt; we ‘3'~iltsl'lai'.l'l4il lum. nnm;:‘:ii.iu than nun/3246?; 5 vi: lupin-lieu: tu-‘mi ww- n'mia swim lt-inllts'tl'ul Qllllqu l;-:\-u-tf:tu (l~.ti.n..;ua..-g.: :l ‘il'l'ii‘Vl ii an” ul atllltlh'hfl “tr-Ill Whl lamina In ’l’w' nun-e. lm. Wu] assailants” ll»! . .l Hui-l Ktlvi"; 1mm; ulna lrtlliltl'fiil on; P‘v'IIIICltl-ill'ltil lmr muitsgililu lcslvm the way things are in some fashion, with positive rules having varying deu'eesofclosenesstothenatnrallaws. Thsanalyflhsreappiissto-esalasaiptionsQnine’sview,thattreth andfahshooduetandansntai'nthshiu-chydconcefis. Moral ascriptionsanasssrtionsordeniahandassnchantrnsoriabe. The logician’swoshistochasstsnthandiahehoodnptheua-naticaltne,“ Qainesays‘. “www.mudnhsphynorobinthetrath conditio-hesepresented-theydoinfiintihha’ssslnantics. Anditshonld beaotsdthat-crbtionsotohhptionorpmhibitionansnothssehhandled as declaratio- ot approval or dhappsoval accord“ to the .otiv'nt Ilse-tine. 2. THE ASSESSMENT OF DEON TIC LOGIC'S Theevahationdconstrnctivsanalyssshvolvsshothsystsnaticand intaitivecritssia. Systematicsnccessdspsntbonthssilnpiicityndclarity nithwhichsqficdsarepsesntsdandrelativetothsnannsshvhichthe saplicds are rehtsd to other concepts h the blond. Mal conceptnalapparatuthatbthsalthstsohjsctotnce-trnction. An analysbthattanydshssitssqfiedaersncesdehredncssths-toother antic-,hsyst-aticaWsnpsriorteonsthatdo-not. Ithcofidsseda virtuetomininissthsaanhssdhnda-sntalosualysabbconcepts. 'l‘hshtaitivesnccs-claco-trnctivsanahfidspubonthedeuee towhichthsconcsptndhdaviosdis “Mfiththe intaitionsmc’ntsdwiththsconceptaalhshaviosotitssqiicsnda Intaitive aces-Weithbdsuestowhichhtaitionsareviolatedbythe Ht t.‘ '-H '~t .. .1: "'i It’w- ' ‘4 hi ... 1' 'a' It“ .. t , :4... ,. .:-.p..t u ii t -"4- u... .u r‘ -t t! -. ' U M 2‘ t : -- dual.) all "it! i "b llvil'ltl Hi ' 'iht'g' '9‘ '.l (’"'v°t.l't» 'H’: I. ...:.-' , Mu .nu It. .31 than-ml mil in l. ‘1'! - tlbl .mt "-‘tv. mu? -. 32.: i :14. t '1 Hit in th'tl MN. [I J!» L; tut. Apt 1’1! :0 Aw...” ,fl 9th -.1. t. 3:; wt. r: 'i ill in Dithttltt i i‘.’ 'Hll tjtt in” .i . tl 140‘! ll ‘Illl ‘t-J. it tvl 4'! rich” I'. Hid 't;J"l tl‘l. i will [It ‘Oltll U” [1.3‘ rilltl lllt. 4‘“. I) t'- stell 'l‘tl'it‘t.t,“/{ 41'.” 'tttdt'fi l... M It latt' .e'timt‘n: w ( 14?...31'wil m “'7 rut: as in == rt-l or II "lI‘ll'J'llh' . ' ' l l I l 's ‘ I it ah let.” Ill'tl'tll In" ‘t'll-i tl'tlllttllll.1tl 1t! ll‘” "6"ll-ltt l) rilwll in"! h lJ-ttl tJ‘O-4 II "M tau It “mm W " H3 lulu tn'. at; lb I‘H‘l‘lh'fllt In its .- "win in uutlt. mi r'i» at 1].)“ - 3"‘1511 .4 mm an“ .3. an twigs. .3 . ...\‘ trig. rt?t.ttt‘sl. .- |£i~.tl rvtleidtlt r*tr.’is.fl.‘. '91.. *thwalu’t in tlttilhttifi ("t ‘ .il «'li‘tli' but. ”Hts 1:62;». “til ttu ~111;'r.;'~l! N'i'wnr «Hunt-‘1'". Mt'flt'n nus-ital!" .tl until! Itt ’tnttltntl Will H] 9(i-..l‘l'| luth‘ lailtt‘w't'lm 'nfi tiltt‘u-,\\ ttmlN tin” lb‘ nti‘ihr-tll‘v'ltl 1':i4tt4l‘itl "it” til (it; rut-a ‘ Putt-.3 U lr'tlbl'b't “Ht. ttlt' . nu i u/ .uunmtmwm lo .t-rwin "Uhéllildl mi: rt mt: «mum-it. outrun”. 1min» u! mutt r‘t‘utl'Wl Il‘ui».~o'ntte 1n .tV-vv-iq't‘a an I‘vtltl‘ilt tiitti tau. fiIH/ltétlt't u l‘l‘l‘ltl’l’ rt rt ll .lutl Win.“ it’ll ‘ttl-a Hi “It!” «we .{3 li'lliiitlt'tli‘w’ rt .dttnllutt rut-mum) -.-t i!§?’iit§tit;lll 1n launnml-msl in t'wlwmt "wit mmtntmn (4l 'mml ‘I""‘."lt 'Hli tltt elut‘ttj'Fi) rt: litu'fl "I?! it'll-’01”! 8 l0 .Ir'MNi-I ‘i'titt‘ltll ‘itil 413 um: .... thJi'ittl Itltwtl‘p‘t «it it) '1...n..t°=.t twang-um.» wit dull” ut wwwul ........-...u.... r7: in 101 uni l ltmrqmnr» ml! min met-w»... mummm us?! It l'"tlt.lult srtr. rttmtunm until! 01 'rnj-vtt mt tltttt reactant» (r‘s't'tl'r sun—nun.-. 6 replacement at the saplicsnds with the system’s ssplicsts. Possible violations arecttwosorts. Eithersosnshtaifincaptasedbythessplicsndsis onittedinthssnhstitntioncssonlshtaitionnuehtsdtothessflicsndsis hclndsdhthshshaviorolthssqh'cds. Thstraditionaldsonticparadomss Wthssshtaittvedivalnss. Bntitnatthbianctarethatalailaretoelncidatsthsphilosophyof ”WWWdaqu-Wm A deonticsysts-hdse-sdinteitivebwettothsext-tthntitsdschration olthesesbcontrarytogenerallyaccsptsdhehsb. Aneahessdthbsort occasswhsssn'nathsbotthssyds-andwhsnitbap-Qaccspted heathdnhsthscsdharymconntn-partdflhhbacrwhese wheatailsdhyssntencssgensrallyhehsvedtohetrns. Batwhenoneis dsdwhsthsrnhcenntahteitivewhesenb-ucriptiondobfiption, Want-“subcutbdfls-mdconficth‘jnhents dependinsonhownbtohsandsrstood. honstoashwhsthesthe ilnperativea-ociatedwhhnnpartdasysts-dpssscrbtivenhsactaal aMuwhethcthbWbanntnnlh? honstoash whdhswnotouwonldmhshiwbohsythbhpcatmosnhsther mdamufiywonld‘estothbhpssatinasacunonly sharednidstohshavior? henstsqndionns’sWahontthe trnthortabehoodolfi? Qndin-ththos-nhefidIaItosay whethsrthesitantionshkhtkhtsdhyso-sdthsh-onsdsonticp-ndones arepararhdcalandthbbqschbapsohhnhthsparadmes a-ociatsdwithconflicth'ohkationsmdbc-nsd. hummusmmmu “Mmmmmumtnwm ..., t... .. ’t. .al 1‘... .n-pu - n! ”we all “it” tlitt. .1,” . t". it‘ 1.. an m: ; u ‘t ‘..--tuitu.~ “all M trauma» it'llltltllll 'w'm' '1 till n'tur 4h! in -'H .. p. “filthy! will Ul tunnel-run! llngtndm min-r 10 lltztlltltlrnth' ‘ttl-l Ill ltnltsttw r 'luln'ifltl )IJIIUIlo llatnlltLS'IJ ‘hivl .ltllttsl'fil,‘ ‘ltl’ Ill) 1thu’l‘Kl ‘Mll Ill l"9l!lllllll "WES’Il' °' 'Hlt’lzit ‘3! "ill tslgjisiuul m Ithwulhi.‘ ~).--l ‘IIhltttlli'D t-i ‘Hllithl 8 Mull 'Hu' Itit=l «till its‘ at H “hi / thiL'llltlt’t’) A'Hlltt.lwfi [Muir/f. 8 la Ht utttgwi‘tl :1) "till L‘ltt.\)'ttllll ‘tftut'a‘vbl th'f’t ml "4i! Hi ”all um?) ”ill m llb‘lll zl -.I:;flJ_"!l lma. «i. Ht tit tr '» wimir-t- tum wait in I Muir-N I rl'ut-ul lml twins (ltt.’l‘ltl" t-l (“um-z" rt r» vtit in lrlltl'i‘Wfi {lust‘ul'fl b 0’l ll "I'l'ttlfl lnlti utslr (4-: 'Nll In rural) 8 at Q tt’l‘ttl I! r' tl'IItI art-um 1.. .‘Mlh‘i (.t m: in marsmmmw examine] 115.3531.) 'tll '14:! ”.4 :ull littl'tl rt wuu ll'rllll tut .‘mtt ml at lm-nti'ul ‘(lltz't-m'tzt wr-ttwtttw {d lMluJ't'n vi 1.. .tltntla gilt: 'lu ilull-‘ilwfi as at (3; and» 'sl;tt|Iltttlttuttn‘t m 1..it..iu ll‘tA'ru-g mlti~ic‘..l°i![ Stitéisulltiti') in 5mm fit. ‘ttil Pi'ml ‘iiI-v .114 ZI‘rtstth 'lu ‘t'ttitéltl'ltl‘l'nl 'Hlt thtll'ulfl Ad; (I! 'mu nl l'illlf'i‘ltvtlll ml 03 m !, tl-ul It.) {u'lil'll'ttl'ilt 'flltt nt; 6‘95311 ‘tltltll't'trt'hl ll) lll'alI (4!. It It» 11.81, (A (3,1 llétc'l lt':t.~..uv'b‘ "I.’tll~t'|tlvttl A": at «at... «.l .051 lmutsn n at €i‘lllbi‘13tiit am) that” 1-. 3.34.1»... 1.» l‘ml-nlN 1n filllh'l‘ttiu" ”all V’ntn ni Q'ttta to! We)“; lulth N wit” that ‘tu 'lvtlt‘ttlk Ilmmtttln'a 8 A8 ‘t'tltn'wgttlt «Hit it! 'W‘tus Hm.” (litiiotllntu'l it lu It'ulul'mt [h ‘Hll mass m 111“1°)i”3'l4] a. uno anthem.) ut "Ilia el .1... full Ml 03 03.11.52: t: and Mir at “it villi: 't "utmn 'wnlt w itl ruuitwmgi' lu lmnttw—ifl u.) ttttttt l . 3 Q ' ° -’ I t I Q: r“'/Hl'8'ltisl 'lattllt‘tit ftluilih-l ‘Nil In {Hill-I. It. it"ltl sultl' «ll FINN lhtcltd '4.“ '1'.“ t'ul N 11...;9'361 ‘Mll {I Hi” tIi ‘Itltflil ls {Shit a‘kl "'0 4'51 Hill ltllfi l5; minimum; '0'“; .ic‘v'tt‘viir Wit: vttm’w'ttiiu mm .2...» d2.» imm mm... s ' In it I with "alvt rot-u, he .04”...th ‘9 1H att'tlr tlul r 8 In lol'tttvz'vrrfifi IMP-'1” tlt~ til . -g ..: -/. .1. . .- ----- 1.1- . . z..-...-. . ..., 1 .~tllt. at, mutt. ll .13! Jun. um hint. h Intel”) 319-. fits—"t. tfl til”! it! tutu-03w“ I’.”~I'ltil:ll' lfl'_)_lrlrl‘l!' taunt ml! tI‘tleI-Dll .it;t_1t 100m. blitlth new twin! 7 withthecapficada'lovudlnotmuchdsm 0nthootherhnnd,m WMMMhWMMWMWtk unudumlflmdtk. mafidfidtfiomm wmvbbbmhhfih-Mdothwcfl-mmmm MW “WWIbMdW mmmMMmWh-Mhtdmh WMWhm-Hw. Mm,itbmttht “mmmwwmmuwm mmammumwunmm handout-11M Rustin-WWII“ thIthR,DMH-dyduflytho W.WhthWMthe.,he ammmmdc‘nwwhfl-bh; ”Mountbatten. Thin-khbnchh’udit hmummdmmambmm .3MWW Wit-“Wot“ WWhgmth(M-fltw fluhahauou)ndtlbmbwuaodfiom MW mmawmm-mmm aheadhnficmmw Mashed-ethanol. attic-alum m,.wmmm mmeMu-wmmwm mmmmaummm Samantha Mdmbcwfiwhflmtw'flhm n-phcoml‘ao...a.. MWbM’IuaI-fiontht mmdmammmmmm Is‘ .a‘d Hail“ mi 1'. I vw- .4. a. I" II «1.: In!) mural” ".0 :-.\-.L«mnw\ ‘01“ "“7 o hivell'iid'flt ‘H'tbll'flrfi! 'l‘-.'£.i-‘~ill 4,11 Jli‘i r'uotihuldl N'OI roil’iull [51H drink”; .1 ml 'I’ 13mm. ceia tmit Inn-My", an if .‘roaiam "'ruu» Human ms Tn Ii mm In" 'HI‘DL 'r "7””le “INN-1'4"!” ‘NU 0‘) [.5318 Hindi-HUN "1”!” “30.041 tie” "L‘HPMH in ”Luv-viii '1 “'1'“ h [Liliitilvi' Waugh,” «and; .w1..'t._.m1-ui tum-Am ""1“ .‘tn'ssitt't1cb HN‘ .I'Hiifl "I “I"Ii “'18 ‘Vl‘ui N‘iil Mi, l'lhfl‘d Hl‘dHJHUHI Us” isl'rltiwpi RI ii J‘erlhll'. Gibimg‘fl 9-. r’ni'wlu'ulii ).:'.5'!l raunumug win! ‘fi’iLiWSI‘Hil mad! his 'Iilfim l“ i»! u! 916 awn-«I 1:3»!aéi‘ml‘ml lletll'l‘i") nl wmlu'v ll "mi" firm/1:5?!” In”; li‘fffl‘ .z... wu-mhli 1n o-‘llNIH‘I'UI “"fl'wnfli 'U‘thuiII "Mir-WU}! Ih:u‘=g~mzihi:gsi1lll "H" “To” VHIHIHW‘H: "will P'w'nil 'aéhlwol: my 1pm!» 'zh'wzil iiidc'd? 0d ,.9.| ,mmmu- :. a: final r1"'2.1-.iuiiui;:icl mil 'Hi .‘H .wnlgi'vv-nq 1n .mluxu-TIHR lgé'lil'flu'igivv‘l'l "vi! Hi i. Maw-71m rhyvmn': Iv y! u! ruin! vi. Hui” Tan!) imu 1‘“; «J Imiqum "‘Jtl'fizmi‘a W'HHI'NIIIP mm u .44? "Eu-Jim]; a 2i fli'r main; and 1' .éy'm‘tmr um ”I rum: .‘Olllauil'2335 viral I'an'tld. withui Hi “I‘mlétli iim Wait «23! in unimurw-rm mi: uni! Emmi ai ted? «(Mimi {”hllrfl ridllij'vu'lirnu ) .0 «New. ils'flsil‘nJ-ull «him! Is #5 '1” IIQ'I‘ézll Mali}; b‘i'l'QE—iu W1 Lilltuir “Mini! 8 1n} I-sl'ul?oli‘llrflt.'r)1 “luxury“; m-wv wit 1n mm as Irvi'u'nni 2i (irIia-vs vim bus “‘11“ had a mi tun Miami wuliwul'hlis at Err/c»! '«U III“II{!‘DBJQIH WIS €00“th [£10111 ‘1!“ it) ksltlll'lll‘linflufl‘l ‘D'HISC'. “I“"“-I"I'W$ lumis Wm MuiT .°ua.«:_.r:_s‘{_r~t~~tu “ms awn-mm: Thar-mi» In War-aw»? 'Hil r’hiH'w'i’ I'hruil "DH/NV. zl‘uiwul 8 .‘(illboh‘fl‘fi .mvh'l'ugw‘k] it'ltnll '90“ 1“ 5- ""Thfll Ii!" !£1p°‘k¢§lf3 “.138 .')":M~Iii:iiul 17-4311: all .Ifluhi WIS fi‘b’nl'tlzin 3'." W‘L-il’filffll 'P' Mari-V’- .m‘wrm'w t'.‘£3‘§".’!ifil J'Ni'i" an In aflai’z'ul‘w'u! mil Illa-55 ntainwn-r uh li'-I.’ luluiuvnfi hi Jervalu'o all «main ,K ltl'inln'I It ri Héfihflh' In ’P-blw n ' IIHH'Ivnro; aszul‘ (.1 gums-m nme 1 vi "HSIHN'M We: 541—" ..-r....,l...i 1.»;va whit: ruminant; '»st«-?Lr:.:1:imutl 'ms liil'1' in wnwum‘rmu 8 when, Wicmofi'ahofldspocfly thetrnthconditionofor objectmnmmi‘. ”.mtukddeonticlogicioto mmmumhwmmmmud Mbtbhc-dfiumficwm Amuddcuficmbtbmdfiocmt m-amunmmr. unwed-idol- bmwfig'fungnnfimmdiu MmdthM'i-M'J'EM' mkWflbmm Amdfibthoory who'meory'c-hibfibw. “Mic mmmmawwmmdmm hug-p. Hfind‘wmm‘bnfltowvjfihcuouy W‘h‘huabnb‘wm AMthMWBthmh-dmuul. HWMmmummm-IM WMbduWMth-“fichth «QMWdCJflMdMWw undue-flew W,fihmubddw Mbuudfitudmm mmmmb. deugmm’omumm ¢b.ubwummu¢hmm thdch-Mthbdcdmmrhmmm mmummmmdmmr,wao mummdhmmmmmdnm ennui-indium w,&ywmm'hther “MFdflumd-Hbybmmmg mm Form-phlsWth-orychhntht'diis r." .IMH‘ .‘C; “raw IrIus-ur I In K-IMNIII oo'-H*‘Ioh If I HIINH‘V I "I .. :6 -n i'. J. In :1 In mu .I'HI'sH I ‘Mlhiulill *‘D-JWI.‘ -r ':.M' .H I I ”him his mutant] Imam ":Il “whims r 'tl‘iltl‘m ‘tuI mlumi .M'v ($31,311 ail Ii§I~'I ;.* HI‘H'HI n'l!‘ n"~jI'I"/'in Mllnu'u’ mIl In MW"? “HI! vl «ml IIIJHn-LHPI 1a! In unamInme w.“ m «urn, Ia 'ulmmh In 1.23:: Inturm I l’iI-I'sI'H .‘DIIs’iiI'if‘ us «A ‘I and-1.15m a‘saunnw no r-‘xm Mn N m. um”; 1 9 all. It- I‘O'ui‘flu‘m THU Erna-mil 'u IH'IaJ 6 *8 , inn/en flu-nil IK'HliPmi'ml mi! 'II‘III‘JIIII' (4" I416 ”IMF-UHF” H" “Hus N-‘NI 1.4.; In"; “‘HJH'HuI I'ropIu :9. mt AI!“ In 'y‘vu'ajaru I _t’9j“;';‘1;,l Ira-In W! In (HUI/(“‘24.“) Mil min-UH; 'H'W 'IHIIJ'HII AMI I .n ,iimruul'n' H {9' «3%:qu "H" :iItiuI eI fig" 'NI ““1"” Imnlu ‘I‘II In #‘InI‘HII‘u". “NI NJ III‘HII'IHJ“ I0 IIHIfi‘I‘I’I 'IIII H‘uII'I“F6 "Hurt-"8 um ‘I'I'I m L-uL 4' Iimuw m [.4529 «u C.» .r‘i a: tum ma .4 Iain; II 591.543.16th .tw'u y MIMI! (p-Is on")! 7'.) fin: is m mun-«42w: m: H 'uiuwuh In NHIIh'HuH‘VH “HIE mi «Mun-{n 'siHuNI) .iu )I-uI I-mfl i .riir-zusénnm‘m In; 1w! .m «2111 Mama: um: a-rsmmua .4115 «1mm! hush-:1 N PHIHII 'DIHHHI) fl'IIII «anviurih;"§ IfC'yJquI 1I'III In Mann-Wu; 101 'UIIQJ‘IH‘WB '11. luv-”Inna Mail In mucurvmiqw‘l dun-a. m: MIMI” «m1! WWII-"Hm WM; ”maul Io was mil .mdl awbuunmm emu 'IIriiuzltiIi away-H.170 :lialnhlqinil » «M dmn wimnvi- .ni-MI 'MIIJ aim” “11;“on In Mr ‘0qu In twin». 3 an aim“ mun-June 9mm?! IMII linub'mI MI: 8. ilI'II" I? Mum-II) Ii In"; IH'II'MIIW' In ’1'! ...- «'3 .‘flf'n ahamani. cl 3“; Isl.“ flufliiis-LI'MII “1;! nl Imimunhifil a: alr-aIJ 8 ni 0,: mm {mum "us (Mi! '5 1M a nun» In vi'ni Mil :3 N» «am: v1:.;.-i n ~aifi will; Jan-I .1 "muiumiuu: mwu:~.m~m In mam-n... dim! 'uil Am: Ind "Burnt-.1; u! ~w’nmlc: «r In an .4;me mm! ‘uil «.I um: i «a. .11 In nl-I-EIIIiiU'i men «ii and I'HII'OIIN 'HHIHI'OI‘J» III '11:” "('NII “(II‘ -l""".;' 13“”: oQI-‘hq Tight: ""'t‘l"'?;‘l'a I t I I ' . -wla. m r awplvhiv 'vaI {II Iruuwfl‘b Wm 10 InF'H'I I Emu“: HI"! r‘oH' WW I Hm! unini- Hr‘rngl IsimIiuJ'niI 5 II .‘tICiuiclflv ‘! I Initial-Wm hfllu 9 ohfiptory'atdb'¢hpunhfibh’,thutheaydetfihhow,inmmsof utihnut,¢ohthoondifinuhmhcumhhhgthpudiate'ia W'nhbbmmthh-W'hmhdbh'. W,:Mflhduficbfiuhtonhkthmnl concept-tom“. 0m,mudmfloum “madman-on. “dehflktflufimm thbtdudWmflthmII-gfi. May-m MmmdMuuMHnMnfl thunmbomdwhcuouboumthIbu-ic mammoth-union. mafia-dumbed“! “Withhmhhbuh-Itbudw The mmmMDBC‘,b,ontbm,-onlyphnbfichiu MMbanbtb-onlwmududut within-pontoon”. Nana-mum“ olDBC. Amudmmbbmmmmm WMdefio-anlm [twain—dot mwmgmmumm’omwwm numbhfinmawwhm,MGbat-Mby whtbtbeunotbywhdbmflyamanm Ole’o mummmmummm, whkhu-wid-tflywfihuyvhmtowflchtbmnlmpb mmbeuMHMHmhhww Micahmaphvmmflkmwmhmmt nor-gm nummbmgmmmma mmmmmmmmmmmw ""1" at: H4“, "'.'-.1I' .‘ ltw. IMH III ‘r'sIIH'nI ”I - «IHU I! ,«. 50'”qu I .. I. . r1 Huh-:1 "I" 'ch' '.’II’!IH~I IH‘a (war-1w»: 'luI AIIHIHI-II H HWY] 'ull .Ill‘mwt 2o. . ."-oloi;~~dto:‘I-'«l 4" um :i "H MI! Ellitllrmv') 9‘ "W‘fl’fiv ul «1;» W1 "numwi‘i- sz‘su .H ”III WILIVI In wl «V'uI 'utiirr-II ‘luI II/t-‘I “HIV“ 8 I:“I‘I"I¢.o),’ ‘H; HulweldH‘n’ In”; ‘~$;|H.I’I wIIHI .HuIIku-iIzikl 1~sdiu|l£ ‘HIH (II r91 1““. PUMII') M111! awn?! 1'uI3'u‘IN In nugimnp MIT m ..- [Lu-m1 9111 In IL; 41:; .uwhn «(PHI/1.0 [III-III II "WI ‘NIIH.’ IR Il'ir'ru chD NI I-Itlu‘i rughll'n" Ifi'h-HI In lr'I ‘NII ”h Hui! ”a IIII IIszI-IIHIV’1 8 RB Ilwhmdal’l’hl IJHB ‘IoIHIImV‘u'I .s. "WWII” III‘V‘VNI II III (.8 [whiniarrrn ‘hI It‘hil '11:": 791]“ “THIN I'll/I147. 9" mm “W?!“ ivoi'ota «I Icifjm Isl-J quI In 5mm»: .llnin:;~~1l in lI-u‘IHI mm»- ,‘mmwv. ‘MII .nltrom: . Itduul '=:ii 1.31:3." “I ""«Iis. ‘5“; Wm“ "III III “sh-mun! {III‘INIII "I III '.vll$tII1‘.‘il‘§‘I ”112.7102“ .TIL‘E'IIC'W “I" [In .-".I .3. "It! .I"'!HEW'1‘I Ut'i‘I-II "1‘ Ir M lull-INNIN‘I Mo. rug-Hum! IthII mil In] mmi-wmlm «13.33"... mi; “.4: Inn-.i. '1"an 'uimu'tir Ir ‘uII ,-..I.«imu.t§a Ita.-.t51;'|u::‘ as-I'I 1‘tIIItflIh' mm ”I Io-vgr-o'! {INN ’El‘} In 4? mutton imnm mi: «mi-v1 01 wt i’tll‘fl—‘M 'mm-wi. In .II'J'J J53 1‘ In I ”first; HIII FANJIsNYIWIR liI J‘Itu‘l 'I‘I‘MI' ‘MI-I 'I-‘D It.” “Has IMII ’I'ti'fl'r' IHIIMI" EIIII-1?'.:‘s1 “13111th 89110 P'IIIS'IIH'II ‘IIHEHIZIV'IO «flu .Ii]'ii!l!§z:I":r:I! J'IU‘:II? ul Iwg'u'tgj-n vi 1” ’I?g-III'I ,‘(1ulr«1j.?.: 4 ”11;" 10 .03.. . mi; «I u] Lima: 1min hm” om» ml: {Lilo-mug 1n vim-van" vi Jwiu 14 ‘IU mm» «I: n. Imi» Hlm’ffllsu‘.“ 1'13”! fl-azfshiu’zmnw 6 hszu/III "IIULIMU wmwl %'!III “I unxuyo‘a w g-num [Hum ash II. MEN m Hafiz-Inn's; wail urns dtiu (um-M 1._" --~ {IMIN 'Iu Irmi‘nio mi M Ma JmI .w:iI-all'lirwrw"! m «szznli’lq «so; Inn-1| «J u! find We" i'W‘IK‘P'I 1m. III 141' .IIZIILsaIuil'IB .Ih'IUII'I 1'311193‘ «Us [I we?" r? {-uhn u! ImmIrd 0/ ' 4:11an .: rIlI'Ooflu‘ mil fl-r’ivfll'hI {anfiqmm s (Liqui- "I wimp"; "'qu AMI II 'Inrw-‘vm «by» mm lubnm nun-m; mil l4!» ,nlntamm-r... [um nua:;.-;:.i~ hum: P'w—s—u-m 10 udpouibility,nlimihritydbcundbymdiwallogicilu7. Quench Wbdbhufluthmmmdwfibfihw memhu-dwyumwugmma WWdMVflbmhm-dmud nation; "bpodbh'bWto'Notncuu-ilylotflhmy .oddhdqud'¢bpunwb'bwtlyqnmtto'ltilm mug-ctr. “Wmeuhmith-of fibuahgbmpflothflhbk. Annamthuhpthtth mmmmmwubwwm mgw-denw-hmmuumhm WWflRMbh-lflow-fifiuu 'M'umthwmhumkmdmddbfic udfififiodnontkqdu’onhmw'flmm kWh-“minim W,Mdinlopodh qubufimwwmmmm “Wmthmmfl-dwh mwmwuhmmwm. hminthtbmmtbdoo-ficudthm mmbW/mm-ammu “emu. FuMIdomWMMc-Ibw hu-dem-ahhw'hdhwm Myahdbdhu-dmdyudm Hummus dewbhmflpmhuflm muMmmma-uhmmmm hummfibmbabdumh-flwthuhfim Mmbmflflmm Thddhtddd-oaticlogicio thmtndadnmyuwwfihm Iain" M" flu-"n1“! IV‘WJVHH Id IHr‘r‘HMMI Ill.bw...nm b .lauf'h’xw‘] bub Itaihisvuul '!-. aura-hula» mun->- IJnII'lrpn-n m ILr-Mm «J ..a haw A Ilvii‘luuv nm‘ lam-J1 Is (321” "Minn“ lulu (iir/‘O'I-vlil In null-LI m (“Nix ‘vw I‘nfiN w -h‘ mung-mm lu «M's! m (FUN 0!! (1 MN Ilulflilu‘l'sq In wanna-3b ‘thlblq'n‘nb mum at "-_. hm Jié‘sxwwm lw’" n! mun/mm n1 ”-.i.i.».«-uq a l" .u-nmwu Lu! .4 1|" HI Jainllllém '~Ii.u~lt-.'§~!fi HI "'03.:a..aitil‘!w. Al u... l'flh rH-r'l ‘bioa.gg' I” IIHI‘EII‘AH'YI I. nlifi ()1 11111310: "’18 alnflzrui! 45111.31 ,".",5 Incl 11“.!“ l'tulle-JH 'Hh 134i] {$5.11. “knit ,{ilqg’z‘ifiqaji .)§¥.j:‘ d": M" 'ti'i;.jiTi'i'b Ul Céwiligifi Fifi“ 35.” r'tiuibin'ul 'Hchtib’. ‘HU idle; Rugnuufi “(In t] "It! [IV-Ill‘ui ( nimn: ")iltuu'flrhz ‘HII m smitq 1:0...“ 1m“ uni-w MU I“ ruutlml lhh u] ‘tzli 'In '- mxui" 8 chi rib 4h and: ism; lmn'una aim #5 mi m unmit- wi Mu avian-5:35 hmmwuu‘ WM. Minn” In "mini.- riovfll ‘N'IH’ Ili rd'i‘ntuml ”EMU mil Q18 at; "mnuum" uh” Hu'lfl'iu'! [MN Jd‘uaIiUJn'fi " H'fl‘oluu (Mikel dHl‘IVw. dad-1‘4: 'MH hull 14% .u impinmi» «Ms-um“ .1='vnm1n§£ .lusmua': is [mum m 'miqiw Him“); mumun-ui mil the“ «(Mid nth! ?’-""Hin3fl'0"il “UMPMJHHI ‘Jtllinlfiiu Arc! la‘ll ufi- {11” A.“ M? inflflfi! llflfi «mam; I.“ ‘J-U’li""l(” ‘Hil Ii! Nah} ‘nli «"H'Owln) ins!!!" Iiinzpi H'wunn imnm Mil m lcul rem man 5i! i viii-sh 'q'i'llll"«l'i*"‘l Midtifl ‘51:: Edit: 'r'tln'oil mil “wand I‘"1‘:::lél$tl"':t ~31 luwutfiolq '(III M Ml Ilrniiifur'fl l‘iul‘xhi 13m: Is -‘I- l'."~:t--llli ‘nlmmtu 21:11:35 “ml «Minn. f‘tl?|t¢.:a‘olll imal‘ Jo mi mi"- mawimz-u 1.: {I wrahi lean ti: I .wiitmuitm 1H1 .14.! [Mt—i w in" 3-. runodn ,InIp-qggua naul Ami rs "why-Ml in”; unywqiiu In ENIH‘OI In all .‘hlu'fluU alua‘llxguu bum 'HL-umrm 10 «um! m Irvin; '3: mi "M «with mu; .m; Hi 19m: imam u! a‘s-«im‘sm lmnutnnfl luv-'1'! P'il‘¥i§i§i.sb «mm in ‘atzieiul ho (hut; “I .‘.;:'iia'ln’rifl i--Ua‘l.;t;l'l a“ l-IlIli-D ,ES'l'f/I I‘M") "1b “.1“ ('Il"ll""‘!6 I‘ 14.3.1 ml! lumin lama. "a. um In.“ lit; a! v .umu. «:JJ k'll.u'luhl “will In -. w J "Hun-It.» in 3.25: lime WET .41'3"i15= m tannin-..“ i-mx it :mu ‘MU nmmwi . I '. u l I’Hmhl‘l HUN H‘¥":-h 18:1! L'lndb‘l In mHh-ll 8 ‘l-l'Ils‘fll ('3 (‘V'I'fll “MIMI“! hwv ll intuitioutbontthotelhbilityofuglmmtowithmorducfipfioufior conclusion. Itwmhmwmmndwfivomiolhflnm WWhNMNhfiifinm-huhthkmt. 8. BOOM CONSSQ UENTIALBH AND POSSELE WORLDS mamwmmtmmmmmud mwmnwmumwuwwm mdmwwmmmwmmw. MthfioWWhh-mmd tho-«dwitdoamtmduammtbdoouk :31!thth W,hbMtMIo-onlmptl mummammwmm DBObnppoood mummum-m Thad-diving“ muchmhwhmwmdm Wflfiufithmvim-Mdth wwumbm MDBOh-nnhmhmdmabmd WbmmmcwuflMdfibfi-m Mummdmusm mun-animation thmdmumnhedthBCmufiuI-dw, M,Wi“d~hwm. htdfinly,tho Mbmmfihafibwwhohhhmmm M kWh-“,0cqhbfiowudotw. MRMhmfidmbH:mflw0rm-l w,ndthtmbntnmicdcd Mmtwill Hi n..'lle'.|" n t‘a 1H u'IIH r" ELM-'1‘ H "0 IIIH H‘H‘I‘ - 3. Huh; r'un- I III ¢ . I I 0 1 ' “Jun! 1“ 1n. H" "nu-:2; '1' H! s'w'l ‘zcllll- d ""0 2“” ”Wm. '54! “ON I. run. ‘1'! Mn- 3: "u ‘11qu t. 1.! m wan-31;.» cmmmu has «Manna;- dud m «iiimn aurmuw M ‘t'A' ! 5" "13.1311:er W H 11.5-1.1! Y‘; 113. it 1 /~I' t t ab -. A .c I” ‘H' L-g.‘ lung .~.;||I'il) m“ N'hulu‘ l'.:.it-‘u~' In may“: Mi.) Mi midtu'nffl >31! ml kiui-‘olis hm: Havana.” 11:10:11 mil my Iii-ins 'L; I .resi§§::im.‘ii 'ufipis mix .mr .m-‘I It'l'mul‘ifl flrk'lw"! M I; mm min w win-1 wi Jun-nwrvfl Emma! In robin 3w u-utuifivb «Ninth?! Hi "I h'oiIJNunn ’miMh: mil [In wi-U'wg'tio 3| ll mul‘U‘ vliu ab "Iii! fl‘eri‘H‘ .“JLJ’IS “8 fl” L314] fb "In (”Ki-ti H 31'3", 11' " “111'!“ ‘HN ,2; - «Ion In: m on .Iwil Imi mun «i H .rwwv‘luV .mtré..i«-m -..-is-.|.. wai' In"; F. omnyullod 4 £11] Irma] uniq (“gt mm hum” mil In “MM-moi» mil m “cums um Iqu/U'dfl-‘fl "9LT Magician.) m L'siuvitii [.248 w‘nl-nlrfl Jim‘luul 9d «31 ml! In winniuuudwimt lv'virgrw'us'u m1 91>" ui i‘*"“3“1 N am I'lé'lii‘mll'll Mi! ml In luwivll'vlaimi awniau 'msm «ml Iluilmfimn'ufl "uh Huh Ims "mu. .3...“ :« .1 .fluéhiifl'm‘fi-i 5:11 ‘lIE'J‘UOiiI Hui! rim‘liflq ‘Rflall'tfilflut im- m Mil 'tu Wadi lit: m'mivfl ii 'rimimulq t’Hmnm 3i “NJ ii'.t|'uii;." ulailalvuaml r” HUI. i1) ‘Mub'rh' Lam «M‘W‘aln's i: mumun 'maom. Mi! ul Mq'Hn-n .«amuml lof'lumszun mil .(zmlmulq [mum MI 10 '41: >15 -tm whim-"H.212. 91” an ‘u .quHIIV'vu-‘w Luz. Quins «1e; QJti'Z Hi m lvmsion «'1» Arm. Imum WI “:53 ..Ii°o-'iii§"1li Hfml'n! 10 "Minus, to. your” m u ul‘Jfg'w'U‘D'l ,{iial .14qu >m. - .m, um; [Inilsvdidfl q‘mA n1 mu: :im 4.1.! law u m ‘m.» mad-w.» u] haunts mam-- In 42ml may»! mi! av! um.- .. Jon-M7241;- nmi 1'41} an! ..O'"Jlll"'lfl H-lfl'" I” "NH” 1"" 8 15 "ii H lltni'élshr lam! ir'l"‘|S ‘0‘ .hi‘i'ul N .l-‘OHUHO’ I. N l-mcnm u, a-ulr ,“s 1wfl8 'u! [-1.1]!th In“ H! I’I'r'uzzi'm ‘flfl' L118 ,mvnnu» ___._ ._ .__.._4__— ’-I-.-—=~——-—-—w- - l2 bed'ncmedhterudrejocted. Whmwjoctmumdtbiomw VWWWWOMbWhh-Imum (ubmmmmam),nacmm WdeMhmOfiwhaMI-mtudfitm dun-in MbMWMO‘WmeN w-Wh'fibmflcuIMdtbtn-Odhbw «M'abobfipdtobrhghwthflf. hath-mm, mummmuummmma umtdtbmdflaumwdhm “huuMdenfibsfi-ficflm BIt,DBCdounochboobbtio-olbhtu-Idwhtmh MWM- Mummmwmhhflbm shutwtahdubdmufiqmobbdhhh‘m. For ”fibwmequMchouto MtcoIHmmtho-clhwcodon 1‘0th mfihDBCdIbathdeaMfiubnhfiwto kunpuMhhpMWthUa-“Nfly Ill-hadn‘t. muumunwhwuum dtbknfiupthcipbthdqnbmuhohbdtodowhttbymdo, hum-Mwlhchchtc. Ithadytooqthtmflytho mamammmmhwmm thanpouihbhtmmdduhhtomt. Thumb-h mammmammwmmma tho-Hum AMMhddanthDBOWd-odfity. mumwmmwmdm, I ;'~, *‘I N.- 0rd.. In. 9 .z .44 mm! Hi.) In r“ .rna.’ "o’HdL‘jfl 3 q» imam; -.»a‘.‘ 3:9,.” ruin-.0 r'v-uciu v: arm uhu'l uJ rum any. (a! wuiablm \J ‘lnlatl'ugu I! unw-i'iu mil 't. MN Irvin I'oxéflnb'ri'l KL] Jaul'slri' “hid“!!! :ihLES-utl E‘nn‘l“ “Whit-ll Kl VJ»! um», 8 6.) lulu 1mm; m: Wfltxlt'ib .. Wmi v n: .H mm? m in Mwuw'u-m w. row i WI MI "US hwm'olu'm an!“ CA") J'Hl‘flfilf' urnml» nimmuu [u rt "I‘ll" :4" r’lmi.8 in hi'] all Ign‘) «3/! «:16 L) rm: tisl'w‘. ,“i‘luh‘iglju at -, In] rl-I‘nla-J‘lihii Ms" Lam] nu'ucfsti'in .rhun T'WE'U III ' a luil w ~73; ll .' Mui u! i. w. i.» a: 1'” .l-«M‘I "1.»- ‘H v'll'H‘Ifl WEI fl‘vNH'Mi rilntihi‘fl 3'6 LWUH-wn nus “li'o’o'n'ltl‘ni L1H: 'wmiolatis-ul ”new: ‘M‘fii! In oenslhu‘vll‘v" 9.2.5 huf‘ -'.s.;'§l; 1U NHL]! ~12! L1H; ‘1‘L8 "6 1m datum unfit; in mm!» in vhowvw as no uni! 10w” nm-r-u )M‘N ”m nmlvl an (inn "mirth“ which In" w‘uvi» #393 .mu :HHJ u! I”... II“! 3ch N8 IiiuZJHlt! ‘Hli (HI. an 1(1th #1, .ifl'J‘oi Edit] bduuwt‘ 1w} .m-ws 111nm! m [Hui-5...; Wu; 'Ignil um waft”; in 1"?!th mam: new». at r’h 0" "1H! 0! im'gidu no." “wimp/T )Mil mm M unuumm a u .i gml. w v'thlliu' 1.] hum'nb u] “a. ml: at Ir? J] wef 15 1.- 431 "um "Mali-n b luau; d ‘D'liitif'fl ‘lfn-w mu Jammin'lrz as aM‘r-uu'» iMum mm “with: '1 i ,duil mid 'Mvrwl “I'm“ ms Imiu u! ‘sJQuJ-s'l Hal ,l‘lu-ifi egn'm ‘Ii:a;lt?tls Jar-.3; m: "Jr-.- "why-mu“ 'i'd‘rfl lrujuhl'ib GI .38}! “Hi! (“gun lull «Ml! an” hamib "39in“ .ui- an m: 1min uh m l‘i;.i~iu {I u: ‘m. imam; 15d! wiqivuml um and mi! In 'nil alm'mz-ms mail a.» u} (in!) ri ii .‘I'Nhl 18"") "vi Hus mu raw-our: "-3 "min? )lludiifl b-ni!'|’w-..-1a «Hi .(ti’ilh) “hull.” v.3 "uucz'th In rmqidmn flint! ”News ruf'i' .mww.“ mm 21131:; in Ffllbh lfii‘iolulual :ll‘. -ué-s;.~~~t "'2' Tu 'wmi um r-m~;';:tm1.| .1qu mus-Harv. mum; in 'n ul mi; Am in" rump"! r .5. gulxqfl 'auiluzn ‘nil niistuu m ”(91.73.9in V1“! mi! menu; 'nwd imu ui inzmair ia‘luo’l I . I . ' ‘I 1! a I l ' -«:.l h» ’91:“ch "‘|"".’.[' Iva-u»; mun-Irv”: "4'"I-!”'l’l"" ll'v'hl MM "mm: 1" _ 13 upechnyuthepounhtiondthenutitiuisveryh-nitfnlintheuflysisof tummuwuhmwdofiuw minim-£60m Mwbmpo-ihhwodbaxbtuduo Mthmec-tmfllym ”mamm-Puwv-wjuhau¢hmham oupadbbwoddaul'flmflyfi'uhuidhm‘btruh acrylic-duvet”. hW,MndDbdnr-dclmu WthM-dbwwmmu ethic-uh. mum'thu-ujfihm¢b "bundmwflhhund'mfbmjdhmfih “tamarinhuuummmt. m» M'M¢'bmjuhm¢mhhum,bm mudhmphgbhm'Po-iflyfi'bmi-thmoti Whammmttufimuhmtabphbhwu mum-ow. Dmmwmhwm “to“... Muchitbuh-dm [amalgam-3c “mmmummeMm Winthtothnchflwcfl. humuhww “wuhbubmpodbhwaflhutdm 15m dthvhwmhqhhdhmwvhtbmtm WWWMbdhc-dhmm Mubbfi-‘Odufiammc-dhcw memwmuuumum hehrflndwhhdthbm “nu“damt “Matinee-110d”. “Wu-chant whflbtbmmflbdhhhbhdmwmcbduhe ubmmmhmmmmmm i. ‘c..c~ 17% c H! I: {1 'x’c &r lel' ’ I". in HM!" o‘i‘wzi ‘IH- r't; H...’"‘»- -:»I up - t L‘SH |-. |t‘15~"l unit ‘flil "I rh I; IN In , 'HtuJst} «mi: 0h. m; h .‘ l-cn. "i ‘0 «LEI-1N ‘Dlig wwq “(Wind 0d A! “van“! HI.- .“L. .is n] ill-2', E ll'ol: . :I 'Uilsl (it indHtIFU'D .III'i On :ti’ #i‘i'NI” 'batilr flu. .fl‘IrH‘I'HiI ‘0 all 'hdlh 1-4 H1513! I.“ Ilia. u i” It!!!“ "I“ In isoh‘nlu't' H. v! or. m um) 2i (9 mm ni Lug mm) as ”J (liznmwu-n." hm; My» WIN/(ct... mu. II: m l a! w Cms'n m Saul, cm” as mnu'l-i" In mnniui‘i l-‘m "riot-2:?!" J-JJ'W'” M iu'mu "WI-rm] a.” ’ltl‘uunlll [l'rtNi'k‘ “HUM '1 Iu'loulan‘fl mil It) with“ m I‘M-liniwnl ”oi; i-W-‘imlb ”Q {Mia-v"! ."I " .r'lfluiuu‘i U} Efiziflg. ; ..' .r.a~ a’“l'=!.!i 'ch .. «an m Ji-IiI mm v.1 a: M. won m 1,111 «ml in "a. ri-teuu'l" hm: 'HIH «I in» M. Lin inn; 'vgt‘Il wuu N ‘m'w‘l-Hi ltl‘nrhul Witnai} “Mn-A MR in“? ‘K‘ {5‘4 1H um! MI] 109:?” mu: 4 Mm mm: (and é'aauin 1;: -. s" m I’m mm! at ".u liflw'n'VNr " wilui-uI. n (I , was": [Ii Iraq ‘ili'tl ni m ‘uiigw. 5" up 1 m1 u: mum}; («H.418 ed Lug gm“ It} at!“ mi 0| 3mm}; 4 1n Jtl'mltml l‘ciihs‘i mmm 06 "NH MAN .Nntl ‘mH 1»u:11‘i olhwi Hfhugm‘u [ll IEJMMIII 'méhzs 4.597“;th hi'l .hll‘mlum ‘Tlillifi ‘HH'V. 'J‘ilvin In 4215.941”: 9“ .II”!iI%lH'lii in mm} 5 2i u Ii mm H. "omit ul 19.3.3111»! u“ “2ng “'45" tutu” «Liar/1n] imdmm." u! '9-4l'v.;i-c1 nu whim" {Luau-u.” i Immillum «i u .mlmm 1M!“ ul .HEUN hum; ml: m 11:“er imwsmul I‘M“!!! NH~ 3mm lm'hb‘ mil .ifiywn "MM-ml 'mn {in-n "vel ”1"in Huh i-ui'ui “Iii -In'nH uumhmhm mil “will insmit ‘HHUI m INmHH/u mi IEHJ nu: mi: In ."HHJ I‘fltifili ’ fll L's/r.“ will e'l 64“”;an lbllflu] ‘HH halid‘fl‘ ivuzczgi‘u mi Mums“ wmiidmm nmwvi; mi! 1511! inmwads 3i #1 MM s...' ‘Hllslfi‘l Nani mun-s 1M?! twin Hui (”I‘iitjunll twil'ois “N31 u) ‘V‘llln'w’! luminu 3.1 on»!!! 5 18 with hrVJK I16 Ind/l .‘WUH'FH fill“ “Nut!” “"11qu ‘td 1w! uaal'l'wats imvwniél'flmm'.) ‘Ni'i' .Ifmfaul In 'w'zmn Mi! e‘o'-l!‘i!':31ll (i-Wilm'w u. u‘ l.- 11. lull H"“-f“ «um». bud ;-i ii mail 1min» mi Milo.» mm: m?! at In!» I“ r ~H;F‘.O{ tl'!!?t€‘..;titj xii IIUIIQE'I'h-h llnIhB am“ hm; "NH! liltl‘fluq-u; H Li l4 reliaoonmoddityinthofollowingpmution. AMWhDBC’oWdthdw-ficcompbh w-m Nth-WWW MMMNMMWbuouma-or nub. Famphshdmmmm othbmfihmhmwtmmflm dflbmdthpfidefl-pbhibmm. hmDBCMb-Mtotbmdtbmmt ummwummmwmm oftl'nagatthtmwdhacttm,uwaboflipdto brhgitsbouttht¢oulyflahkwh¢ammtynnbfmnab m¢gbont MMbMIM HUI“ ".n H, 311‘" J. sic w“! H I guild“ U f. 4-. ~ “0 A .HI VII) "'ii 0: II' «It 03L] ‘ '7 «ii I” 1‘s"ll-" Inn I '- I In.“ -..;é:l n5.» m'ahil'u‘ lam mil «I walnut-mpmm .) twain; - l¢ - Wm .mrvm. m avummm 1|«1‘i n! ‘IIH-‘J‘i‘l {I'Illwlti't‘l't r vi l'h; "hl ‘h'luul list“ ‘tlt-l' an ch a; nail "fltJ ”I! JH'le-ULLQUU .quluhllfl dip". flu. in “Nu-3 IS 39"?!"th 'Ih‘ flit-4W] uh.» I‘n‘l‘Hn kiln” 8 WIMP-1‘1 nus' .flc) all ‘Drh‘ (I! In” -’icfll‘{".il.iu 6| llul‘ '5‘ [lb nl'urvmaalu‘t an unit Mu“- r. iix In wum'wh im: mm mil in mun m mm.“ in |.l'°‘:r€ Ihi|i_u||f' W.“ In "HUM; “(it u) [1"]??(a';.:tl w.\jz,-.'-! ;.I .flsrlu‘tgitlus I}; d‘nrl‘Jos'lq 'VHI'U H' ri'hiln “JUIH ‘Hi-hll‘fl'JI luil rt”: 'I»."Vuua 'H‘U filth?" LII: u! “WU-{n ii 1‘ “5‘3“ I!“ ."'i l 5 wt] i" ?'0"i!‘illl"~'ll N ("Hi ”"1!“ h"‘e$ r1!!! f” ~. vii-"1 (”awn Nauru-r; HadI-v‘t 5‘ villa-I (I r it litt'l (V Héul th‘b '- ‘flrl'l .xi.ou;.-I nu iv. 13”": "mil (lulusi can” Mn. is. 2",: :-m ' Int CHAPTER ONE TENSE AND MODALITY 1. TRUTH, TENSE AND DETEMMI Thdouticthoubdlafly,mwmndthhm mmmm Meniscus-loud“ MtHded-WMIbmmNth ficudomaflndeWdththu-y. Thu-wan MMMMhthdn-udnbdw. Attic m,thdeN&My’IMh¢-mm mMWthubm-pddthmm-o mmammu-mmmmmm'u included. mummm,mmummb Mszuflabr-onlucrbfio-homtomdythb my. “thmwmmwm mnuwmummm In mMMMi—dfibm-anmmmbhm bytchuuWMthqmwhwu-ymflbh Widdmgmfimdthmhmm hwmnbwu.mbu.mw¢mm MMBNhWhVMflflth-uhfid, vh..hydhhyh¢uw ShaDBChmfic-Iymm mob hath an 5 tel-III d M m h punk-ibis kW hthm,3d*(flm.mornb muaMMamehApp-dkc. 15 3/1) I] 11"” H" TlLI/flUI/I (III. IE‘ff/Ili” .3}. :IH‘IIIllIi 1015;! INNS ,IQZ‘fl‘l 1.; ”HI ,1§,..}/ In '9'": .' ”Ii. 'Dil;i_u"il ”a V fl"! Mm rum “9“; *4 mnmi- .i- Hum-~14] 113:“. wv: 4/8 W m n "x. ’ uh' 9' 'Hl .lru} L'Hal N" '1‘! 9'1"” fiflini I”! [filial Pit N !” L! n .3 Hill-’1!" ' "til 3:11.»! M'U‘J :1 ...' r'v-vuil‘ J')-)'--i_l 91” in I1"!'!"3 0'97'i'1 "‘21'1'"€"' 1" Whit"! i'l‘li '..-l'~i..- S "1!" ML! 815- ‘i'wnl'vl'filll in w-id'! in”; r'llufd “h“ MINI} urnii 'IHI-Mni' J~' inh'I-g an lfl-‘du'w. ugfiligdul Irojxls) A fit M13] ‘1.“ h.” N 1" Ib-Uldic‘? 0/" With“ isrl Illi ”HI-I m: I! - lulu-Wow "I“ in “'st :Hm;.!1'or Min wzl Inuduruuw mmio. w: w an" hm. Him. ~18 aw "Min-w t-wd' Ii mi N m vuunmi: mii in swing-t mm -o- s c-ml Hi ”-va ll ' nl an! n sun-sin.- 1~:I..-=~.- I" mural Iiéuw H! 'rluif ? lulml mi: dam-q at him an flin'EHWIS [slum 1n} wwwm'w lism‘lnl s w- g-a-Hm 'Hl‘ iroihlltia ‘Ylu kn ”Lg" ”-5 ll Ntlll d air; 0 HI Altman}. ”fig 1 .u u .6} .0 HI .rumuwmwau 1:43»: ~a‘us his “bluish”! Inuhnx-‘uil Mr H! Irwin r'vh mum «J M tun-m "1B r'mmm'w sun 245:: In mnuwit [rm-1w”; Jiltnl'fhml'v wE-Eé'amn-u) {‘I'slw Ill ib‘nlrtuw ‘9"; PM! lmil IIHIU-‘P' mum! 15.5) s “I ru‘wl h ”In” ('bvfl'flgi'm ‘HH In [Izhl'lblloh 6 ‘JIIH‘IJU ‘1) "WM-.111 “mint-mg! ‘-’-?I 'wuméa M air Mi! 8 Ina 8i 'a'vcrnuv s Imil iv‘aiiwtiaiiétm at n ,llnlei'ii} 11-.i:..-w all am": .me zilwswmm «d M aim? u find» m u ”I. labymnu mun». ea «1m?! .Imil mh’ Iroiu'wu'] liih'll'licJfl‘m rel hi‘l wum’ .i:§wtal’1vlaslho‘I 8 Emluvitguit III .:\a: Hidiwioll'l‘k; m "turf-E- 2H" I.» v‘I VI”!!! in «arm (I! "H. [II 91"” Fistula] 4h”! In ‘chlu'ia 8 mun-wwcq (d 19TH.” 8 .19! mil [Ii .r‘llfIUlJ'shjo'oiIH - I . . . .. ‘ 3 ’ Hun "l‘l" Ill Al .‘JlNHIH‘O'IIHU't 1H lurlq L’IIJ ”Ll/"AU b In“ r-H, -:: m .—— -—-— w—w _-—-———~— 16 Thomtutiondmtioubrhndmtduomicupmud nkoguvmhgtbbmfihdwefl-mbmubudmmdDBC mbhthondWMM WWI-preceded byuontlhuhdmhdnhgwithnmmlndshcm Fol-mphuflndaaukmm Sinihrb,hdicatou mmmmvmommmacm. mmmm-fimumwwmmm “mutton-attic... Tho plantation at th- at... b Imb- np into action Whthuhuflhdbcuhtbmm For mumm-mmmummhmm WmmfithT‘mwfll‘mfio-bw. www.mnm'ofl-Whmhaldmmhmfl wmmwnfilflwm'hthmflmph new humdenmmppo-u mmmmnubummmmu nodutolocdu. mmmmwhmmm mammmmmaw-m mmwhmmqubI-hhhtbtywd «mm-dam m'mhwbyam dbmdmumwhmmfic mammmwunmhm dedMWhhfl-fldhflu M,whmMM-dmwhthhuum Wanna-aha. W,fihm¢thhndmmbomfuin¢. ThqupudkAmtubnthmmh-dfiemm I u .«w ».-":’2«;‘ n nulwli; Il-I.I'|¢31‘NIOH in] aunt-n- 'h") H'tuh‘lnn mil S ‘ 3‘ 'O-cl"‘ll' "It" WCilloé‘lU} "Ntflvi .‘ H4 in mu'fiuli-ol ‘NH “'111'! '9. "“3!!! w my a uninaulluhu 'ril'm‘mn. unwm Junk" ampuud 14- mamiJ 0}..."er nu H" N” J ["8 I II'O‘WHIII ‘I'I'JNul I”; I“!!! mm.“ Md 1uzfi-dull Muffin) m; It. In ,. n: :u fink-ii" Human-1‘ 3m nay-4.11118 issm to Luci 3.0.! .4qu w 1u7i .nmu .mvw 3i "i: Imuv. 151mm ”1.1:; n14 6! in”; T lwwuul n1~2_mlll IIIIH unnuuirwl )hbul (kl Iii!!! _‘.:Iio’|I::§~.'-ni ”3"!“ has «av-nu“ “hull XI shill 3-1311!!!" mi "A.“ .?“M“tiil loll 918 In?! r'uiwill‘v ululJ'rw ulna 111! || «in'hi (I Ill-Hr I» ”a“ '10 flut't.ul’tv~"0 4! "I” ml uunmlhlq‘s autumn-i mi! m new] to "Minniloz mi! ul ”mummy-«154': mm =' In} vnuufiouu. dIEJ‘II in”; azzizmnoit h‘liil‘IHI-‘ii‘fll .cnntm ruin nut xii-mum'- Jr-Hlsvai. Al Ilnlt'lfi ‘H‘uifl HN'; 1"!ch I III U‘ HI‘M‘Hq *I'H.‘ Htwlirul Iran “sum hJ alluxlsiulu'l IHIHI In”? a-Muunu] IIHIIHI- .‘I‘IM .r'lnhi'rv-ir .1 Huuui (“yuan-p {5:1ch unit 'P'I'HIN 3H9] Twigmi ' 5mm 'rpamnwz u; an Mum almlt‘ll‘l‘vb‘ wwwqqn-w’n] fl'ul‘vu'. h It) "minivan“; "sail .P'wfi‘i In"?! Hi ivvoflv'n'h "1h "i «Ml-gush ‘ull Huh [Him lm JIM «I H nv lam; rtlult'v‘v Irwlu'vwrg Jimulmm mum: .‘uiai'humlpi 1215: M «simmn lim ne’ul'r'm dual him. tn m: [-16.01 io'mtiu‘l “-DN ‘0 llvoiiuullui "Hi! ”.Hlli't‘tlug .mim 'M'vléiulr' i'llfl HJIHHIH} in «'MII 'uil 1u'i "N‘uhdrhO-I' rt‘ lwIwomi ‘rzu ‘uuud 'uil "WHEN .‘vn'mnlu'l unmu mm s M 1:011:2th «d “an Huil‘ "mum-1N: u-n 1mm" ammtu u: nmw'm Wit-mama l'vépiv M iwiammi "ms "-13-! «ummlumnwm in ”truth?" m" in MIN"! M .n-J's ~73»ng 8 Wm humus/w ,‘zuwl annuvml 9m ‘4 ruam'I-J-mmi'w rm'm'm] Minna—«43"; "id! 11.} «Minimum mm in .rm'iwillll‘fi'ii'flsli menu In "-cl ”mad M“ u! Ir-Hzi-ri rue-”Hun" l-fl}; R‘vwgil ,fllw'lq'fltlvfl ‘7! =1“! .li35'd.| i- ~tl'w'flt; was I. was: v." unhhiunb «Q "3‘... “WI“ 311 WWW“ “din”. ‘N‘i ‘1) Jll'I‘Hif'ta In“ .liélioollc!‘} ‘ a ’ . n' NHL-J *m‘zhrl ‘n?! In u'oHJu'wu-“i [thn‘mp-v 8 rltlhln‘n 1- VOL. «ml. mill w_~_._ __—__. _ ____,. 17 DBCbuedonoutlinenumbu-I. Inth'nuppeadixtheoommentuyofthe “Miami“ AMBlbhdlthuuudmfln-QW, mh-huthm. WehcghthWbyMthm-WMd actuary. “Mahmm Theo-fluted» HedondthMcthm NMVNWW WWII-Nicotindmhnmhuthm'om uummhfihMa-MWMbI-ufly “Muhammdbmmm. WhMWWtfi-M'Pflflflh mphmntficMhMMtbyfiomI-oufln thdDBC.‘ 1. Academia-hi: 1.2 Ammmmpwrwithor without-haw 1.3 Conn-diva: 1.8.1 TNQWW‘I,A,V,*.”, Tud_|_. 1.3.2 6mm (Jail. Mabmdw-mm Torahntothe mm,tbbr-IbmmduuflchId-|mof wfimmdeMbu-fianm,br “95"mmdw'udwuhhmpb'm Ibo“. DBOhnIbMWwNmWMIe-lbmpubh WmaHM-wmnb. 8.1-3.3cahothoqhtotu “kWnth-WM(mhl-uionin DEC. . ‘ ‘ 1 ’ v.: 1 I|.:1:-l.q.El.l o”. ,‘iHn‘it. J“: "I "1uv..|t|| -11;.13~1 .11 [H ... 411' 1.. u'._gl: .-.- .31 7mm 14'... c"?r‘,".I! [in r! 2. d IMIH'9'H‘ .lmimuu H Ix. '1 Mn nu .‘ii! Iii'nihilu'» ‘12!) ’11:: .9! tin ,1. 'l an In 6 Unbrlc-mII-HIHHI mil spun-turn! (II n-onbtlvw‘ml WI! all'wl 'H ~a.:l '--';:I:J.-uu'a ‘lw'u:I r. @gllillul 'thllHJR ‘0!“ ‘31“ II‘I'u -. In} 1...: ”Ind! ml .- uc-igi'.| {1; ~11!" [131” "2151395 7' : “Mind «I: 10 fl? rib. ‘rlll In rli'LJ' d-li‘I IIV” “'lslj """I' "N II'I'1;I«’IIilI ’Ih ' 1" "11.1 I")! lr-r'-- .H] ‘NI ’1:;Iji,~.0 .‘-;)-. ti Mann» A 1mm nin- Ni il't'H-Vi [Us ,whgm;.-n um] .14!» mm“ Mai ’H'wl n: I. :II‘I PMUIFIIUI ')l§li~:"8 WI! 3-: 'méw' -. ”t. .~/i:.I 1 .l '91!!! wanna In} "I" I-tus "I" lIv'I‘le'I ~51 -._.{éi «hmwcim 1:1!I‘ii’ll'lf: "CI' unminis'mi ‘HH .‘tluntfi “'16 ”II“ { III tI watltn .aI-AI‘AII “I fiIVItaIl ‘1'“; In“ n.1, III-94.,” in} In album‘s! 'um um. ‘r'ziuuwvi mun / I .,.,, 1 cI_i'1ln'hIl a. we» r-u-IJ L-"t'ul‘bhl‘i". 'am-o-J kl .rhzil'ui-Aillr mum.» "a‘oJH'rmuu I c. a .‘ ’ .' V .A . '"'/il'r°|1o1n I Ia.rq-nltq.1o| lijl".i I... 2 m... g" \ In)“ 1 .1 'i's‘ aboclsizi Yiiéi‘ilk'h’ ‘. I I «H .4 nwrn 0'1 r‘IlHH‘P-I It't1t-IHIWIIJI in”; rt."~u'HHI m: 'm: 3-,, I '1 ”Hr #031111!!!” 'nnptiue 'lu v‘bu’iuvw "Hu. mfhuliul ‘11“ .l'raII-Ili. In...’ .z':I: 'ri .‘i'vd new». a “wig-m was ob .81: u 14.6-41-1 It: cz'rvui'wtp‘w humor 1.4:“ .5111" "I“ ‘II'HII'./‘. 'haI .HI! Hui. H's-unu-f‘ww Inn‘ ranu I119: .‘flHtIW-Ir'? .‘etgul'.’ "7 751‘011‘ 1.1-?! untidy}: “.4111 ‘t'lti I143” ‘vui',-.HU' om?! r-Ja5¢iiz;l=‘f 'L I .“sgraIr rat t. '-.'.-"U~UI* WI :11? I : 10.9:“111'4 Iv‘n‘IHUIMIIHI I".’.1-'| m. wmtvmw» m ...........'.{s .Uu’ {inn-.1 I.-~.v,..:‘|-iiuu III PIIII'I Inmmummh «.1 “mm: ‘4’! 18 2. Formula: Finite sequences at atomic fonnnlu. 3. Wen-Found Formula (vb): 3.1 H¢iudonicnm¢bwolkinnn¢ 3.2 H‘lfiimwfihbbflomewdl-bmod: 3.2.1 w 312 (WW) 32-3 MW) MA (db-W) 112.5 ($91!). 3.3 Tadlmvdl-hnod. Wommhfiomficmm-oumtdwm hmmmudumdudum. WMdWwflth-filflchfim whammohmmmmambmmm Wuhan-put“ thbudWW-hmmm: mumhmdwmmwmhm Thedafinition «hmmtbuudmummu WMhmdwmmmhbv‘dDBC «shadow. ’I‘I’Idufinitiou’ngimvhubndm mmmdei-‘uu. Mitch Wtd-fiodd-mhorhponlm Thai-no con-actio- htwcu the “but: at this out and are“: nits oi wmm-mmum 'l‘hombmof Mamm-wummbmmw m-b-mWMnh-obw. ,. .iu'M-I mun-u. in r..In-~. 'v 1.1:: rum.“ 1 v - ~- -o :w: H} (:.u|..‘.|urI Inmw'I ~II'H « h‘nti’lcoI Ii-m m (In ,u-uuum 'mm H: m: a; .. '1: I r ‘: 'omlui hm w'ln xmmjiuI wII u-nh .rIlH ..--, J I-1i8 Ii 1 c . I ;.t t.‘ A .-I I. I. x .4 \v .1 i ;.«I .Ir'cmlm zi'uv mu. I Imps i wi‘ duds! In bun-until Mm: “xi! .wn'H-un ~I:g't-zu;v Mil uJ mm “"1“ we HHIHuthIH UK In MOI! Ibhfl IIHUnl'Vl'H‘th Hb' qI” Ion! '0‘le rvn-gnc' ‘lll'r IHII lei .JIID <11“ Ill 1‘11.“ I111!” Ir‘mulilnu. ml III“ In Menu/‘1 In lI-uis.u'..I.i, 0 “.II . n! In?! 1H»: WI fits") 11.-imam 1m. IMHE‘V‘fl-J “I H Hush-w 'r mar-m»- n-uiu reclullt~l-v'2.g1 nu "Inhlwitg'w 0; “'1 HI "111‘ 'l'llr'. il'NIII""‘I‘ he? "1' "I” *lII I'w £4 ’1 11‘ :'1~"cI-3;wlll Hr .1-nmtfi’I) mi 1. .IMISIII’III'IB ‘NI III N anmuznit. 1% II min In MU'HI m .'oi'11'1"~m' Hu- 9 up” II III mam-nu.” IU til'I‘lfl ”I; in 51'1“th .|l: “mum! 1']! .1111 9” “II In 513" 0:71 ‘1uI wlnlilimu'» MM! u MIN in em?” m NHJHUHI! ‘1 WW1 1‘!“ ~1in ulqu in”; r3 v HI [rum .41 “dint: :II MoII Ivoitwuu .3: WI HM‘» »... .4 «.1 I. II’ In.» 3 at rucouuzu-ssm MI: In wasmimnn aru'i mII w: «I ads-III jazzy»: It'l'u‘lm’ll 1n ruruumu In 1% M! u: in hush-sit Iv r’hllll blmii’n up" Inlk Inc! #1.“ in Frritflwul ‘Hil H‘P'N ['04 flu” punt“: “I ~- I MN")!!! 'HII «WI‘B'HII 1n r IU'Hi *I cIt 'U‘N‘ “I II .nr. llrvhl'HII' 'IHI wllhaltc'ItI' 15311-11:an ' u .1v“?~v"li't'i Pl Hun-1E: um as 1;.) a: ‘uuyluw dim-um”: 91:. I11 ' I l O u o 11"“:“1'1'1 fl 'HII'HI'X.‘ 'dfl ”Hutgflll: I‘Q'DII'Hii1 ‘Htltw '5 'HJ 5"}; 'fllliuh. 19 Thesecondcoondinateism. mistobethoughtofasthepreeent temporal stage, or the intend that we call “now“. «I is, of course, a memhaoithentdtempordstmu. Thethirdcootdiaateb<. Intuitively(x;M! |- w: by“; “UK x; In «I In r.:«In:wui arm. It (.8 IO IIHIIJ.II'I .,L{ LJI hula!” I1 I. Iluanianu) r I I ‘I III I Izisl‘IIUHI II'IDI'D 1'” “III I'MIIEI "'1 'All 'Ib'IfllI ‘13-.” Iuifl II *I I u: up In ‘nll 'Im} ,Iluh'HI "III In P’I'rIulugu mi n1»: / m'III 1»?th (hrummi "VI" 'Ili‘nl'n‘nl 'l'uI'uN PR ‘IISI at: IbiHI/L‘I' WI r‘ollulwI IMII (ding-W1 ruiI 4m}! .7 flint! “mi willwui 4:: MI] “'18 W‘nnll Eternal! 15.13 mum 01 I'll infirm“!!! HI «Mun rain) "I I'tnlrcjgi mil Is! I unit r. .i m'mmm mmv. WI hum I 'l i'HlHV' “VHS I'IH'HHHIII TULI P.“ 1:3 "5 I: .a -‘;I~ II ‘VI ’IHI-‘HI N In!“ o-‘oIH g-‘H 'I‘IIIII "Isltn'. In “(.53 'r.‘:I ‘MI OI 'HIIU') 1112i“! II ”it” _"‘9I15.L2ti, I 1!] .‘trtnlajiIf‘ 'cIIV at! In "I!!! 1T1”! 3 2| Q'l'..'I HGMII jjtls'lte' x. I‘l'ul'cI/ I|.:ll nulls'huw -a u . ‘IHIHr pl P" H J; [I MIN Ir. "NIH )HHIHI All ‘ulu I53” '55 mil ”LII! 1I'|.I #Hl'ullt-Nc .HJII 10”] 'M ”£111 T4715) r; “.433” In :I‘uuo khl'uH-‘uv‘l I» Wino'tI'g-u- 1' HI!!! KI nil In mm lugs Ian] M?! (Ifllsttil Jami m; a n41; a. m-wwm twin. I'M. ' I ‘ I 2. HIV“!!! m snx'mnu wran'il “MP7”! /— I'iw‘nlli .l {I I'IHI‘HI 4' JI‘ 1in In ‘1 , _llI‘II~I|Ha' "III rJI'IhL-ifl WI (IIMIHHIIJW "W! “I"? Ivlol I . u«;II ‘HII It) (fluogrfill'te 1U] nvnIt.I.u.)u IIHI’II m) .«a-Hfl-u) “10”.)an l' H... m-mv H" ‘ 'I 2- WM! w‘nJuI «m u1~~n~ WI“ "4., mil *- ul 26 TommhM’ammitnI-thoday,(oryeuud1y,orthe dubdun)fib(ww)m'bthcuuthnwmben m-hdthto-onwklrtwommdq. Nomummmpad “huhkbMfltbm-mfl-dwmtm thmfihmbbmwbmmmm h'hhmbhbmuhbcm—Hflo'.flnmum mmwfibmbuUIdhm'Thbsn-W'b “hmdmmmuhoudfi-MMW Mumwmmmmummm 'PdWfibphgbhmehbnu—Mb’hhth Wmhuwifiwhichmm OuthothMIwny MWBWMhm'Mhnm-W'bwhm MmeMbM,nhvchn-difiou mWhtfinW'Mfihmbhfioc-otht Mbtwm'hbmwmmwhichwo beau. Fmthovhwpohtddulity,onlyoudthhmconhiniu thy-utm'iflbw Butwhichoudthuwillbe Wham-am “Pm-“Mum WNWhmdthi-s. 'ltbguh‘tobothocue uhbzm-W'bhflfinbmhwyhjdhm 'Mbum-bfltb'buuhmhMMhl. Itbtobe mwuthbmwMtuyo-odm “Mm-tuba.“ hakmmhhaydm itothundyui-akdobm Whichhhtorythe mdwuhwflhflowbdpmdntabukmnbmflbm find. “kWh-“deumlythmmnl .H In ,HJM Mr .1 hi hiss.) L1“ (Ill rw II nun-5,“: v. Il'lnid'ir .r 1;“:I'ol . ; r‘ 'Ni CNN via” "1' 1H ‘I ’uf’uiN 'olhlIUH'I'HWIIIH um” In 4! H 'w-at‘ni x... MCI.» m—u ‘HII ulhdxgqnw ”HI. 1.3m ,wmud rinh um 1n) uuumml winwi .9» will lwal «and» 61113.1»: us “0131;152le mi! ll JUL-Th) ‘HU 131.35 9-3.:"1I111ai fluilm r! nwhium‘u tin?“ Wily-t; “I In” (ill '54 NJ VIII‘VM "‘I'uil .MHHHR “HI' Wl'! ~V'Ii nil nu 15'» an N "JuncL—u'w a 4 until lmil «an mil ml at mm” .2! )i' mil F¢botl-u without¢hh¢truhuydthombuc thus. / "' "’H’w ' "Hal" 7*! i-‘wn. o '.‘H! '0.'l «I I ww’ II. 'II hi -.i .\ I- u .H m .- .. - : a := \ Iv'm )-‘..l GIN I‘anll 'uIQI n: In“; H‘ 'thd .nn‘lni ._ iu-ol .l. VFW-‘7“- ~——. ‘— CHAPTER TWO ACTION 1. BRINGHVG' SOMETHING ABOUT Whubthnhtionbetwmaguhudthehactio-I? hhitively,the madwmmwumuumhm HSnitlm mumummuuubmm’.mmm Mthohmponh'ndukhon. Snithmtahcthttlbbthocucb tuhmouttoSmithmthgitfiu-bahgthm-Mthhnpolhb (Io-khan. WNSnithmhrhoMc-nhidafildwflhthe oontfibntionhcmtotbmthhpmm Indicted-,vvhm smmmmugumummm Wnuhmwhhdmmmmfihgnudh mmumhmwmuumm Anditm Mtooxphhhbhhucoo-thmdmuhthbm. lithe Mdnflx-chMRL-htnhtobotbmdmb “MWMbmndfltnfifldldh-onuuk HQ“VM~MWM“~MMWNSM mmu-ummmmudmmmmd WMhmh)hwh-mmormum. Tontmtommnpb,htumthdthhnpon8mith’a (la-khan. memmubmu. lithe mtmtbmthauhmmhmmdnm'fihthe proatatwhkhthohnpouhith’oubofl. hots-emana- \73' .3 HIHHHJ‘H’ wi--'\.u.{\ \ Y 1 W'i " .‘HHO =Ill rain“ I. ‘H o!“ in!» (MW 9- H ' (Il‘k‘ HUI ‘o~¢ ‘I 932 IC a t” HUM mmv 5‘ Xti‘béllnul Wm"! It? "HIM. 1 - . 1!! f.“ “Him in" ’6 u n ‘9 lu . u u! vb I . c Q g a a . win» .1 h': raluh Ib‘ r :I-c'u .IIH fl 4"”: fill an 'liflb“ '0»? llq'l hltrvt N r"-llul L t I I l ' A 4 +9 ' NH II Mal Just! 5:0”an hull.- IHn;'. w- KI A' s‘.‘ I.“ an (gs-n.- w.” um: 40- 'i'! «jnllhi “U 3611] 3048! 0!” B!“ P. Ill"ii H ‘Jll d"l”"$' H'iltl'. «" “H's a is ‘9”.3 W 0"! N i» H.“ ”1"»! W" In.) tannin . 31:.“ h «I otmn' 1.515}; I." M erlo M .u r; dun” 'lleu [II um Nun «Wit-at If.” nut ml '0 'il-‘vlil 'sd u -.H.« ”In... a m '1. i 1:! ml} uni! (Him in”: Hi .11: He lit-mu; Lu. "awn r :-.1 I 11m" ‘. «.3 tun. Ill 2.:mmmuo «nun-w! "ui' Ha. in HH'ilv'I ‘slht'il'. «I l- ‘l‘| F" ul..l"'l3ll 1H aw I! In”, Irt\3;;.l‘.-:!..Hl 1.1 In.” fig” ”Mud .2! unzigu: H ”l n‘b‘.|»'9.|gul\: M! II USN mu: m (3113:". In 9am”: "nil an 5 1:: «mm ’lt? hm; n » ' 'i.:.'sit.Lq In 'lténllt In I‘m '91.! WI c'l II‘~4.~I n 10.,L'a‘ n nil .3 onv 1 In. 1 Iv /i Nor-Hint” ‘M'tlll In ”I. ll. IiMH ll iron on H) ‘01:”: 01 43:3” . 1 li. «NHL-Hun" "-Hu! ltd II Hail ‘MchJ KIN “9’ H .fliflll 1111""."I‘HI r‘lln‘ilIJiiiu? '. IE‘IH Intulil“!!! l' l- "I“ IN] rmnmu! 'll l'u‘. '9!!! tin” ivufilhéiiil 'vi III I! “mail. I 3th; .1” H. 9h it runs it) ~‘-' .hlallx mu. ;: u} .. in .II-mI 'V‘NJ mnmmlmn worn-1.2m JUN. nu ‘iIEEfi. 4'“ IMIJ “Willi“! ml I'd Align...» ‘H‘U HI (“.19le MI MN ii tun-cit. rm! runi :im." nun warm-up 'N-neJ‘uf'H.‘ nu rt Anni ”-7 an” ’IN‘WIBIIUSJI-‘i u us‘r .hl'Nflt-fl Mun: M 'I-‘odl .W. 1! Mz‘on'hul 1|! ~“Ha? .4 1013' Aid. N 1w!” «6! If?” P! J'Ii- ’1: st: 1' Haiti ‘nli Ami» Us hi‘vfi} 35 dukhmpisoflispouibhudthstitiloniacontinmt. BntSmith mmwithmudhoodoiummwitblotofl. hull thwbuflndbhhdmvhkhdolothchdedlflnpdbb mbdmthhnpbon. hallthrutdthupouihhmbit i306. hlhcwiththbmgituhuufitthtotfllkdthncfiou duwuamtuuocw'fihammtutht momenta-blown. ThmtuolDBCbMtobchdommeaupociu mebmmhhMfitd-thmdqub. The “Mdmmm'm'mhhwu. 1.1 Tor-I 1.1.1 Nana: WmmttHMOVittorwithou W Formupb,if:b3nno,tnkhtb¢Wda-thumfor :1.th Today‘ctmthmdthofncfioafb Mauhmumtmodsm-udmto Mmtunsnhudthddmbmmtom. htlitivoly,thoutuipodbyltomtaudmt-,bthutof mupodhhrnbfinto-Mthnctio-dam bother wathahhthd-buu-tdwmum. Wammunbwwbmu-mwhtadoaor Inn-done. mmmdliuw 7.4.2 Whmahtu-oudeM,fl-,a)-Awhuo (i) 490:3”). vk.,Ah:nhatdthdno-cnhdmwpodhbnhfiveto X. Thuhutdnhnflmpodhbmbnufipodumt Uh!” W,“ 1" 'M ' 1 “U 'i ’1 ~‘H H ”'H '"‘ ". .0 "1 ‘H " 4‘ '.h 1” U. h H W ‘3 [H " "' «HWIJU: '_. p!!! (V IN 10".; HI Pl . ”TH, r loitll,“ 11;; 44%”qu 'u-. :1: cid'wll hill .9. fl 11.1” m “I IHMI HI Io'~al'!tr‘-'8 r'3'tIHI 'lv 1'! n .‘u .ouc-ul o. ‘1 up. an -..a In Irr.‘ mil H". m .u-- #1 mm” “m! .m 1!. FJHHJHIL‘ 'N'" ‘0 "f“ i" 111.!“ U? 3.3"11111 "I1""v' ”'1“ 3| Lin '-'B "L3, “in” 9H“ 13' h" ”I 'filla I: INHH’V"! '14 "HI 0. m. H! N linmvwr!‘ Al; HitHluIlI 8 It. ll't'h II}. 1.. (U. '3 1 rr- lw-alIcr-H . V 3 "V l- "in Iln’iH rmlml mil; :3! ~:’ I“ .1..sn «.1 ‘HH In furl: ml 'mi rural; l-n wmgcgl um .».|~ b- It! Will}, «cl ul an. r-'~q;:..' Nu! m. I ~ in 'H-nl “Hum-Nun ..: Q.» lit-.1” .‘rJ‘it- nu! NH. rum" in ,.. 1' awn. ”411‘ l 1 ' H-‘HHHN “.0 "I!” ‘9 d'AI'WlH K c“!'“"l "'6' I'M-Ii "vigil I i i 1 l .f“! .V"4"' 1.3 mun mi! ..' In Hi419'uil w. Minn? .- mum! o. a. h I: ,‘1 ‘msm-o ml -. \ unl‘mm ‘uii 1n [1 4391'!” "til I'H'Vih I... 1: mi ,e'~o.'-nar. 1.. ,i. ”.1 ”I wtl‘urrfl I'IH. Ll Hi'ule'nt a. l-Hu "SH-II 'Of‘V‘.bs '10-: r-H-s .1 he” av lv‘O'H.--Iv n1 «mm '1 WIN/HM. »-..-u.:"n": In I'M Hi! It' I‘miur. t; I" 51- Min.» KM? ,1' a; m mar...” im. .\ was 0! j 'I“ "“1337 .4; law as! :10: run.“ "IN” IN ‘uIH'HHI‘IIo .. in Ha «tn-i “H” In”! "l U] ‘DllirI-W WINK-"fl 'IH'NIIHHI H: 31- ciov '~vI|l [LII-nititllu'l II. Jl-w 05 «I I“ '8 llW-ih a‘uiiuo u li-IHJ .14 N ‘.. "'uuh « $1211” it"!!! ill 11» fab-"WM" r?! Fhufl d “I H. *i‘w‘u " HI."- ‘I ! 1r NHHHI P8 v.1“ in Ha!“ "I!” ".‘Hs‘dllllfl‘r‘lv'l H11! :u I. rmi 'H '13” _ 2 ,. ,l!.l‘~ .iJ', ' I Luz. “u. MI 0: r1 -. ”1'13! .1 “.6 : 11.151 '3 .. w '| "NH. '1 " 2* ’1’! 1543': ‘Hu Ilsliv" rul'nuunt 3H '9' ”it“ ‘1" I‘v'ili‘ I 4| HI Hluuwll in. ' w ”w. u'v r-Hhmnl'n “H rm; véww'ittmu’ IH P» Im- 9!” 36 m, handles of the agent, must include the present moment from the mtegepointolm,nmelyniteelf. Thbw-pothwiththeviewthhtif theutio-deechegutco-titnteemhgdthemgedpodbifitiee, the-th’lmhghchd-thepmtectulm Soweeddtothe conditionalltzz (ii) 36A. MtheeitutioedFiguefl. FIGURE 0 ACTION ASSIGNMENT \ 41m) 1 Thidiecnndeptctetheectioemtnhtin toahtnomentn. Thehctionedeguta mthepoefibilitbetntothehm containing-”gory. haduthatnod'lthctmtehmethee-ehcthmhmtete gimmtweedd: (iii) «##*K-.a)¢fll.fl) Actiolucriptio-hDBChevetheintlewhueBiethe two-phceectiolo’eutoc,aiu*t,ud¢bwhetahthpeboet. It bhte-dedthetwfidthetypefldhendhtlitivdyu'abrhpit ‘Hh un‘H ho ._.-,.,,l «‘2‘ ., .-...' |.. ,. ”.51 '11?! In 1 HI l‘ith' ‘ON ov' ., 0""§I ‘2 .. 111's 1 H. In vnll’wl. I H“ 'I .1 .n-,,1~ 3' Hind.“ ruini'h. H u m- I . I ’1. w- in 9!. I'll. .h tlun‘m muém :H y I .‘I‘l NH“! ‘NH do. umnui .x' c'v"': "‘i; z.” ("nuptial (mi .nnm (Hr in” .8 H. "Holt. - «13,151.; mi (I. :m\ “.110 w'l 31.. I-IIR .1”".t{ u- |‘.§-_g'i"| “I. ".1“: 5". 'iHhH‘l'n.“ 5 «Hunt'uup “tn“. 1 0111 '5 m 1;. ”mi 2":1'“ «an-tn In 1 III h J‘”!‘!!.’ ’l' "h "“l “J H in.‘. ‘I' _'g Iiw~=| “I ll-ouh... on Ia. llzt'lj He! 13.". In rlhuzu. ‘uél 3|! ""‘1‘1 '11.! r a! 3'! '1” Li!!!)lwf'llsll ”1‘7. 11ml! a" all! '1 ilhnu‘: .Lt. «I "ll-"I"! In Il-u H’la-f 1!“ 1‘"Juilh ’ ri «Hit N . l . E . ‘l HUN 4% ‘tul nan-1m I'lhl‘ mu rWo u! lul'm um 13. . u ?'9l!Z!!'E.-' +1 " I: If $11..“ I I“ i .m ammumuv» In!“ '0' - I hm: 1n in HI “"5 ‘1” 1.. mum! Ilwh: I°"I'i"-‘th ”'4: 4 4| 1‘. '11)]: Pay} |.«:li v}: .-:-i-. uh! J "'4'! ugh '1. .521» Hui: iw3u'u“! r’! 37 abonttlutcb'. AccordinglythemtuolDBCiaahI-godtoinchdethe uctiouopentor: 1.7 Actioqua-stor: B. Mahtmfibfllflmhwbm 3.2.8 Dd Thetnthcolditiouiotncfiolmmgimhtwom In conditio-(i)Ba¢htruut-oalyfl¢bhudmymdthont fin,a)whichwbtboudpodhhmwmdmby a’unctiouBItJlovduiora’ooo-tdhfiatowwhmutntobe Whmmmdew-Mombwa’a MmmwfihhabMMfibon-h mph-bod in condition (ii). This, the out {:clbunufifiman in (ii) mttbddmmbtwtbwtthammm bohgthocaoutn. Whahchpsbat¢hgmtht¢inthe cueudinoodohghmb1¢fimbch¢thcum Truthcooditiouiarwfidthhhnmumo: 9.12 {WP'IiH (i) (X)(h)(x€flnfl)*:fl¢D‘-f) Old (ii) (KNINOIE{Khalil-fin-‘flflh'm- Withontcuditioufii), not.” vh.,m.|tllhplbout any MdfihMiMmeH2-fimqwhflb count-hm mebwbuphhwhubmtbyth'mhg'd pau’bifithonuochtodwiththmduchw. Continuance-m ¢adia swam-Mammax-awm. Whax'nt-n-utoltypo l, (h)(x€h+:fl(¢a¢)D3-t);whacxboltype 2, (h)(x€h-':II("¢W)D'-f); with x i- W 3. (thEhmw “VHF-t) I " Ill.,'s ' I t w.I.Ir l I-l'l In rix'lI'v‘ 'iz-I II III: :‘I;.. .g. I “HI” .'| my: ~-;') 1m; .x/ I I :fiuUIu.ni~mnwlw ~I nu LuIIu-MI wua «rt-swndfi Judi I. L i. ”I Hm] “HI I“ "$1.4 Has ftl'liit‘ll"l\' {I ”I I» |n.-I ijuifti-‘IIHD II “II ‘uiI I'w HII .IlI1'I‘IIIi'IIII I‘I‘IJI It; {91".} ’I II IIII'I “I 1|: NIH I LII] III [Iv-'IIII'IIII' HI HI ID: 'l'nmwn-m ‘tI-I III iIlI'HIIUIII ‘II-II’m-a' In I'I' "III (Int-"VIII” ‘I-IIIH I .IHII 'NI ”I III It; Ml'tni'uilI ltd!” ul flmliv SI‘ZHIH'I n: 1"! 'I 1' In III .IU-ll .v'tl'lizlfi v »" IBIII Ritl'ui'uzil 'hI'Iern‘I l0 WHHIIHA "i;I Mir-0'15!!!“ IIHI'I “III III IHHI-I'I‘ II II'IIRIII'D/‘I in]! I-Hb' ,I I‘iutgv‘o'l (nu-In HI IIIIN I oIcJ I‘M-*5 "Hi ’II~!I' m IIII III III IIII‘II‘fAIaIJ’oIJ: PM "6:7 “I III vI'tIiiIIIIU1 III I--.i-Ii..liu!"8 .mvll ”\TI'HII ., In 'o’lnlhs MI] in}! urn-wum MINA-3 In 1., “:6! nIII‘MHI'i'l "III n] (4' "AI! HHIIIIJIH‘; ‘flI If- Hln-Is; W'I‘I'I‘I n. u'uIJ'J' .III In W131" "tuI "III'III '14,: MI! and m: :7 .~ «In. 4'.” uxi ‘-~"IHI: u- us I'm. who mudiJnu‘nsown]«mtvadv'rfivkunwr'dmII th=td,~t j 51* Ims (if-"i. -§- ‘ “MIMI IIuInJ I-I u3Lri.:m wsiufiIIAnizdz: XEXHLKIIfiI A”. Maxis 4&1.th Illa-{‘4 (1%“) ,,.\‘II ,I.,..r-I' {,5 - I.” [IIIII‘IIII'O'I Hh flog/1' 40 II ml” ”WI! I=h+k IMIJ 'Irtu ‘HII IIMw-r'vwll AI II-nI MIMI}; In "‘1‘!" anmt 3am Hzmuw I: 1' *mmn'um' mil ui Immm at Imiu twig/w us inon mi Humid. Muia' PVIII‘IIII‘M ‘JII I‘ ;.Irllta I .III"£N II II I It) tunii a“ Wu? “.3” I-‘Ii‘n now’S ’I.£I::-'I..-ruq m '.I I. III I! ma. 1. In awn 1110} can; W! -;at m m'mlnnl It: 'Mniiuif'. ‘4 I'lllx -. "I" I“ "I ’ """I‘V “3r“ 0" “ 14‘1"” (I ; 1&5! .I ”‘3’! In Inwmnul 8 Al I '0: mil." .’ o I . . I: V) .I. A .I fI I'IIIII “I ”H" RI I "I‘hlll IiSI‘IiJh-u I II I'MLI 88 and when x is 0! type 4, (h)(x€h-»:I[(1¢A1w)]]1st). The Initiation might be depicted a tailors: 3 4 typuolmto SinceR'luoquinh-conhtion,nbdouotthuutypa. Andiltho ddeodbbanM-mhdfl4typom nthtuythbdbafi—mt,lhauhruthtuthudw otcbundfiunmthmbpodbhnhtiwto-mtho uthmfl{mfix,n}ba¢—Wthmmcfltpodhbdmuut flawmbhmhamwpulwt Whatamight bthgdboutd-nhtmtothocfitbdupictodhtbmm. lip...i‘]hdicttathtamcnuidulna-utothtmduchtypoi, “Walnut-rt“)... Fampbltlllbdmthtmtu ottypu4,2,lmnducanfidcntiuhtlotmbdtno8. £111.01) I «’3 action dugou- Ill 3010“!) (i) [1.2] M (ii) [1.3] But (ii) [1.41 BMW-W) (ii) [1,2,3] 304M) (iii) [MAI Bum-'1') (iii) [1.3.41 DUNN” (iii) [1.3.3.4 Bum! W) (M Thmhgauochbdwithmtnetionbwtodbythe .: an 11-..:..-M “I i ' _. \a.. . ,IHII I will In / '.-'¢ but. LGNHIIHI (I; I"'I'~Y'¢ 'I« “I ’1 s'nmuJ In wag/I I I i. I I.‘ 1* I v.l q 4“ J 4’ 'III I~ Hui .r'uI/I ‘V'NII I-- 'Hi: In 4| III .IIUIIMI'I “I’IIOIIIIIIIII‘I m. , II 'Hmf. 'II" “KI". I III. I!) @i‘f‘IIJ zI "IIILIIIH' III ”I “I’I’hI‘I'I 'I‘II'-""I "HI‘HIHIII “I J.»- IHIUII v-‘I.-I INN) IIIII'II ‘I:§I P.“ 1II P.“ “IIII' III’III".f--J- , In I Iv rI-II IILr’ .I'I‘IHI ‘HII IIhIII. III HI S'IIIIIII'I'I 'IIIIIHK‘R! VII: :‘I-oIil ”DI” .I"1II|'i-II'H ‘IIIs q '!Iih ".; I” ‘.I'i'I‘7'EiI' "I?!”‘KI ”III" “III “’3‘.“ II'I4'I".‘_:J"AJ 8 (I IIEIJ'JILII II .?‘:x‘V 'I'IIIII‘I h. .HII n Imi :1 .I II‘ mmEI I r u; II 'UH' ”(WI 0 II 'Is“! In «m'mm'I M; I "III HH-‘I‘IIHU ‘III NHIIHI ‘HII III IV” IIIIII ”I III'BII 'IIII HI ’IJIII.I'°'I III Iii IIIU'II. t'JuI’III .I 'WII II I” In "II; Ifiiil rhivtelt‘iil VIII-VIII"! NH". 8 I=.II r‘t‘h‘ IIM‘I i.I a.“ h. rlunmdll halo oHIIbth'III ,:I 5-H walnut/w I- I .r'rqtl 'ru’lu NIB ImI III-I ,Irdall I. “Mil In «III'mmm Inn II ul' II'IIIrs'I' Icahn 1"} *H ”In I ‘. I w M II In ¢;‘~-u;_: *II dIIHII m r .- -— I 1'“ In IJAyh-‘I {1. “cl . ‘: “I; Hal ‘- I .t 3' III IJ‘ ’ I I .II Um .V.’ '1 v-1 :uI I.H In II hi (.3 I.» yIHI I}... III! I V 1| {I t’ - I. .1 m :wm» run-a1 an Ilull'di I.i"-T.8 [LIN It‘an'er'vs- mun-Nut.» 'MII 39 oohmnbbelled'degroe'. Theodosiacubeauociutodwiththeoohmm damthttbbhtenchmmwovcwhmmbdetuhed. For Wumddmufibwmmghbocolfiducdthemm ((fi)thmtw,otc.)cahouocinhdwitlthtuthhbkior (obaflwhichhuonlymmwhnthhmnhhhnthovdnet. Shikrly,thhbluhwhtbhm¢htubontududeuu(ii)hvebnt tumwhmthehnlhhkuthnhat “chm W‘L‘I‘FH WWW ‘ [Icahn-(Mthommtlacfiubw Hdnapa-Iorm autholdm(iv)nhfivotom¢udw,thuadoulotm “amnion-builds. hadnrloruacfio-Iobothbwuk, flmaIMoqndthc-otdalxthdmpodbhnhfiwbn. Moreover, MaMumdMfifiMh¢ufl¢uwbtht BGIWW)VBa(¢-W)VBGH*¢I- Tint a Indor- ‘- Idio- 0‘ dew (i) Wb¢IIquhikBaMAWLM Notice“ 13.2 I‘M-’3‘ much-“{mfipranfin-thmmudbaumt mummthWw-,mm¢mtu Innatm. Andhhct,th°lwouldhvotohethecaowhuaapuforma ~n HUN»: 9" VIII! 9"Il-‘II' 2h “II in.- r’b'l'..JI' 'I’.»|.I lt~ - I» I v: "I‘Ll II Hm a’ 1.: I: .13 -s hi: ,4 . .1 an” I! uh: warmly: H 4»; [HI ”if-z I limit. I. I. ' ww -; . 'HII IrrranIvtln') ‘MI IIIi'IIII II min .«It «nah .i, In "norm m; ,n 3...: m. mi mum Ilium :3! IIEIN Imlm mam ml at.» (.‘ut' .Iv '3.-..I'u‘(. I” A! Mi: 1133; i am nit « nip! IQIU’flIHI 'vsI‘ "PHI." um: tum Jim» *IuI xi mi » I.‘ ~ ' HnI wd-II IIiI 'H‘hr-h I=oItIIII .Il'ncm Iti't'u‘ltI cl ‘RIIN ‘IHI rqubI WI? ,II ILIHH. mIIuIlzI ‘Hll 1%:th .I writs! 'MIE auIbl xiuunui ‘LII M will zuzrl um I” VJVI I91" .5I IJ' WI IJV’oI .' ".u' I." H. A I J '3 1 a z I 1 x I I I s 1 I 2 I 'n . I I l I I I I I I v I 1 IN) MI w m ("ml- i. II :f‘II‘I- .a III mum!” n m 38 Ii InvtnI-i-nm «.1 mam: In no» L- II'H‘I "'III am immim m Nw'Ht-II IHII (‘N-II II ""3” .J IIIIH I'J 'ult'br (II HILLIS‘I I’II 'rt‘l "Mr I” hHIIdI H'- is?!” A!“ ‘NI MI "HIV“; III; 1an I'VE .4: III .III II~ In. It; algl'bz'l In 'M'IIIUI :uI ’I-al. want/ .m nl «1min "vi Man... «1;; Huh I II: M .II .. mil Inn.» Mun to mix ‘MII .véamqm y in": t}- “I WINNI‘V’I M!) 'H' "II In ”mine; In. rmtn'vug c- IMII ..; -:u»-~.h In mains us vmiuII't-n I) IMI'I’ I)" at» *‘Iv' up» .I 4 A .IMI am am .6 Ian: -.. us 'HHIIH’I I? III 'otIH (I ‘9‘" *I 11‘ - .‘. 5 I ““16 an; mm? Inn. .I.~.1 M WI IIITJIII IU"..m$1\/Am Katy: I‘Ir 'uI! haw Mil nI III'IIIII AIL.‘¢hndo¢ywithT, cum-cc. ThubRthbilDBC. tRE. p.991 u-BatHBav W,mwmflmwmmmme dwintouhhoabat. Butthnbfiu‘doulothold. IBM. 4 -v Bow. Mnbdouholdflconditinl(fi)bdmppdhmthmthm9.12 hum-scripting Bcenmhcodwithtwocoutahtnitive W Meantime-(mmmmmmnop-tho N3“ “(watt-stow“. MIMI)“ mkhvahcoumtothooth,m,fiwflboumd “(math-isthmus. WNINME: 12.1 In'IBa_L. hdhmamuhflbhfigmmhnm'hichmwodd «pact. muumhmmdcmm I .IOI Incl IIIIILI II a! (I! II . ,tIIIv -. ”I {,I "lfi“.. IHIII 'I‘ III. ."' I: ‘IIIL I’d. II-gl "I‘:- [I I'?‘1If""l .'!' "i ‘) "‘.,l .1 1‘“? I..lt|'l .I‘II"-'v‘”' I‘. ““'I‘IHI! ."' ,. I'! "W” ""“"'“i “5 “‘4 "H “I XI'IN‘I'I'IIHI "In ummu mi: .w'ml: "II" ‘MU'I‘UI-HH'O WI Irrmmfin‘i PI IhI’l I” "UH-1r. (until InvIIafi «II "’-""':II II”: "F‘Iif? IEII'IIIII IINI.'II)I*II’IN 0.! «III‘nkUig-IIL '1’”. 153;, .o‘u'nII I436; ' I! I I I c . . - ""Ih‘” "“4"" q'=l|"3Il‘V II.I"7'II ‘i-II (II numuumm v.1 I'.» 1.1 ~ ”In: ’Ii'!IIIJ."I III” ‘ ‘aI ‘ (you. .‘i n; 'l o ‘5 U" A. ., , ,L‘V "l . ‘- 4-H; 1U“ uéI III 1m“ ”1“ V”) II'W“. 1. ‘i "H h i‘!’I?LI-‘i.!i d. JI Q I III.” I:,...II.IIN III (In In.“ HI I ‘IIiimfinfiw ’1‘ III!” |,.,,,;3.§ ‘ ,4 4., lI-W‘gu :‘w‘I m attluu e I mm WI "LII.”II‘IV'M" “UH”. "‘H ”WI" ‘ INN 'mu INN I’t'I/‘I Izauun ‘nlu II'I.‘IIII'IIII J‘ 'I‘ ‘ ‘Iaid ¢‘ ii. I§It‘&‘ ‘ 'IIUWI'IIU‘) dim! mII "MI Ir-gw-m a] m unmhnm II Mmi mm ‘oilfl m;I " “’- "I‘31'3"“'i?§"” UNI liu II IN «(I ‘3’“: «N u'quI .wlinimh "4; "NH m IHI . O ‘. . I. ' ‘ "' ““I‘ *- ‘HHHHIIH-omal'": ' n v” 438 IN! II-vllndun Bulimia M I "IlnIL'IiIIr‘ u I . ' ' t . _ _ z , _ V ‘ I ”121,-“. In) .IIIHI I II IIHIIII} I..I ‘IIII'I v'uaqllu.hb IL; fight ,3," n‘, ”I. 5 .3“ “In”. "I WI III” I! '1"-'195"'I"‘~I ~-"‘IiIU "1' HI "II‘III‘HIII: 'uln ft‘ch: M ”In! wimp-1 PIIH’HIIIIH'I ‘NU III 0'3””ng II.) I...” :"I ‘JIII JI i\l‘l IIIICrN .4. ,':£ "I;’I"‘7’ :hI -‘-' l.‘.I I III-II )” 'I “II N _‘.IIII,' "I'IIIII ‘f'fl, I": “if. I3”: ’1‘ ‘)' ‘4'?! VII"':"'{ ii" .‘I'I‘I'N " "‘ II) HI """!I ""“1” ’ I” KI'N'NI '0“! III 'thHI'lquII I’JxlI «km! em: H'wa 41 However, 13.3 #‘IBaT “law,“lhaaqatnflthmwuymtpodbk at:no.nt,BaT night-true. WN.udanN.domthold. N. “Imam RN, 5%; Mdtfifimbmmmoabmmfiuud Dwummwmmmhmdmmmmm udRNbold. mmmdBmme‘w 'c. ~(naww)-»am(¢w). MM,M‘dounot. 1M. “mm-«Baum» Ou'uflmwflmthMttthfi-de outbobrhpuhont¢aldhhpnhodfi But-ct”. mum dthmbhhthnwdmthdthmwhb-hmion numb-(9.126”). Sm¢avbuuhfltbmbmto aundM¢AVihbnhthrddfiommbMto nbcmofiilhbhdldthu. mmmwdu,tm. Snpguoahothti’nbdallytno. Sheavhlothhhdlpo-ibh muuukudhaumflavbhhmwmtdkg “,dmidiuaw meumnh.u tK. I-Baw-WPEGMW). Whflmhhpwtthmdfimwfihfihnmtudww i' .)I.' H l 1,5] 4. i 'u 5".an Hi'unnlil J'l‘!“’ I‘nl'J-w-rl. “*5 “I ‘III Jfl'v.fi “8 ‘.IHI" In”. Ivi‘le I‘ ll 0'3"“! ‘M'H 'hI “Inst” i is] Iilmlnm ti 1:. iii ii nun ul: 7 l wim firms )2 lilbilllli ‘ A l ’ {w imp”: . .Q.) ‘4’ 1.: w w'nia "INLZSIVB 11min: “III gl'mxil‘xi (f'uiiult: u" '1; Wing” eigil In 'vga¢:r~'3 .12.! Mini mi! in in u: truiw mm'Hrir Ib‘lmur 'mla'uu Il-IH‘IHII nil Inn. Hui»! Ilnd LJ Lu. «Mud " I .rtnu'suatinm I'Nw .. t. rum-".9; mi! minivan-vi ”unwind (Juiln'n«I;“ . .iuit r‘.‘M'I ii." .Jituhrl'iqnm hziI z.*-i?iA.~ii~(.IAJHI] .. f unit ;3 his {'9 In iiniisilclgim'o ‘NI! Hand's ermihi 'mu ii Hui! I'wlxw Huh» 9w! mmr ‘MEJ .I’H“?! .ur .iuil .mii ,,-‘ Mimic: 31mm I'm. :1. Ir . ii; . Hui mu; «in: mm; 1.73 iuuiuizzu'v limtt wit lo rum-r» lat-nu». ‘uii rt mini-inn mil in mi UMP-~49; «AIN'OH'WIII wit iih m Mull 6i 4A.) ‘M‘NI=!”’: .l A z :i 'J Hut 1N1.i MK ”I warm in alumina” ‘th’irr-WK‘ 9:1! I» Mn "III in «and is! . Mg: la ill hilt. 1!! 'h H wm' ‘Ii'. In Hwiomimn um (1.3.111 mii min in HR m «ii?! #1 .9 mmz'md in margin. III; II! 2‘}th lull M J ‘i'th'g 'iuil Inn'JJHI 4i J H.“ H-‘ifi ‘iflhl'fl" r m honilurtrww 4d! BHMILJi amt : i. i III Ii; 1, m i-‘Hl‘no’h lt-n rtiiwmmi‘ iwill‘l‘fiilllil') o. LiitinllJ-I lieu. «um .rawui' ti A j] ./i «Iv-nil flimm HI rll :_°H|I.HI‘~ tau: ‘J‘r (J‘ «Li .1 r {I . ‘.I fihfI I " ‘H‘I .1 [-nn Hid-4341,98 «HI (‘51 {iii}! ISIIUI‘IE-flu'} 'HII Illtuifi 'J‘IHLI ‘02:» I; 42 wt,thaifoneubobtilpabonttheutocodent,onebrinptbout thou-squat. Mtbafiafi. T. -Ba¢-»¢u OHM, T. .hib D‘ D. kw» "IBafifi habbflowufiu-T.Mtbmogcunl 12.2 h-Bflefimmfifi halt. AIRRPMOholdildldeDoyflu-dnoddhgic,” P.,RP.udO‘holdilDBC. P. h1M¢A1¢) BP‘ hi I- 1Ba1¢ O. hfifia-Iw-IM Euliat,itwuuieodthtmhltadhuyhmtiolo,itilnott theithflthbdcdwdwhtahhpabutmnbhmght tho-tun. 'l‘hpthcflothudouhold,12.3,bdmwtblogied wdwwahrh'uhoutdommwmfim hmmnuttfihubktoa’om 12.3 i-Q-vi '- Bali-NW. Itbahoworthnothgtht: 13.4 “(WWPBGMV‘W “tenant-hum“. mmea-flm app-0W1: Nuthathonmtdladtnn. Alduppouthuthuubtthut mmtpouibbuhtintothmtdwdufimflwhfichifiia the. HVhlogictllytru,thn(¢v‘W)nutbotnouth'-momt mfldcfiommtbadthmtdwdwionudthu I ' I ‘ I ‘ . . . ”an «".IHI~I 'IIIU 1H HI‘II‘HIIB '"II Illwlr r' IHI'I Ir‘lh ‘Iilu I? H'III III'I’I'I'I‘M rig-"III! as nI I HIJ ": nun-4px: HI"! ‘I #3.“in I lIo‘IIcaIril) I... .(,J l.. ‘ 1:31; I 9 Kl ' . g a. . o '9 run-s ‘P‘Ilml “III-l 1qu I mml ntlulhal was II tint ~rmil 3;! r’! Itlsi M WWI Irimm I» .~ HI‘ WM. 1:19PM! ii» in wind ‘-‘ IN: 'IQI [I -/ O ' I: O ' .' . 1., I m Iuou \l I-IIB ' I11 . I I " VI” ‘ - I (1; M "‘2 ""I J 4 0‘; v “I I) Is In" ,4 H ,tilqjxfuilll iIILIIJI‘IU i. 19‘3‘28 H.3II Ir: glull 6'5 II II '1 Mitt. I III"IIMI'I (VII? 'I‘Hé IIIUIIB .4 _”'1II I) "Fii" In (‘I‘iII=:g:;'*u’-'.IIH‘I Ifi'ti' 4} ‘1‘! 159:: a: HI Law'gui :III IMII «fr-Irviixm t‘ '..I Auxili n'mii IMII 'Ii‘gl mu] "II. I. III HIM”. «I Hill "In 'II‘N’I'I II until 11"."! W Lu HI; Illenis r2. .i' I» Infill Iv r'r'tl'tliirwllna “I,” IS a L OI 'IIiH-‘IUHHH. IUWH'H'HI Inn HI .1141! Lizzfiuil (131112" (v.18 nl II IRWI'V I’ (5"“Vu‘1ul I". , . I’ ' ' H i .i «I ’n-‘ncI-Ifir'. ,r Hush-I an AI I'Il‘oultltclili't‘c'i "HI "I IIHIHIIH 'H'UN‘ "" "“I I iw-I in Al 'ti’sIH ILJI Ion‘I'g‘II" Ioflf 'IH'ii I I 1 It! LIVE-VINE“ all ‘JQIIIIIIIII 'I‘i‘ -¢ . I‘ MIN It: IIMIH~.II5I.£I In Hum-MI "III ul 9/1151“! 'DII- ‘HII I-i-mwm ‘HIH ..-. um 41.! In: 'z-II WI :«mu Igvi‘i H'HII .‘OIIH /.h'!|‘."I N . I. mum “.13 (1'3. II‘HIIui .I. 1'" I‘ III 'II‘ ‘III ‘III'. I8 3 “I III"I:TI!‘.w' ii IIx-I’ I}; -:‘z “IIIIrI-Iw 43 Ba(¢vw) must be (aha, linking the consequent of 13.4 fake. Aha note tint: 13.5 U‘Ba(¢V‘¥')-'(BO¢VW)- Ththu-dvb.ad8.mlotthunlnithc. ThbflowhgtwothuunighthotbouhtdunhthtwithMP MbtthBa: 12.4 homaofind 12.5 how-Wm. thw'mbpodblyhmfitabatbm And mmmqumethm-um. But con-ids: 12.6 :- (BaCMA 01m 0 '11!) 4 1M Smhmpbthtfibmflythmutn. Hahhpcm Mdmtfiadmamuthou-ipodmmtmmiw ton. Hmm'oddnthhhhnntbpodbbmtsmt mama-mammaummummnam with”. EnthaintunycoltiuutMuqmthu-m-t bmmtddthnpodbhdnwhvbhhudhaith wuwmhwummmwbaum In mmfimwhmeMbMthe-odonthhg “Woo-thou. MMwauu-uflytbmh ugfildmwdm hbhwohmBWndT‘tht 0‘. MMihdnmlyfl¢htnohmmtpufibb Metal. Mahmhahhhgthhahughndbe “mm-aunt. Hmhdoomdoaymhgntdl. Fawmthnbdm 12.7 t- BaD‘H Dad. m. .emil «Inn urh- 04“! 6 Ii .1” III want-«EMU ‘nli MAMA Nah! r--’ Ptinl tJV . 1| I‘J.aIt‘|‘1’sll’;n‘l ‘uil 13“" 5-. Myth“ 1:1litl'1h1 0-11 [It xii-11 Lomlul U~N ml H ‘i'lnil 'irllh m1 JOHIIUS ”.1 1.;Iul'u1 "23-. n In would“! rm trui .. . arm mi .msud 113:" ,‘..;!Ill!li‘.;“' tn... mi! #154 a; a1 1 11min 10 (1 I .mI-i-ts I in [vii le irmn-{i 11>” Mi! uni HI win] 1! 1w "NI-"H" "W ‘ . . I -‘ . ~11 UH "It. Nu! m.“ 111*“ 1‘ 111'1131'“11‘-J-‘ .‘r‘Ym'ahl D! .n. '1‘1'11' H? ‘3'. "'13 3‘31“? :71» o‘ 10 3'0‘311‘3‘111‘ ‘3 o .wmwmu- 8 hill "‘1 1t 'lltlui “ON v.1 "fifiiwg Lu} #1; ,‘4‘ 1 1‘5: .llitliaJU'W'Htl 'HH fininis'ifl annihpwllltv‘t ‘5‘11”!;§§al] '...l ”Ilolthlil’ ”N mu m . $313131” 1.) a' 11"‘n1‘116 "2) Wm d 15:» mn'umi'n In NH ‘. new“: -. £ Ili'n r. h 13m. "Eamon! b n .1114 la a. w “MEN «main.» .1 t .Ciz'. I 11: «mm .11 m: 4 -: ".1 mum -~.|i wimmwv 101 .twiu. i in w'mumz. m. 4 mi} nimv'tul rut: M "cumin; an! maugwl r mo‘tu'w. iuus'inoinm 1-41 "hupini‘w niulll 7‘1111‘ 116 "Min .1” Axum” l 011% «29.41513 Yi'l'l‘flgd “Militia“ 1'14”]! 13.1311}, I 8 11: (In £1)” 11 unuui'alvgwlui I'l‘na 1n} wail Tuitvmmwi .,8 (1.7:. ,‘H'Ildl 1: nl ‘HHMN r’ Il‘l‘ilfllll 1U 1‘16 B .7 111‘”!!! .11 1mg ..6 ”11¢; ."thll ‘14.“! u! Ilu'ihfi . 9 I t..rr'.t t. we. val '31:.!1 ‘i'rxwhfllk .1191! 1) [ll 1.121;.sul1 Q; ‘14:". / “1 ”N"!!! I: i] 5. 'IIH'!."0“3","'. ~.. fjltifluiiul 9d! 1m! l~3')'),"! 1:» “1101 1'31 oil :..I *-.‘." '5 . 9.. . 11 . . - l v;- . m l a a” 1 15:11 “11.04". kg 3.: m 1 .11. 1!! L zq’suln o't.‘ rm ‘)"01'1'1'o...1' H» : nigh-41". ‘111 M11!!!" .8 J. 1:1‘1‘. 13 10.1 Writ.“ l.!‘ JIHHI M11”?! It: .61”"” villi" . . . , . , . 0., . . l. m lvrl'vdun- 1'1 ‘10 l-‘il‘wtlf. H I: m M» 1' mlrfl- 6 MIN -. "I 'w 48 inWhafia—vafiutofitnflbruyma. Aocordinglyweadd toDBCthoIoflowhg: ll. Vain» 13W Whale I-(M,n,<,l,g) and O-(M',u',<',l',g') are Wic- d D80, 3 and B an fi-vuiuh 3 M83", III-3', <-<', [If and whflhtmfadl'diflndmdfmmou thwmwbfiummfi whacflinu-o. mmdDBCcuhowx.%uoo...gmo‘-dthbdbmou toIpukda-urfidotnthmdDBO. mutton-lath pieced-NIH: 9.13 Whmxbavuhbh¢tlorlnhudflan um. EEG-mm“! if! Milt/fill.“ Ind-r some fl-variutlolxwmflbthuflh‘nmnot Mini 8. BASIC ACTION AND TRIAL mam-won. Snppouwmhtmhtbmdhh w,mmmmmmhm,ummmnm dis. humubwummmm mmmwwummnmauumm fitboctthtlbflhcdbd. smuwnmm,udm DBCwbmhhMfitduWWthh-mtto WWWMdtfiew-aiflhthBC i’l'h I.» [I 1'. ,‘_ tn; - ”I'D,“ "I"; 1"] ii"”” i” "Til"..\¢" ii I.“ -‘ In“ " ‘1 ETHI“ .’ Q 2 a “IlshHll-vl "' ‘l" '0? 1m v i 2' .m -- i'- 4M! "'1 ruiuz'lui :M'hmi Imam] II "x in“; '1‘, vii! in Wlt‘flbl‘i'l-J'P'vizll "u; t: i. 29.3“. ./ .-_- i' Mm 0 '"U ' ‘t '- tv .m :m , if 1‘ ii“ “I o-nm (:1 - H. «13; um Mull im-ull is 1~:'::.§v ". hue" Hui?" 8 hi it oral» m‘vmum "mm: Us "\ 0! [113-11 ‘I'uil High! m Tuliulit: 111mm 16 at it W! ”in min mmlis hiiil hm: “a s...,-t . 8.“! .0. lmh‘ramm'b mi mm KM in rum.” m”. "muuirzm "wit u! emiT fNi‘i )0 9mm! lim 1:) !-‘!!1wq m; in fir‘»;~ n: 714... am! "no; .. 14/”: hm; hilzltt‘lul 8 (I! .uiLsJuJ 5 4| ‘/ WI-ulif (H6 ‘mlw Winn" I53; {.34‘133‘ ‘m 121‘.:::':};.:f Win-MM? I n. - . \l I'- 9HH ‘Hl'fiil 'v“ol5!t.‘§ ‘NH GI u 'H'MN I) in 3.. Hummer-w 1;: [H ‘}.r J‘u; My”. 3”. 'kl‘ Us] 1 I. x 11" I} I‘m 3 Id . ism; 'wmi u’mutmi IIMiI'Miv-m mi! 1-wn inixxuq «uni rI-wwnit u-m'yl II! in 1|.nia'ol.la mil Ill 'I‘Hiul'fl I. awn}. an)?!" 'pmngqur' .umn-u: nib-Luau roam? r131 Main-«m; an.“ iu‘z-u'w luiR Tuba] e211 c‘nuim uln'r‘bl :1-1 m: Jung] «it 14m lli‘HtlnzII «mm, m «numu‘mi 45 vi ,mqunrmu'nn and! Hi .a-qi» 1'1 Wild ‘Nl Hui] 'IU Tuim} Wad indué "Coil?! 10;.“ 3‘1?!“ 03 ‘."l¢/:' in!“ Erhih'ut". aane- Mk «are! “down Pawn-v.4; 'v'fl‘il ‘b‘u‘li" [ruin Thin” v'ui mm mmic. n 'I‘a 1 i ,1 nun-nun: an n gummutnh nucmugm-o! as In him...“ «J u! m. «:I k Iii I ‘1'} “I.“ mama-ms h.:!!_-:Iu w.“ I: "mud-rm.” '9io.ll¢r"I-loih "H” N f“Pl-3"” 49 notation. Iatpltnubto'White’ahtheroxph'e-K Whmt'uthonuneof thuthhite,womightW,Bcpv'Whitebrinpitabontthuthb “brains“. cheupintiondWhito’oWbpmodadhytbfiringofthe mdmudifiomhhgadthfifingmauflynhbdoumigbtuk whthrthflfiuhuhnficacfiuorflmmmtbmm Wall-nation. Indud,oucudaythtWhihhmuhtthe dyhgabutgtmhhvwdmmwmhmtsbofld umbmtcundhbhthctodb. Butachadnhlhuuul and-criptionofmhmufibthumcm. Alumina pmtlypopuhviewoolmrophydobg,tmhgwnfichtevenb uheeduttothodyhghdnfimtbfirbgtothhxiudcuuin nucthhite’oumtomebhm’chnhud Whhhfifimuficfimflhmthe Wants-well). Whacflnthbnyadvocunlm, humanly-Eduction”? Thesfiadmththonhflthnh unriiutmt,hhuic. Whaitbnidthtbhthpitshoutthtfiithmdthtbh theorisintocwhopmdneuthtnthda Withoutmnotiouof WRHMbmwNw-mwmflmadl. mumwmmmhmdmmam Meant. mmmnho‘tmamwm ittobothcunthdcuhhmheumw. Anductivbtnighny Mutuadoubflutkdmthn-dwwbmm Ammhghmddbcfianththaflm,thmk :hpudthomthopmd‘ciuudwhtbpmducod,thoudpment flap)nkhtbcthoqhtduthutdpodbkmbthtma¢inchde ' Mu i; ‘ F ' ' V" ' » I} f‘ 1'"... "‘0'." ‘6‘" H. ’|‘ "‘V" 0 - 0 ri 'u .. a I. rj'Lh’ . If: M” .‘Ho~;:"'|I-I' “km: "N “thin "14‘” H-I . .7; ' "’ I"; to .~; Iv» Mum nail M IH'JHM r‘ With! a “4‘71 In nun-Ebb" uh II n. t I v A 3 1!: It” HIM) iv”! i 91 Illutul a W!“ "4H: {I ‘MII i‘; h ‘UIIE'H?! ' g .‘.| H “I“. In”. I DI ‘tlwt-l { “1‘51" Mb” I'H'l "HI‘M- H 1“ “mil I8 ‘I-dri h '4. JUN ‘Htl IUU'VJ J v ? hi'fll'fid HI“. I! hail H1. "iv i’iit 'tth :"r '1‘: "Hi, 0 Ian (I: .IJ’ I‘M": mi! N. 04'“. icifgflu‘ni ‘9“ pump uh.» I}. :3 ~on «“1“,» [1. gap. “g 3'”. HS ”p.45 ‘3“: ’I' . ‘ ‘ I. ' . . . _ ' _ IL"! HI!“ '3 U H'Wh 0x I: 'IUP 'ln‘ 3...! I), l‘ufll‘l (ts! 6"0‘103.‘ .Il“vuw~" {-1431 ‘o 13%. .HUHIA ‘I'HJ‘IIHI 5!! "'18 'v Ail ".ifl a'vu ~ Hi I' :‘3 ":R ‘H min}. i lvrh inn ('Il'” .' t -II t! VHIHv- IHt‘.‘lih‘i MLHW- In ‘nuwii Nd! nl "Hh citifltl r 43611 1' -..1 In Au! ‘M‘MH! wtm'tlw Italic-r) 11./«1201 (Hi; ‘0 ."I. I. 'r' ;.'m' «M! 341“} ,/'{-"Q oh. lc‘ ”U I” I “all mind A m ’mwm hs emu mntqwuwu “IN-‘- runny“. “I I 4“:oo..‘ hp 'rh H’ ”‘bOll‘vnI .‘I'Il'lfi‘t'l‘! ‘ ”Hit "A!!! u! H‘ i-vr “In H, -'t fi‘“ui I: III "i. w A! .J‘niwi vhf ml .i: "I "I ,;| “.’ I‘1I‘“. l'l é'l"' "‘1 “-"I!’ III anti» "Hi! III 111‘} 1'? 1:15."! 43' All“??? IIHH’M‘ h: F3. “1 I- “2” I’hlh ,m-pa‘ .4 Jaw/'9 Louiun u», . ‘1 ‘ I . 1 1 ‘ 5M” imam» h a!!! ll .m “4!: mm“. II riildsi ‘l la~..l .. . ml H “not H 3“ H-JUHH 'mlw: Hb-dfll’ -". "H “NIH 'NL: ~"~ 'IEE'c-ul tu‘ 'l lw‘a-IHTJ‘U ‘HH .3» ’6 «4rd Mum” (gm .- :a’. '-~'=qu u an ”:H'T-IHI H 1;: U7! I h umm- .. 'In :H in ri Min '1’; mi! I‘ll! H! '1'” IN I v!" .. r . in !--R ' ! H -? ”Wm... ii "‘HI'JW ; . . ‘ ' ‘ . . . r; t ‘lu wruntdnfi‘j ‘ln a" wimp; Iw»..; :- and R‘vtltfl- In” H .‘w 0.“? Hunk! .s1 w “lg-m! Ir; Ill *1?!‘ i1 1‘ "'11.! «m; 3M W. :M'v ngg‘n H41! ‘14:: mil )«t n! I: \ . ‘ U— ' ' ‘ C. ‘ i. . I '2 “ I t " ¥. r t 01.; ,. .-9 on [1.13” n [n.m «.H In” [a u .t «.al at v kl.) - an I H N g v. «4*; mu! ‘Ii£.~.l}| 1: {sh a H; In?) any I' «I. In a -,-.. Yin] 1c] “.11qu r -.|;l‘,;nv|; an? ‘-' \ 33.911 "‘ UH!!! Nu}. Mn] in I"? ml. 49.64 0 'tquiunu] n”. tgzgiu In”; ygu'uji».1q up” :| ”bur-1‘ Hut: In MAI-u! I) 'c! Li'ch “I u! Hi [on f.. ,4”! 50 thoplmtmomtbecmofwhtadidstmemomtbdonm. If {mRJun}'-thcntdno-b aim-1W pan-ibis rehtivetom, {mailman fittest duo-auto dam pondbbrehtivotom, Wmthmhdaummtuficfinn. Acthmipthishmdwdmm. Forminpb, WbumtmwmahhpMdnij-twwbnmfily humwmawimdydid. Whthmbsthhpubotwoen muvwmhhpnhougfinfithwtduutypeof wda’oactiol. chohpomthucthgndthe mdfibw,fit~htliflvoly'hpodbktonywmuor mtahhpfinbutuhddthnywthmdfihmly: mammamubm. thhpoohmmlitbdificnlt «www.mmtmmwabmbmm, whthttbdoc'doltopulthhfip'ortbfirhgdtthdbthm, ”Macbeth. Ithtobouobdhuothtwhn{x:Rx,m}btohohh-nuthont dMMpodflarohfinton,{m€fln,a)}’-tobe tin-thudmbintwmmtom mewadfiumuflcmtmumdfimdon whtuyouohdidordou. hMfianMm mmwmmmmmdmtm can't. hw,itbhmttomhothdthuohmu mmuvmhchthh-km-dhchdhst mflfiihmhwtm,hmflm hotter mmnmnmnaomummmumm thwfidamtdoctcahohfifioryorm. Ciao-mum's If at ‘N’trl "1 IHHHHHH ‘mhr’ lb“ t'i‘o v' “.1? N In D-‘uh I M! ha‘nlis 1.. In .. 'le pm .. u, al)’ .. o] ”hiya“. I. in: It. lithnw .'.’u'1||lll‘|| |u 1'»- ‘ti?’ A {Hz ,‘ $ , Hi .3 '! 'O‘h’ v'l ‘¢IHQ'!"'I In- U'W'Eblinuur rHl HHHHI It! I'V “Hi '3 .1 'IIH\ ,1 IE "I um?! 'tufua‘ h. mm!“ ‘tuicw h. 1. ‘u t|«-.I Q; ”A! {In Uévéniuiuiw -f'j‘..'i w r .1 .Itlzz'v - .gj i;.qln1l§i~hru .[n I my] ‘ R -a u... .4. far}; Heal J H u -' o . «a wi “.15 II Mpg ivl m N! in. «i5 xj_||!ui ta ”:5 N .I‘ lawns Ii“ n! W fl h . u ..-~.i .‘ 1' ! ’ .t‘ " "‘1': ti ‘ - a 1 . ‘ w .30 ‘9").1 hat) I» :11 HI). 2 ‘j'! a; s 3L: Hilltflinxl - Md." I: '.’I3 W” I» m!!! s a; in hi-twsil mi Mmm C1 .Wnis whli'hi "(In mi» int: 121mm 'Hil INN; ‘HHI I8 ‘Nil H‘MNi'h‘ “"913 ’41:! ii Will 4% "I III in vcll‘il'QW'lh-i 1H 'Iuii‘uid .6». u! wl-izvrwu.“ ’Ji~u/.;:ui:u «m-vw H .i.. :14 a C, In Na-I-‘Hfl‘bup a I‘ a..." vi an 'Hil‘V’WH‘W‘I m?! MAI 11M. ‘uil ius'wm 1n nu .ig; £4.91" . mu tin .c mi. .4 H ,iimu-v. rm! al any] mi! N Irwin‘s; hi :m'l'l x yamiwulcv 1.. Nun/r .l‘afl ‘0!“ P1 Hair)“ ri) 'Jci In. war!" Mum! 3:1".‘9 I. ..f:H Hit: 1: ul 'ol .l-r-ou c.“ "H in» «m at harm mi! 'tu 3.5.5! mi! 10 1‘6'7‘12311 sift mm M I! vi wait mil Tui‘ m» i-di in whininrw “:5 3w ml! a" waltz] mi «.1 4: {m /.«i 2} WIN!” I“?! *rvnl Ari-m ml on rt H .i 2; {Hum 71’} .m m WH'fii'v‘i “Miami; xiv-swim. EIHHH‘.’ am‘mtwm In In ul Winn“: 112:.4‘Vmfl (irmmn :mmw rm"!!! r11 in PM “nil no: "Min! .Iu “latch!!!” 14" halos lll‘numlt Talon" “Inna Hi lnh H hue” am ”Hush. HUI rm ~25 wnrmiiu'u 144mm an ant 'Hmui ) nl mm In hi: vi» «wins 1min Huh Mum in mlmhfi 'Hii moi-dint” i-‘tlivlm IIV‘WWII hunt nilwn mi: «xi-nil! |:§'b‘.’h ‘N‘ - u! mummy PI “‘l‘iii’ mill nxuryvr: m luxntnym an n .nhuasiouu'. M n j~-nxi-wiuu hm: ,«tm 'vi-w‘ s umimimi ,nnuq; 1m: '"u'w’a: m1 wicu'umq wt?!” H1 .IIUHQI'VV.“ “dd.” amrfl Jun-til; lat-UNI“! ‘ui "hr 'v‘wlil H IIR ll-HI‘VIII .u. s mm! H ‘3“‘3 m amine In «cm-emu; ml «at: m Raiding] A «an?! wis'lnfl 'VHU ‘ur'um'v l' i u -:..s:‘i1.il 1n '11”lean «ti "5."! 1'8 imwma 8 ion” ”Win an 51 hmmmmwfluflcfimitfliouudwwwemwdinufly thmmmdpmcfipfioludmfiombnt mnmmmmamumhwm a nighthohflpdtohfi‘ubutmfladouuhoqutthh Winn. WMWtthDBCW-fid mbMfimbMNmbmth-flmwm WI]. Misdafici-Cyhthmflmt’lmpmflbfiod “mumwmmhwWM-wudum For ”subbehmhumtommuhdthhuk «Hummumnmmwwufldw whuum-Mmhbmdm Podfinnbmwuhb. flown-thumbshudbd ”undistoDBC? WWBthW-Mt mumwwbmkuwmmmu Wmflwwbmhntmhd. Throbbabpmlibitod mnmwmmmmanmm This mwtbmmmmmwmmm mum-mumaom. Wheels-orb bhbMMWWMMWRi-mam dwhflanxthudfibthuth-Mm memmwdwm Accordingly,one wtmwhlfihdthmammbhc’smdm,hdid mmthmummummmm mamm,udhnfitfiuhhhfldnhm Mahmflhcunothmhmtodomm. HilLlHi'lh HI. :I. IL" H l.;h ninth hllill ”MINI-u!” “In 0 H HIM u? ‘Iwnlud t “on.“ #1 lwi .l'u‘ with”. l4}! lltuéql‘a v WM l-. llnuib Nil 3'5 In .t".‘"‘ 'nll 5“ H! l: on] I. u «at. o". .1« MI, n! an“ m «Halli uni; (Idii'm In) ex (Imus um MPH.“ 1914914" 4 "HM rail "nun. Rug“. Jun run. h it fl-OI-I llhxix t‘. ga'clci nl id ~itzu ml the.” Iu Ilvwwlfi rwl m m Ilrumiunl Iurrmqmi viiumh'am-vm waximm Wu; Hui! cumin. im'li lulu-m; I H! Vb»! u" ‘Hmi n1 uz‘rrm In Mail 8‘ "ml-m . I In. rm; 'HR 'r'..-3ll"-‘.tti 1| «xv-Emu. mil m I'm-uhi'hh s «.1 an” iu‘m-w-umml ini .HNI 1U hqwflll'd l'iiil 1’ili3-iiN V'HI'V’“ llfién‘i') «H‘f‘iii Lilbéi (H K 3135“ ""‘H Quasi wit u; ’HIHJ “nit haul» Ml ":HIYI H0013 fl'oioLMu-i rt 'I‘ri‘iut a. ,ss‘dts'h/‘fi 4:” In lull ui {rum-g5 anti-mm in?! II nd‘! Hm Mud-me! twin/W! «J L 0-“ .r‘x 3‘3an 'ha 661;“: 96111 In [1155*] 38 1rd! as H‘Miw- a. Inn at W» it"in-thi ”hi WHOM 'Hi “K: ”It” mil-3.1M imhui r~lllilflfllwrf in”?! 'ht- .-.. mutu‘tai n3 runllu-LI‘III Tobi/mm 0! nl (”Jada-w; 9W7: Iii-I «:0 "wwwus Mi ”human" misrrm Emu-5.4mm: '11! Lm‘. mini! and um; ”alum. Mi: 1‘! w-«h. i-“H'hliu't‘l m 1'-;ti='1 ‘LiT {Wktlrfl 7"" Hi it‘llxu'nali Hi Hui” h ol‘ro I: thigh!»- tui‘i .r‘lt;r~!sll 1"].01‘91 «'Hi I! H'N'i TH! "ii-l w...»- Ul wuLnHul n‘1-li In“ ”‘35 «chums “Flitk‘itofliflfl 13;;11 ‘N-azl mi! {HIM Ligand ml higum unlit-4.1: fimwn in MN rutmui‘ 'I,'!~"!r?.~«;-=i-l) in n .i..;..5~;.ij mi lumen.» and) int» munm WIN It Ills Ian! ".0 Jl “MM-sit II'II‘I .li~ H u. ...i.-r.-c..urnu «‘l'ww IHZI Nu. wail In on. -v'.i; H.111 viiulf'tfi herb-1331f? ‘91” ii ll fizz: Ilvi'u; hike-muse 41mm qm‘ulm fi‘onlt 'mu .4 ~u.i m'rvi» ..«m:nw-ma T» ritvwg». v'zum'vunr? mim 1i]..*"'li| n'wa ir-nhiniMq in“ us .i‘$I§\Il‘v'l r:.1":tl~l1 “1;! L.- )JHlui/Hll “Hi! “In '.a::}» {H BIL-3! Him"; twirl.” H.411} ‘H!’ I'Wi'jiil IniHIIHII-e Lin. [4!” "til it: 'tiitnzw“! ‘51:] Suva: ItisQ-r’ilsir. “H' "INN“! Iltu’l] lI’S'MH'IH-l “M “11' Mimi! “H1 Innis ."I’JIU’W‘I WU m “"5 ”‘11 an t '\ I a ' . I a '- »m:cl'qu-¥ ulo n! mun: nun! trot-M Mu! m1 tuned.» ‘HI 3* H‘H'I "er '5 ‘V H15 52 4. ACTIONS DE DICTO AND DE RE Thtwotypudoatacuudummhwtodowith hmdBmmmlqu-m Wdthologicof wammamwmmwma Madden. hMMhmphflV-Mbdpdthtou nightmhdidothttbhmtotdblocahbdxhdhflbutnot heliuvodchTh-hmdbedxMhl Wichita mahmuthmuwbgwu-mmma Withhdhfl'btno. manwmmuam hauwbgwummmmwm W'Thhmtordbfloab‘,hukhothll Rhino-Wade Mfiutbhmhrdhfloahhchhthlkhmtwwiflu MMMVhiMbyJou-tohdxum Routine mwmmanumhmudwbdxmw Mmhhfimfl. Withxthschihrmc-bndc. Sumo-twin! mm'fihuuphhhdthmhhpkubutM'So-obodyor othebpobudbyJou-‘hm. habitats-MM“ mfihhfiuflfidmcfibwhimfitbfl'flohw byJooa-“iltnoolthtm. Josu’actio-hfi'nmblhdcdicto action. Joushhpitabmtthumu-mdthh'xhpobmd' bmhthwhmeVMmde-fiumo. mummnmtuummmumwmb pots-0d. quthbttaouuichthfirthtmahbnchtmthb mhpobondbyJo-u. Thikindolnctinnhhrc. Ounighthopotwinwtwiththeplulibifityofthue “m; ”I: :11 "In“ '91 Hi "windward": 1 mull wruluin-v in K'Q'l hu' mii In n‘: ‘ ~11! in lelrw-‘U vi“ .Hucu. mummy: l..¢h!‘fl. t/‘a 1'I-‘-' 1. in ‘i' tmrcsl ‘Nil w "Nani l§-"f.s‘211i"”w uni” ("u-"tin!!! nit-n; unit in 'u'ui mi: um. Mini mu uni! inr.?m:~mnl we r1 Ii .ui-g'uw-% 1. J “:twl Willldri'j‘) .1} M 5» Lm. «nah tun '30:. Ht.) 1"“ 1.1" fl ‘ifi'ul’ild In Iulsl’Htli M11 1:”?! t'\:."u 1h “rum! hi‘zm' ‘ «m w um ' qi «.i .88) r...) Ii? 3! chew-1M .1” monk-Inn 'Mlhi’ Hm n 'm um} -I in “nomad 91‘1“. 13.11! 3'96i'nl b 4 {5+3 Mn} 11"! H rig, "veil-i 'Iu 'lulu» ols wail 014;! «lb “0“" in 1I'HI‘DNH ‘HIJ IL!“ ‘H fih .‘JHLJ‘N: .1 .‘thI n "mm in} .H II n'uand -—'m.i~L 'ail "Hi-flifio‘v mi» .IHaisI'i-m Maw». 3.12:}! Ind-J r at J“ I“?! .-Ir #1 - . . . . ' ., ' a . ~ ~ . -' n ‘h M'H'm'h‘ arm». n .1954 J‘Hi IV 4| , wuhdu‘ In inlu‘whl ‘hii “NIHEM v'oin 'I'nm n1 Wit-1319011: 1| luel m H .ILI In, Ila v.1 adieu-slid (In MIJJM "1“ Mail u'wx‘h nit nu H .iinzl 3w} 7J2 M m ”nui- rl inlwiiwi 4 who Am“! Him-mm mt?! iloJ m»: xi- 1’! zia'm‘nd I.» tumwm Mil imil n f» mania! /"'lr"- lama ..n.. ‘3'.I')i.:l mi um «hi; in EM" “#11015!!!" .‘tifim‘ "Ni [15" [lull'Hfllub Tlrildll'r’. 8 Wain-s If” I ’tv- Jiuuhmu'" I...” Jim-i5 Ii agmmi rm-vl. ainmi nah-3.4. me MIN mirwmmi N Jbli. ”Ligands. rind-W Ii duh liiuli 'H:'.l 4i ”rt" si. I}; “:11. ant] ".l 1‘54. fitnnuv'uu] n wt!" In]! H .19». .11 m3» H 3,19 munimw 1._-3‘! inaceiz. r? ya um --‘ .3. "3. «iii 4 Wm Ad“ m u oh 1: ram?- wnumsm Evil in “m! u ".u....~3 M u-.m:~»nn. W [9. mm} ‘nil in as" ch! w ‘thu’. hut“ “10:58 I: ~"‘.uild (MIMI. .Wu‘ to WIN! v’"Ah!II ‘Hi ‘Ir '1“ 1.) ‘hit! I! 4:161 llllnih uIi'H<§-c-!* Pl H'IHIh an? Ht! ‘Hh? ”I -u -!Ioi;/ tmi: .H'n'it} ti 2:» .i u-mi ennui. sum ml lgixpm Ii iumi 1 fun 'ni! m. "1 Hull li'lH'r' 0’1'1la"' ”Mn-Hutu} lwll I’isn hi Jul Min ‘1 'HJ “d! e'l-M! | HI"'!-"l "1 3h «1' "ml m‘ Irma ”emf .r-nml. .i but Mn; 4 mmw v 0-! 't lidlo‘u l‘lsh‘ "Ii: “H I. h: m: 4'1““ ll! lh‘oH '0 0’4. M" NH ‘HJJ 53 influences, l3.7wonldbettheais,bntit°unot. 13.7 "((3K)Ba¢'*3a(3t)¢) MlafibmtmmtbdhuM'lwhtomwouflcxpoct. 113.8 #(Ba(3t)¢*(3t)9¢¢)~ Whmfiucu—lihbl-uhbuhflo'o. Fortune WGudHhhodicdbthdemmHfiFw¢ III we “IF-1t 12.8 HEM-'30:». 12.9 n—(33)G¢->G(3:)¢. But 13.9 #Hflzw-tmm and 13.10 #GGsfl-vm And lat W 12.10 pawn-.063». All 13.11 #D(33)¢-+(33)D¢. ‘.1/'1n‘u'1 1nI'|/"b lath.” on!“ ‘fi‘4"/ 'fi‘.-‘_I'. '6' 1-11 r'NHiicri r13 --1 -1-i-1%1léiui ‘Ii.: 5 .r,;. my”: immumc'im iwwt mi! M ”mud lunmu ~1 n11 .(‘JL 131- p, ,I.‘ ‘1 ’u ‘1 l. ~cuN (.1 Ame.” 11:11” mil nu .alr Nil 3 £2; 11' -5111‘1 1‘51 t«~:.1«;.»- v ’ .‘I -"'s Jon! (I ~’- f~ HJH w—< ’i i .11- I! f‘c.|l'i'9t’11 ;.’s I ' .1 19111. 14:.l 1411' lull ‘ltl CHAPTER THREE CONSEQUENCES AND SANCTION 1. CONSEQUENCES Thuolyskofthomorfloompbpmpooedhmbmqmtidbfic. Itbnggoued,formph,thu'aibrbiddenhombringhgitoboutthst ob'llutnthoonditionoidenticdwith'AWoia‘obfingingqb obont b a being sanctioned”. Given the lunatic W of DBC, whot truthoonditiommoppropfiotoiormtacoaofthobrm'Wiso de Sinee'litbthaW'oomethnooconvmth‘niniormotion, ct-v'w is o poo-ibis translation when... But,nppou¢isotypoofoonooqnuthlototoofnflnindeteminotive olfotbiddmooooldingtomotuthicdmfiolh. Aocouiingly, suppooothotiotbidduoeioinhoduoodublbwchPahforbflduhom brhgingitobootthot¢')boqnivohtto8a¢+fl("whooouoqmof abl'ingingtbsboot'). FmthoduhldMBaéioflowobyh-uth functiondinbteooo,ud-1Fa¢+3a¢wouldhoothofi. bowel-Ma’s nothoingptohibitodhomdoingmthhgatdhthothodouh. «hoops Mbuydoingaflthethhpthtmnotiudoonmfloo. Simihrb', iftheooueqmtidiotrooognhuOMPaioobligodtobringcbobontflu oqninlnttowBatb+mthahomthoduidoanA18a¢foflowoud “UM->‘Iw'l‘m Inthiocue,thtaillotobligodtodo mothinxeltoihththodoulotdoit. Pol-Imaiootubbon. Heonly douwhothobobfigodtodo. Th’nnitutionbintnitivolyintolenble. /I\."|/[ J II.’ 'J'I'\”'I'lvvl "\ , 'fl 5‘ ‘ I I. \ t I‘ 4 ’ , ’(‘,i }\ ‘ r \ I ) I 1 0H H-Hrytt't-t .1 ,1 ,1 11.01,. 1 s 1.,g: 1. » a 9310 In u .v. .o u: it ‘i 1,1“.11. II .‘:1 .-i ”In“ 1| » :1 . r1 1 . 'zirutls : 1:1 twos- .- 1 a H n' r in 11:13, a sh . ' HUN ‘1 ‘ 1.11111 ‘1 '1' 'l -! 9‘ "1 c-H 1.1;, .' 6 1 “1 H113; It ‘1 . qt”. 3'»: “111‘ U 111.! ..; * ‘1: u. 1 I ,..v o . 1 .' ." "i 1" "' ’51 H H '3' ‘ :3 a I H l I ’1 |¢‘._'l'.-' {‘1’ t. o I . - ~ ,., .z - 1.! (I 81 ’ ."IHL. .4“: ”Ohm 4 u w! , I. n.. 1 ‘I’n- ...- HM In" ‘11 n J. I 3;. II 1a :1 1 I «‘6 " H v't'»! J. I‘ it. In 15* mm" a « .Io in .1? . t , -.. u; I ll. .‘ win." hLiiwlo! ’11.. «1.1:: 1' .111‘951'1'1 I! 2..“ ' '8 In '1 d 1 . . .. . . . .. I! ‘1‘ I."1’l' “" "1 1 t 'u .‘5‘. ".3; . 3 ‘HO"~‘ r1 ’ 1.1 ‘11‘4 111“ 1’“ 1 . . u 'lll"\HI1 ."l I x I. I J .1». Q.’ ’3' 1!. ,"‘!')‘I I. 1 " O " 0-K .1 s. 1 [4' 161-113 Itl *fl'..1‘l1 .4! _. 1 In) '1""l’- ‘!.!’ 'w-I1 1 In 31-. .’ i :11 n x" . 't ‘l 311}! 'I III #1 11' rtr“!, 1 1‘ '1'! 11111”)! _ c‘. g. I in”; 9 H '1‘1 11 ‘ 1' ‘ $111” I . . l ‘ ‘ M: 1 . 11 FM: H1 ”-111 a... m o n‘al'nllnr ambit m I. 1.. .2 Min '1 .. “1 II ob o"I!.if'!1£-". uwz-rve'm‘m. u- .m. mu NH. 1:. I .~ .1121! 4'! 1!:- ”1. (viii! .1 .. mm: 1 : -an-H ' 19].“. (a! 1-"- win | 1 t " 4 .‘qf . H . 1‘1113'3-3 Mn: ‘11:. H t'I. 150015 a. -.'.6 {g fpaI" {I} 11'}! u n ‘1 (‘Itf‘l f. .11 1 c 5 '1‘fls 1‘ I u I v y - - ' - v .I 4 II...1I'IH In" .-I I .1111! 11" 'H [:1 "u ‘. i h 1 .1 “IA wti Jan-John”? .-| ‘ r'i. H"-I I. ”1. In] «la. 1. 'HI and! nit-‘11: {:1'1§.H'~ 1 1 ' .. ' ' . Ho H.111: 1111 ”.111151111. .1 11..."..zux as”; to I I r .0... (-1 an n d H -' ”-3 55 It was mentioned in the introduction tint mate as not obliged or brbiddarehtivetouctotheyactuflyhfltopeflormoractuflypeflorm, bntmhtivotowhtthoypo-ibbhiltopaiomorpouiblypuiorm. Thus, nththuthmnditbndobewm'WbaWofcb'the urictoo-ditioulu(¢+whuimpmmt. Pethpoflthenhtionot'w heingtcouoqmd¢istenpordlyutondod,itwouldnotbe Wmcoflduthbmm¢ud11uutnnldmfipfive hwwheudbisconddnodacaued'w. hthpnviouchptcnwo introdncodthowdl—howntauopantonGudehaowfidthetypeo WMMmbmmmme-fih'hbmmtobe thocuathattb'ud'ltdwmhuboathocmthtW. Nominee mhmmeteruflytmwocuddmmmumwmponl Wfiwhaowfbofthtwamtom-ammu'lt botcndlythecaethedi'udth'nmopentorcubeintrodnoedbythe ummnmcw. Thsthob'lctaullythocuoifiitdwaynhsbouthcmaditia thitysgoingtohothecaotht¢ Wemighttkcolfiduwtofthe ionED(¢+¢)-ucribhgm~nnhfitytothneeudond¢by¢. ¢cahocouidandznflchtcaflcondithior¢or¢um Moonditionbrofi. Hahpnoftimobroqnindbotwouthe comma and what prod-cal it, ED(¢-’F'W) an be considered as tnuhting'V'naconoqde. thifluutbrmddotominilm mWhChptoergED(¢»V)winhoW-Mthio WWWi-udtenponlmmmmmtkfi “dbl-ad. mmwmmammmmm '-=U(W-’¢)incue~=¢udthtt ==D(¢-W)incuon=-I¢,reminpmblemtic n n! I: n' -o u-HH” «III HI , h . ~: .I 1’ t . I'M cg IIIIJWII In» 1. In} H. IIM 'IIIIIHIh HM ‘I-I u' - Ii..II. I'd- «I . I: mu." w :Létrmq In “In-1'. «I ml m1 [MI ; at! out» - u . .in a . uni ', iv: ‘onfl'vlu; 014'” .t I»; r'l ,’ LHIH 3~ III 'I , ' , 1?:I‘~!§‘i‘§".?a I”! ”I I'I I . 3a I .I 1.. IInI'II'io “II II H‘IHII"| III'!|ll"..Io;I.rI In- (I -." I ln-Iiw.I.I-.I I 041” I . , _ .‘ a“! I." IIIIHIII ll 9- 'i II It "I o’u‘h'lau'ui't] r . It: ‘0 HI IN}! t~—(|t"| g. ‘ I, n. mum» m Imps“: a; .. Mn; {,3 H . ‘N! L‘ liiaill‘lz‘ri" ‘31:! 'I'I': I“)! III 'IIIII.“{‘-!'I-ll «(I ~u ""l“§’ wIIaHNl'L. ‘I:II in 'u in '1‘.-..u I; lovI-: ru‘ I A; . ‘OI-l'.” ”-1 o . 7' ' ‘4» «III Hz. I” on” "WM!” I; '.I.~ I -h.io.lr;zn ‘I'Ila! “I; ”4. [5"] '~‘Il il'lt‘II-4iiioll It (-1 3'”in r exliizé (I Ii" ‘nii! d'v-II .r'li'w. 'lic.:.‘.i:|u it. 4:.” M wt. I Luv L . mix N. w ”:3 II::3I 'r us ‘04:! [I‘m-I a :i 'r II. n‘r‘; I. .. In?“ H I «II «I. n NH. 1¢.IINZIII II WM?” "/‘I 'l“ .«l 'I‘quv..ti.~. 1:15 "th '6” . I ' l‘uIIv"' 3‘ "I; ‘Ut-l 's.'H|’I.»I -I Is H m». .-"I'vH'tii’ I? wi: in'IIINI 11.! ‘1‘”; z i ‘tqil 'uII In a. I! n u d. 1 Inu.§ .p. n4 ,-l I “413:. H” I “5-,"; t‘o:}.|_‘}t't:~ h “I and! In“. _. 'Io. .. S.) ‘1.“ II: ”I I!‘ -I r‘I- vu' Inwallmg .. . J “,IIA'.; ’ I II ins: vs» .m "MI “Ii ,- Ms”. It In an": “sis li-l ”I H I '3] _I‘.I it.,‘,‘ 1 g I I i I y ' «II In - :3 ll 1 -hI-’IIII'I "NIH ItI‘.-:II "Ill U IRIII ‘V? . w‘I ‘Nl u! $.1I' ' r‘ H .u . 4 I . y y I .' i" -; In II'nr-z'n HIM ‘IIU HI Ilumufi’ul iI‘IJIhII um" ‘- c. at. ‘a f.‘ I H s r: .0 .19.‘ t: ‘1 ll, J 'Q’? .‘A’E'Qi.‘l ", ii". I'Bv, 10". '{l} if b. é-V‘I’z :; [.5'. I." 5“ i (0‘ ‘t i "4 "i i ‘1‘”! .1 't “H”. ’-I ‘Whiihi ‘\ i. .3 1"? IW" '* I‘ " il»"”\ I e l-iwidrmw '54! um III-4:9”! .H «‘HI‘EHI'I hm; In» a f‘ -u.‘u'»-h¢o. I»‘ am?!“ '1' in r‘IIUHI H'W'I‘I‘I'Lil II'IIIN’ " . l4! ‘)‘>Il‘ti3-.~ II a I. «I . thigh" HI .I h! ‘Auqu-I‘w: m" lama-u u] 4. ,1 I9 .1 .I w". 1'.” ,U ‘ m ('1‘. “1:. .. I. ‘véml II‘I'I:I'I‘ Hm] “(hunt-II In M-II‘I 'uai .alv ~u.1.’m “.‘ium «ml: “3.3:; Ivnlr In w'x-qug...’ nil Ion! 'kv.5~sI --u I. ‘uwsiwu I... «Inan'r . mt tin}; : ’ ‘I- 56 but the matter will not be further pursued. 8. SANCTION Theoouequnoedhtetedwhemtheofligntmiorbiddmor Wdumtammnedinvolvuthenpplicntiondeome motiontoanndthinppuutlymutinchdetbeoocnmdmething eviliora. Thqituemoppmprintetonnkeueolthemticetnctm Ruckhupropooediorucfiptioudpnluuoein'SenuticFonndntione forthelngicoll’reierenoe'”,bntwithreviliou. mmnmamuwmmtwo function. Thefiretueig-toenchpo-iblewoddeteolnmbervnlne. Thimdnmhavdnehtnitivelywtstbeptdemoenheolench pouibleworld. Formmphifworldwfien-ipedehighetnmbetthm wmwlbprdenedotprelenbletowr Coilthooethek—vnlneeoteech world. Snmmmhmhewfidfiem'pbwm q',whuepudanentonicoatenoeeortnth—hnctiouloolnpoudeof the-e. Tibbwhetetheeeooudl'uctionooneeintoplny. naive-site vehethenvenge(nrithnetionlneen)ofellthek—vnheeo€nllpouible waidedwhkhphtrmoimilnrlyiorthuytnth-hnctiond compound). 'pbwdenbletoq'btrnejutincuetbemofell k-vnlne-ofnllpouibloworldlwhuepbtneiemtetthuthenvengeof nllk-vnlnoeolpouibleworldowheuqbtne“. Emmi-emblem. Thonmhetofpo-ihleworldlmightbe infinite. Snppoeethek—vnlneeofpoeu’bleworldewherepietrueue ".H ", «In: runner [1| "'I'i mun. illIIl-IH'I". ‘Itli In “I. II ".tnsll Iol ’IILIIIQ’H 9116 r; if?!» .‘b'.uc.4.. wil‘zl ,. .IH -'I.'~. u: u a 'H U.1 N i- ‘_ .. ll - Ii. . l illlllll' -I I HI ’1 ""‘t'l ‘H‘ I'; 4 HI ‘4!’ I I: wul nponH'I 'Hlé ’ I" Il"l”) 'lI'I'jb "Ill "lv‘iqlllll l. ‘Il-‘W 11"t3 ‘Ilh I 1113;”; ‘1“ in fill‘ll an“: n. . ’0'. r' I‘III‘HHHNI ‘uil ‘wlllrul Ir‘IIaII o'lIIl'ilI‘]~;3~; (”II I'rm ;, 'I‘ uu-a ll ”Illlll lul ll 1‘. »; ”Illsivllllvl ~1m..m-~J m nun-I :14"; In mammal m»; 1“: In we (ml 1 «:1 ...; ma». I l‘uiutiiul H . "I |u ”Mn: unoml'ol *I'I ‘IIII Mu r—“I’I I'I‘l ,,| .IILI/‘ifwl mu: Hui .‘ War-twat in smut ‘MI 1‘. g I "n Palnihutn'h‘ noun; :‘I’t. l". r:|o‘?.;:‘lla'l ”H.|I .11.] wval '|'U:jlr’ hi 1: vi 5 I'iII-N ‘1'?" "a"! Il'iflt 01 ni.v‘.fi i"I.l 'Hll 'uuqunaz thum- 4: «MIN 'I’nl'vtllil is n «u! u- Iil l‘uéillllll 'I‘dl :Hl K ll'ul‘J I. a! N li'jull 'll "l'QIH“/"' 'lHl loll- (I 'III.‘ r1 i] IE, to j.. A psi-A "Ill ‘Ir'nll I.:.’ N u] ‘II-ilsI-TVI I” le Q'ltl r! .h 1‘ :1 'Ii I‘l'ti’ib' rl ‘l. ,'H!-" *Izll in HI! 8 I" ‘i0."’“"‘6l II «uh IN "flay“! loan H m Hlo "Inn“: III-Ins! uIsIl ~ IiHHI “In a ‘I HI Nu v mums "lfix p Inn: ‘1 h" 43h , i! :‘I. 9'"ch ' ll (nix! IIlIII "MN" I II! :I W!!! lII'lH I'M. ‘nil 'I‘I'HIM .-1| "I”. ‘i- alii ~ u- ml llu in ;"‘l_lil\’ -A W” III; In ’11:. an In "I ”11.31315; was! :1: MN m a / Ia“ 1' mdl'llstlll :‘nIb 1+! 1' ’lwl Iih; hl.’ v.4” II (I Ila-ll. It. :‘Ion ‘i I“ “ruin-h ‘II‘J 'Vht “I 1.5.. ‘ . l? m l.» u? 'u Quin - -| #3 «I. J “Inhlul-I: 3" l l '10: N” III Ill 'lewrm r1 ‘Illgi "I I, ‘I”!“;"N RIMI'III‘ Il'II- u-i lib in f‘Il'Iti A ' III! .'I I» 'II til" IN '3 Emu-I In Int... 2 4 :4 W '0 .HH air-N ‘bisI-.~Ht) l4 1'NlIlIII-l “It; In H i .1.‘ I: 'l ‘9! mil Uri .. .s.;I w n, 5:: I... I.’ ‘ivvl1'(.t;' u. wig r z ..; pm; 2... mm ,. 57 1,2,3,...n where n is some infinite number and the k—vnlnea of possible world: where q '3 true is 4,6,6...n. If so it is questionnble whether there are nvmtoheoompued. ShoeRucherdoeanotreqnirethntthennmher olpouibleworldahefinite,hbneondfuctionionotwefl-defined. Unbrtnnntely,hedounotmationthinprobleninthouticlecited. ShoeldonothnowhowtonvoidthilpmhlemiorDBCwithout limitingthennmberdmomentspouiblentuymomttonfinitenmber, Iwillcimplyaidatepth'u'nueuhruiormnldeocription'uooncened, whilemkhgueoltheintnitio-thntmnkeRe-cher’smtooplnfibie. htheaphntionoftheeoordhntudpermhibbintapntntiouinChnpter 'I‘wo,thefuctiongwuhrieflyintrodncod. awe-mum.“ Mumbudanignnndnmhcuvahe. Formmit mighttdemtmh(themior$ocntu)ndq(thewflming 'Athaubnladbyuhva')umtouduknmnmicnlvdne. htnitively,thenmber dm,h,q)repraatathecdobgienlltndin¢ofthe truthol'Atheuisnhdhynhm'ntmomturehtivetoSocrm The Wthenmhu,thehigher0|80crnteo’oocnbdvahustmhthernle dAtheubydnve-(ntm). Thehnctiongitohethonghtdusimihrtoflacher’lncond function. mmmmmmdmwmmammg Womtdoumtdmbntthembunightbnud. The mdnnmhulthehndionnuiptonqentmnomtmadwfltbm tohethonghtduthonwnmicdodobgicdvdudnflthe mupodhhnhtivetomntwhich¢itru,nhtivotoaguta. In MWWMImbmguk-Imtohethonghtdudepictingthe nwmvdummdnh-hmththmw. . u .. . uul'ti .1. It i . H . "- -- . V t ~ an H'- .7 5- H!- .'v n ’ H - I r‘ ‘ to r ' on o 1' )h 5 91-” t '3'! lr;.,i "‘..a‘.»} 5‘“. f’."(li) I‘m! Ir Ll ‘DDIHT. lo a :4 o: -i I in o “M 3 "' l N 1' 0| ,. Ilw' ‘l'ai'l mn- "W rid . -ln i n! v-itilwfl 'H in ‘1 5 . V it'll: 'Jl't'il‘ a}. H; sabrt:1s.|«_ 3i) .Intv-INH IIul rim u! 1.11...un.;. i ll;":- in It" '%°v| ni‘ziiill we" lauwl- HI Husi HUI“; int! "i I Wm: M c l ‘i'h'i; I I" i 'thll ’1”) H. w ilrh-ug " ' -IH| P '1 ..‘ l‘iinl 't l ' illziili .~ . ti ' -..- «.l lle'LI ., -i0 it Hit”! M4 ”til #1; ‘DH ,.3 (4th q»: ~l-n ,u w i3”! 0 Hi! .i. a. He 'Iil‘tro‘lh ( I to! u a) ‘1-:.ult lblii ll him ”3 "li I . t H It -s t! I}! 1.; .' al I lit . ”NHL! slfi'iW'Jl : 3521” Int} sr 4 e.t-¥~ .. “vi In I: m', 't vlil m is v K'Oltla‘il r’i-I tun“; ";a?:.' \l .i513( I .~ it ..| HI! . ‘z in “nil .(HL -;. ion‘ is with: t '14.} ‘WHC I '1‘ 1mm . -| (e: y 5. (u hm: it'n - draw“ I}; fih .N I' 7'; alt-I'll H” ‘H '4‘ 3‘ Mia. iv 16-11.!" 'H»! "H's-d 013.1 '3 I“ hium‘wi ~35! 325.36” HHD- lhlt'r‘li'flll "'5 ~-' ii‘4‘i"’1. iu‘lfl «h! u " lb rt. I" o" - HI i-u I. -l fll'fliii .17! i9 kHH-L'J 31--'.’I0itli I; Wait Mn N whfu ’1'iiicm 'I nlzlolIJ "oi: M ”NH Jul ' s , am a". m --';3ni~rl l” hm,“ m It, '3 ”mi, ii mm. a mi, ‘ i« sin»: "I Mir 4 m h. wads"! I. '32.. v. Nutmf uv 6'39 1 Hit t'nimtm «H tom'rl' 1.” Hi n'c‘ei; 1" 'ui‘Hi" i" ‘1.”7'“ #1qu ’1. ta, 0 "blunt" .9 in It .. (1 pi H u i n n‘ _ l 'u?! H'ti; .zuu- vi 1 r» 1+! ~..:-_,., in www.mn ‘I :‘uwl u: z m . u: .' and NH i'tliliiwliti “twir' ’l iln-H'h“.w!~ "H No: .UII l- in n: «at: -Hu .- I I c -.ia oft "1» "N Li”; t' iu'wth {H -- in “st; Ht; (-5 Hi foam li"a' .' :1 I ' ~ . . in l: H '- In a «In; I H3 n 't- 1.3.8 iIHH nn‘m “jhl 'ts' 'vlfi "h m Marina! mi «1 ui mm is ul "'1'.” "I xvi-ll «I .3 r «in I». m u' ‘IV-‘L' -: 'n-r -u; «no .... «I ml wm -h in ill abuil nl ml ‘e’n «dawn-.1. 9 r; Mum" .5! -'.‘-t-'N $Ilt!» .. "Ht; .1 ~-..~ I on m low-'1' HI --~d 1* “- 'Dtr. N »' ”‘44 h wmrxr 'I‘n t'v-t HenoeweaddtoDBC: 7.4.3 Whereabungut,m€M,¢bnwflnndkbnrenl umber,g(ln,a,¢)-h MMdWmnmt’onadeiI-ohbly unlit-nu. Weenideronlymolthedtenntivee. Onthoonohnnd thhgooduunhhthsvetodowithwhntapuhrcorm Inother umthembnightheuoduingdwhntbgoodunmt. Ethic Wimmmhmummiuefamdmu whomedonuilynidtohveobfiotiounthcthui-Mmto. Olmwhntigoodtoungeltnkhthehodluhwhichilthe nee-doortdgoodne-thntmightheinvolvd. Undurth'lcoutrul, Wrehtivetoauvhtilbeufichliorawhothuapnhuitornot. Cngoodten-epeopbhnthdlorthen. hothuma mkhtptdercthMm-othhhhdhwmmm Moduofierohurver,daahoohteotududhhmgoodm, «flu-himpo’ntdview. Andthegoodu-depictedhythe qmtitnfivevahemeuflmuydthmm Ithatthijuctmthntthohnodumdi-ubutoruy mm. Itiperhnpomhalplnhilinfluddtnlingnhont m'edic-lthewtmflhudhmdndm Itis podhbtodefinoucomt,onyF,hde,G,ht-uppou, thkaMu0¢mWHmd “Wbfilflfifi hthbmitinidthati‘huheandncod toG. MhumwmmWWW-m thntitnnhlnodm'hetheroledefinupauibifityintermaof Morvicevenn. Undueithernortdco-truhthenhthicmodd concept-Irendncibletoone. Bntnuyamethntitishtpruent) h t K" ‘ I I 'lh ') 'h "I M'-‘h Hu .4 - tinill (‘0 .o’. 3! ,.l'.[!11‘ [V‘WHH‘ ' Ninth-.1 a] awhilnrhg I” 'ufi'u‘ , cu-‘t'fcs 1.; ”a: lr"0|1|u‘(3'? In "T‘-"t.-§( “hi I e I I ' In“ ui nun 'ml at . "f.”UiIJI MI.» mil in 'ml » Hm: I :lu. tin: w o; . lo M Hit-t6 I‘m?!” '1‘ ’1“. [1 1n #1 -1H-| H lute N 3!?! N In" H] Hui“ Hi .ull kr’m' .u- ‘ui’ wIsil 1| M” r: am hi. mum .« I» .'N In bur-NIH 1H“ mi Him-q wit. v w“: Jim” "HI Jh hutuuT-It ’ln'. whl'flj-s'l pn- H'- we r .. R Iui runny NJ. Hymn; #0 Hull run: r'Ul'VJi ilQflHr‘i'l'HJH the” "l‘quWI ‘ti'.!lT!IZ...?"-o “9’18“ (-i In.» ILHM-ltr‘rt" ‘JE'L he!” nit r: ti-Hifl .miai 'H-\ [Hui 'm hit-m! m'mn. n; m inn)".{ n IwiN ,wmnw ”in! MIMI/mu H.” 1gb"! .lumrm mi "3 'III ‘lvlt‘ PI'Wh. W4." 34: ';..,4 |U., ,.,,. "M "I“ H f'"??H-‘ ll 'I'Kfliuifl I'I- !HI I.l'll'!|"9‘.| r'l “MS" (“is I) H] ’Dl.ll.| i] r.".‘nliur‘t",. . .-; mu 1mm ni um?! v-x i-sd uni wéw'w um ~ us inn-u 'm- .-.u-... -H nil mud 1‘nitm .lr-num ia-ul mil ‘0] H II III sun 'Hs hm: mum m. "w «mt-j wwl'uma [Named 1”] i:!1.i:1'!l~.ir “Ilium”; flat in .I-I'I'm-Jn 1H~3~m in EU” ““I'IM H" I“ l}’ll1'i"0il V~"'i§.iloon"_’ 't.- .l.’ I;"" I". ’Il'ultl 1.’In' (‘2‘ ...otll it ' I «will .r-lfl'tq ‘hr'nil I" rilh’ ‘Hndwrfi ham.» ‘Hch'HII u ‘o. . ‘iltinflllchdut rm int sen-"i8 aliasinli'lbn In mil/1 "'45: 5:41.; 'anmsli rm! I: at It Han-c4 mataim in lm-wm u .Lmi-pl of? O ”it’ll! ’19.”! D. (.3 H N lg! Irin‘i “I H .lll/tdtn‘l'llnifl'l in rusltl *{l i’tlldi Hi r’?:thII Hill w'll‘laii. ml It: -'.. Hon.” ,. PM? Ha Pat H Aiding“: h: mum} m l um .Ymrflu: “ms; 'n'ui-n. pl '21 i...“ .g m MIMI Ill lrfiéill'l' '5‘le f.: 7.1- liar "‘l"”!“‘:l il‘f’fi"! H 'I" ‘li'iljinfl‘i "UPI r. ”Ii-2'01 now: and t tuil iasm- «i H urns: whil Hi .1. cl ‘nanisdmgm 15...; *ol'J" ”PM” {It “in!“ i ‘ul‘vtl. )1 ‘HI. 5"9siii..lu.ltl “H 264- NH Rh inl 0'." ’ " 1: WM! .1: Ju'l'ivmu] vim—Mb an: Han-MU: H'ot'nnzifi- tut rum” H 3M9! 3H...“ 41“.“. ‘hii ,ir’lhun 'Iu I11»: 'I'uinu Tomi} «’1‘! 934] 'In I)..--..~m ' . in ' ‘: '! i H ‘8 LI '9 ‘i .h .‘Iihlli INK" ."UH "3 'Il H H3» H H 7 ”"" ’1'“ 59 mvoidnbletotrentntleutoneofthetwouprimitive,thntis,thereisno wmwmnwmmwmmnmd whichthuetwocahedefinod. Ind'ltingnhhingutnrnlismfmm Moucuthinkolthenonludtheuiobdcdooooeptsu Mum-anew. Letuonythntnflotthaeoonoeptemfil concepts. Wimflymnintnilthtntledo-edtheu Will-him. ThnththerehnonoI-Mooooepthtandwhich alienation-how. Themvnrintiouotcouu. Sommight-fitnhthotthemonl Wmdlhorednoedtooartahuiobdcdw Formplo, Itifituhumnydebethe-ordWhK-dm. Montcalm-Weak“ Buttheynightorlnight ”thew-m Althotchthyndmthenonlto fieWWitnighthethdthaemltiflnom-monl, WWhta-dwhichtheuioloficdoonmmhe defined. houdPriofodetheAMh-Wof doonfichdc‘5mdhgtowhichnmddnhbmjutincue “What“,hwwthmm'umm tutu-Bic. Homudthuthecinpmdepictednmbwhich thantionwuperbctlyopplied,thntb,whuomctioniuoocuredjuin caoitwadeoervod. And-hadeatiitnlanordnotion,the Whamtunlynthnonlnotio-hta-dm“, itbnotutnnl'ltic. harmitdounotrodmnflllmptoto mun-MW WhetherornotPrior’nugmtomnooeptnhle,themtionof goodnorevilinnnctio-iuinvituthereductiv'lt versus nonrednctivist ~u i’Hia‘ v"! it no , '. M 'x i ‘uw ll 'h'fit I L H ‘h 5. «I Hi ' H'- ”JIM in 'Htl'tl HI .N-."ba'-u'| n. lud- «at; H-"li I'lHl/lio ii lzl-szum iuu'lwiquuu t ! NI -:!-'cl IH ‘-:c.£IIH\tl ,"IIHE i; u .i: Iii {run} it ‘hI all. . ufll 'V‘w.‘ ii 4154‘; «a. .-n,~.....-. um-...-.«.ps "Ii; Mao-s ism-m as?! in gm: mu ‘24-" m'iuuvrnam n U. 'vsh «"2; ‘ ulw‘n 'kuil In i‘h mail {we «I! I‘ll ‘Iiilslhi '0”.er .. 1' a»! "III'H’ d‘ui \[ 'Iuii in 'mv 1 Rd N: .H .il I'llhlllumt Winn.“ r‘lvtuuhlguglzn. .r;-l-nmn d All” In mum at Iq‘v'vmm I1.-Ilu=i! on at w nil ,a-u 11 iii amazisslq «A ai-n‘rliu') .i"'l!«t 4* ‘hi ”I": Mtg-rmu'n 1: UR» ui-I'HH “’1“ Jo.” liih‘th‘anu Itiqatil "HAHN. ‘bv’Hlur in (HUN-wish! "’H- Wi'flli "i'. MI?» W] dH'HmH itz‘i‘xui ~05 flit-310'! m imam ”J L5 in.» w-‘Hihn .-’r"viI"KD}! In KIII‘I‘H U' rniv‘ll‘umlbci'i mum“ "toll "outwit «Mum mlnl'H-lu-aifl “5-1." 1.. Hi! I!" c’ .13.] EI.\. I; "‘3' ”.1 ur .r‘Tut .H 4333'” lu') .H s't- “.1 AH ‘Hh "Nil ..2 3:1 4:! am wuslvn [Well 33:» will! .rJr'I 1.! {-1- '1 P-r- u:lu‘n-~ law-"ul- -!/.§: uI Inn in Inmuun m! iii Ir ma ‘I'I‘uul Imll «I “5 ya" u r Ia; - .r-.- ih -t'.'(-i’tl/B 'm! m! the: «Madam; 11.»: «hum ‘Mil “min in huh-9' m rig .nw': n. -.'euiul.m1uu .imuzlwu In ébu’fiilhi-guun "illltu’t'iiui! nil in encairaanh « Inn; i-a 'H~‘l III Wr'b' I” 'r’til fl ’i‘ir“£az;i 3" littlu. .‘al 'hhl". I" Ii In.” 0’ Niki-IUD.“ ' 'u -5I Iii .‘HIII Mun; It ”"41" it” ’Iltll 1:11qu ‘Hll 1:73! il'hxi r29 ‘5" .fl'lii'llil.’ ‘9le ,_« '(lii~‘.v."'iil H 0|“"” U! llrnbuilw Ii Urumqi. lithiu-{ifiqum 'uin Irwi’ irm‘ng. ail :31. it:.t|lifili [H [,r; ‘3‘!"!;! in. guidaniiallolr 'H'nirl .o‘tl .Iisai‘ .il'i. t-‘Os 1%! Hlo‘n; fit.“ HUN 4...» “Nil II-diun hglmn n “was; at H'v-AW mm.» 13:1! Eula» :1- m.” n 0'4." I'D" I itxlualuiut'l in rt'H'tD Ill hunt-HI! It I”!!! ‘Ilii Iii-UH I'M f‘zutl “him *-7!l‘li.i" 'xi «Iqo‘naua U. '3“ "out-WI 1'!!! Wad: H flu“); ’Iiiu "t. .‘d‘-lls.'lhh.|l mu :1 :l r H nun-t l'. -tu'iI "Hi In Iii-l!!! Hot ‘nil 'Ihib’i‘i‘t -' m “-13; -n ‘HHI‘"'H~ ,. tul‘li to II In PM" Hi ,, 1 .1. aIH- H. n v-lu'l I] '1': lil‘t|.s.‘s8 ”i: .r- H J”. 1‘44"”! 'Hfi" t.’ H 2. '[u or'qunuih 60 controversy at 3 different place. Whales Prior believed that the Achilles heeldnductivhticmdthemiueimpfificetionwufoundin judghgbuthenlctioneppliueeeocdhgtothedmplificetion,theheel nightnbohelocsted'ntheintefiedeo-trulottheuflinvolvedh auctionngtrdhudhowthemctiolinpplied.Thetbtony,themord Wmightaflhendncihhtotheubbgicdmhntthehtter Howeouldth'lhppen? cheprdueeeecakuhlanocietedwith hnctiolg'ntahlhthefiutoe-ehvhgtodowithwhtamt dehumpuiauudiltheneeeuitydnppflatiuhhedthenotionof daemthentheDBCunlyfidthemnlnotio-hwhoflyredlctivhticin fimMJdMMWmthm—MW. heewhatbduhedbahcteboutthemthham,adectnddeeire mheducfihedwithontmmmiveddn. hthieeuethe WWMWMINMMWW hounds-militia. R.B.Pary,lormmph,ofleunchepodtioawhen hmthetthegoodiouyohjectduyhtenetwheniltuuthuto dowithwhtbthecueudnotwithwhstughttohethem Olthe mm,8thwflakwhutodowithmiwotmilitm onlyhedeocrihedhywhtoqhttohetheeaeudlothywhtiethe cue, the. Mica m b po-ihb, but W mun-him Atpmtthemenlmmheldtudbcuedumu ithmonhedthntthehmdutunheuubeatmm. DBObmfivddhyeWhhfly-dmtmnductivit mummwmuwmhmsnwmh mtiouthembdGodhnatta-ethicduduiohgicd. 'i'HH’ I *1 w... - .H ...., no. :‘o' mu“: ”131...: c , u...».t. ’2 l V m u... 1 4‘ h 31-d'v'i'ili dunk-:1 mm NI l-3 r.” Urn-'- 'vh-‘Hlln “”1 In c-Hi 1- n all .flnlm "1.4:“ mil (":1 13:3:Ilaaah. ”'Hixitit‘i lluil'zlzw. Hui wwi MUL‘MI. :u Madman” In. mil In imrncnn'. squint!“ um "i imsyua rm Ibuéfi u: m- .' t" t l g A H- '.‘ «I: My” , {ah I). «i If H Is‘fii‘I' I“ '1 oh ‘1; Illlid “I“ NH” In .‘ 01v=‘i ‘t‘! (I! :ll IMO-w 1'*i‘..i “til i: i rIII-YsHW'I it «‘41:! at, NH? u.) ‘n I: . :1 "MI “h h! ' ’tld‘fnlu . .‘111'l1i"l Hinnl'i'i 11111" 1” iv'an-ra. mildhtsu 0):: -‘I -1 ”-0 'NH ll WiH-I'IM! rm. lumxu Huh ”"14 m; Vimill thin ”in u.) '3“ou quire Inn} min m “0,th as 9 umlum'l .IJI-n «it 1.: Mi] d ll"‘.H$'~:~}It§ In at sm'ms‘ «m: 3! i411: ~14: r14 1n r‘tEV ,1. 'lr‘lIH'UiWI iii'hifl kl rill *llul it‘ltrul ‘Hil ‘iu Airiicddi Ilil'l H" lit!” i'l'tr'i) “but.” ‘I.*IIIDII ul Iv‘nuiwx ml in"! an". .1: D V «II 'In its; 13;.“ ‘wfl'r mil 1- Hwidfi i'ms .‘Hn' "411:1! ILN "1i! ”Mia; I'm" F PI UHF-“H 41 ”MN “div . I Q l . ‘ ’5'} "3.. an” 3” ‘I'Iil'vll “Iv-”Hun \Mhlluh 1".” ll- 'n.hN irhldww». "hi Hos“. i'dmw n hm: "ait tits Ila: Ir s1 In“ If! til Irma»: "I h“ III in. animui‘ml nix; ul min-1 t ’ "HiN "mum“; 6 ti 11" #15?!” ANNE/‘1 "lni .I'H‘!i .11 J .s‘iliiimli'] J‘tn‘ 1-‘«'2;°‘1' 1 and ‘e-wrmn 'H'HIN lfi‘fl'fltll ’tih i-v l‘mgviu ("h v.1 lellx "vl it '3 *‘oz' ”1 ‘Hi «H m) «a.» «nil Id at 1.. w) ham aiazu I." In”. .,,,--, mi: --a 1.11” 3;. u wit um u 11 .ai‘mmz. wmmmua (ism us.» u' nmi int.“ -éa;v hm ht! ll .1'114'IFUU'! 1 w. “gym, ”Jill I'I Ilt.i!1v-~ia 'Ni ’iH-I ~15 .4 [Hi3 hi hm inns "VIII '1“ "hi 1 . ' I .' l ‘a ,- mun/.34.; all It"! "Diem-um) m 1* 410311015" lumint Hm it»! w .1 o 01.1. iunufiw H ;.:.«1;;mzm...! n x v MI ,1; ivv'fl'lvli {III {Mi mi [195) r'blli. qutis It var-v, m: I. ,, v31] 3, ."1’vh"| later“! Hi ‘fidb‘ [11.1 ”‘14.“!qu Iv ~|I-»'.| ‘05! id“ ‘0!u'.;“‘1l‘11 .. H l 'ql“ hir‘h slvm fii!:'»t‘:3«:i«.:i.nt.i a" hm: .’if¢-._:ln.i'-. "9in 8 Hi .-'5n.’livi|: at .1 Ir): '1. r-Mtli ’ m "HT”R h-Mrn'cmu ml 111'! I'NHKNI ”Wail MW “’U'WJ‘H'I , . ' l. Inu'wl- Ho. his I: MIN Vl‘ulmu Ill Mn! in '41-! «a? ’ i- turn” 61 Thewfleiorwhichtmthoonditiommtobegivenmoftheiorm M/WudwtadharyuMdthebm'obihetterfor/toa thud". ThoootmdiuuiobgicdopcotorbAudtbmmm cuoooodildyhethouhtolutrouhtio-for'¢ihighetolthe udologiodocaleoiathub‘wu‘. TheodditioutoDBOmtoxm: 1.8 AxiologicolOpa-otot: A. Whenaiootern,ud¢ud1¢mwb, 3.2.11 “N’- 'l‘tlthoolditiouiorthemuiologicduaiptioumuiolbm: 9.14 {EM/WIW-t if fimeflmaM), other“. it h f. Theevflinvolvedhthennctionhgmthomollllhthtio huoqhtohoct. Formpb,it'lnevillorJoh-o|thotthetmeinhio hatyudhlbonh’nn,hntinordertoooutthehlh¢oltbetreeuo Withouthstthehflingn-thehmqhtahont. Leta-"Pied hJohuou’ohontyudhboIhim'. The-Johuooilnlctioudoulyif (3:)Bsp3. hthecuedwhdfiuchualbfiltudcwm pinion-mute“. WhnddmtaflnmmMAd-Ipslps. Shoethuomcmhermebcotio-wewilldoptthofioflowhgnototionl convention: DIS ~Sa++(38)(BJ$AAa"¢/¢)- hotbeMa-fluiuctionhgjutincueofiinmha’oudologicd mkhgthuifi¢adooneolehrhpitohouttht¢ ¢Inutheofirut oduwflhmhRuchc’ota-o. ItohoddhelotodhuethotthoDBC Wubnotohhtoooooutioreutoilomditio-thtnichtottochto auction-mimics. Fammiflnhowinglyhfiuohontoomething thuhwfltomhitneuthotlhvenotn-ctio-edhhn. We mightwnttooo-idutheouowhen,iotmple,nyneighhorhfinga ”HUI In! In ‘1” .I’M‘ H H‘ '15 RH akin. iv isHL‘ 1i :1. ' 11‘1 914/ nil or} 1 . 1‘ "1" -'il .. JUL"! ":3! I" f-III’NM -.- Inl'li-I'ih 1.. "'1'. ’I In.» . , "11"‘11‘0’ l’ "I '11“ i‘tlh’ I ”I Lillsi'NIU Ih o. lint/ls ‘. ”in" 34"” 111': ”-qu 1' u! _ _u 1 : _ ' L1; "1. I 11 HI '(1 l. '10. atlw.iI.:.:|iI-.|’ at; ‘11 'a;‘41111.1l ‘M " 11.2.11' - .1 111.' "0'31; It":1"»' l-iiH .1 min i I; "11.9 v 41 13‘ :15 . 1w L i1~ 93, 11". I 11.10.2‘9111) I“ 'l::'1‘1.lv’ (‘1 I M11” '91“ J ifllb .‘ I‘ijl- .Ilii" F VJ 'I 'H "1:1 .r‘il1JHII «'6; "it; nttlw'i'ii'twb 11.4 at" R ”‘Hl Hi! '11:] r‘I'Wi-Nidus' “”11 1»: u man-mam 14:»:me . mm is 1;”11'1... I. ‘ 11.: 'l 3141“ r‘:inl§1~ .11? 931.3? 6 £1 HF)!" ti£Ii-'liiiihr ‘HII HI im‘li-IHO i. ’1 Mi! .4” g” 'Iw‘Il of: “:111 unwilliwi. 115‘ iii“! lils‘ r11 11 ':;-]$I:a.."~ '1Hi [tn-‘5 "; ”'11“ l . .i ' I . ‘ .. at 1‘41 ‘ml 1.! ”HIM 'nll 1‘1331'1 n! I"! m m Nu: m 1' Nu .. m 1.19.! Hint. Hut "1! 1 1'2,“ PM .Illu‘iii ~).i‘,11ui'i ‘hi lrlllil ': “a”! '13“? £5.11] 0.11"”! 11 um! ”iv 1! mm iI'WUU'IHv w! u'vmiwi. Irni'I’ "mui nu rim; i 'o I mm! roams-int. m .swrghuoi. '1 :II'UI'J :11. 1111: I» ”i r:.g.- rm w s.1 twin .1” w 1.1 wit ui quit. I ‘i. -i 1*! 1111201111 '51“ 'm {inc-11.; '1. Lynn. i. "Half! .11 vi *1 nut-nu :. 5301111111" fgiflfluii'c‘I ‘111! J-E‘::'i6 |: H '1’! .qt.."'gl'iq-i ~1:1...-'}Iuig.vu WM" 11.-1,:I t! .'. :I?- I1“ ix‘ln'z I ‘. LIA»."1.;:§'.‘ ‘." 1:.3 .- ..-_ inc/14 .- .3 Hi Tami at 1.. mm m Mei MM: 'Hio' w wr- n ri'luu mu. w 5‘ ‘~ K gt. "71'!” "‘11 I" '13:;1 it! "if; I! r ' “Hi 'iziiv‘lfllcw’. Ililh' 1, VI ”1.1;. ftiutcbi 1.: ' 'tli’ iihi' H‘NI Irn-sgl “I :ilh 1; w'ltliil V'lqiu 1.1 11‘ ~ 1" ”I" I‘Hniu Hi If 'L'H‘i "if’lflii ”iii, Klg-Hiti‘ll'r} lilb!!‘?'l '1"! 11915;».ng "3 >191» 111‘ “I ‘Uif'lt'i'i‘ ‘Htlu‘ulhv’. ”Hash ‘L’JH'I I’ bitih'nH/Itltl I 11 ,'!i-ll“1€/‘i '1! i .rHHI'tgllW-h HUN-11:» ‘o:’.‘ 1:11! i"Nl 41311168 11:11 4&4; I ‘1...‘! I.-‘,It'to' H ,‘i-‘I‘l "-I"I‘i|li‘.lf In‘ Lin #1 1141' J‘~'.." ' ‘0 ,'.. ‘: '4’." t§"!'!",-.‘.§ ",;l '..'!.“l I’ t"."~’ 1;, O. ,f , I'L’.’ '3' 1". '4’ ." $ . 62 ohouteomeevilrelotivetome,andhedoeethisuopnniehmenttomefor trhnmingthegruououdthefirohydnnt. Hovelbeenouctionedinthio cueiflhsvelohowledgethotmytr'unmiuhtheoctionforwhich Mtbw,orilhvelohowledgeotwhtthe min-thinnotiftheleblooetdnhgho'notuhoVItome, wool'd’ngtowhichthettimmingotmmldfinhydnntoiolorbidden? MWmhporhItton-ctioouaiptiomdwtheymnot inchdedinthemthoooditiouiotnnctiolucfiptiouinDBO. Nauthhithhteudedthotmmdoruiologicdeooeepthabeen Whammuthkpohtdmmy. Suction, whateverthoep’ltemicoo-ditiouotthooactioocotthevictim,btobe Wuhdmflwwmuhufiehw oppliootiondDBCboo-euud. hChptetSixweoo-iduwhotMoobdifluutinlgoodm liloethil'lhvolvedinpndutinloo-identiou. hOhoptetFivewe Mthepodhifityotcofloctiveoctionucflption. Fotennplefitm ph-ihlethatJohloI’o-eighhonoouldooopcotehhrhchcitohoutthot thetreehhonhinudiorthehflhstooolltuuctio-hginthbcue, mthoqhnoouottheudonhdnpthbohont. Butlorthetime behalhnhtmtoctioowflldo. Shoeitinoonnootomdpuflanoeelogiatohnmgthe thouoruiounqnmtothatumehem,me,ud 112.11 um/wnwm Nudechmthstthegoodne-rehtioobutilyn-etficndcuhe nod'll¢hhetterlorathn¢thuitblotthecuothotvhhetterior athutb'. Itlollowohomth'lthotgoodneu'lineflmdve: 1 ‘..~ 1 -*«..a .d 11.9. '11! -1 .... 11W! 11...: 1’. “1‘ -l H MIN-11' av .1131 I '1'1.1‘ .lugl? - 12 5‘51: 11.11 111111.15 -t.-. 1 1113 ',1. .1 .1 ‘ 111' n '1 .1 1‘1'1‘113 'nll r1 21.11111“. :1 1111 IN” '1‘ in. ””114 1:11 Him] I it 1’? 11:1” i" 131? ll #4111! “ll ‘1r1'lfi I 1| 1” ..1u;1‘1'.'l1.71ni 1'! 11141-11; 11H": ‘11 "I 11 (It-.1411“ 111 [I NIH A ,P‘o‘ii" .311 I'M CHI (I ‘0'! un‘ ]. 1.1 |~1I 4"] 111111.: “.111! runny-Hi '1” 1.11.1 111$ rrI-f't i” .1111-191111 ”:13 +£11.11! . 3111141111- 1111 ‘11!» I '1” Sill .-1..it- ~E1oii-Ill’lrh “"131111‘" US 3111.3:1'111131 ""18 '11'i1~!-1 1" ‘71 V . . Ha I 1.11 11 HIE” ~11 11". 121-? In! '15-;‘1'1111 11’11'71 '01" 111 1111'!- ' l ; I C 1 I . :1 ' 1'1 (II. I, ‘ ”It, 0 '1. 0+ :11, .1, I: "'11 I. 11)].‘ ~III J; "I I" In} 0.”. II iI f" 11‘01111‘11'1a 11' '1“th .1'111‘!: 41!. ~ :11 u'a»."12‘r Ir’ 1n 11111111 (12 . 11" u» '3“... ~11! we.” 1" 3 11.15. ”1 v.1 .Ir'n 1.1: m! 10 you-4’ .51.... '51 1n cti~‘l‘ibll'."l 11.1 11.1.31. wait '1 Wu..." H ' g ‘ v . . . ."i'HWIOH "11’ ”h 11‘ "J. .’-"I(1I"'I1i1 :1 11 ‘1 1'11. I? 111 ‘1."01” 11» '1'.” 1'“ 1111111 '1 41”“ il'Hli" ”I1!" 4" ' 1" 111 10.31. ”"13. 11.1116'1'1-51111- 8111:“. '1‘11w*-/1 11.-in 1114a; .. HM Ii" Tomb-11' Iii ol/ '1'11 I Itlt‘1..; ’ HI . 111-.” : o: 113]” ‘1‘,I”~.i,“ u. I“ if. -'i‘1l‘" ,. ”.d3 1, 1111" ‘11P"?! ii ‘Diflniul'l I1 I 11111.1 1"» 11.11... u,” -.-,;i:.. I“ Izgltgi; “N. '11“ “:7 1141.31 11'1“”: 11 51112511111 m ‘11:". «I'm-I iriim'n «‘1<~isi'.1ifl v uwnzi-‘i. 114111 'Ii'iir'ctilw n... «1151' m tulmmlnum r'h 1mm. u! smiihi ‘11:! lui irm; suni 11“ [mi '01” mi: 1119‘ 0.31 I111 ’14-! “bulb r1111 fj'134l1i ”13.31. 111‘0131 it» '121'0 ~11! 1‘IHIIIH [I‘M/1 .11 iiuv 114121.15 111 as 11.111: 111» mu wt '1“ 3111-11111 Wind (1] r11 21 '11! isI‘I’i" IsJW/w .11 "Huh-sun 1 11 111111 ~-'l.v«111~"1-l plural-VIII W1 '1 01311-111111 1r :3 #1.! tut-:1! tw'l Hum/1s 1n twain (1.1.1 WK ‘..SH---6.L.r1 11.1 1an W11 w: (1111114111. 1111b ~,~:-I ‘Q‘y/ iILi .1 111.1 1311.. .111‘H‘11NIH1L1h rt1 11111 ‘:1.."'! '2' ‘Hiuc 1‘; '1111 “-115 «011.1 mi: 4/211! #1111 11.1 1"1i'HI 1 J H.111 9’12"! ‘1?!) "’Ii '1‘ 1! "id! J “1111' H 11o! 1151‘1'1 41 v.3 I 115‘” WHXWi‘ r111 v.1 "'31”ng ’Iin: VII... IIy'I'I} I H‘ 13' ti I; 12.12 1=1Aa¢/¢. A50. 112.13 u-(Aao/pAAap/WHMN. Th'nthefidechnothtthegoodu-odotionbtn-itiveudcaherud 'H¢’nhettetiotathnpudphhetteriorathav,tha¢iohetter hathuifl'. Fm,weohouldnoteopou’hhdtentionilthelotio|dvuiut thhichwo-intmdnoedonma. Aoootdhgtollo fi-vuhtthIbdmpiythifihhlwiththe po-ihhexoeptiolthstthevuhntwodifluututdmtotoflot one-outthaxdou. ThivuiotioI-ightheaqnldedtodlowior vuiotionintheadanatolmnlu Undfiuighthe Wfl-vuiutonotoulyiftheydiflaotnootinwhtoeto‘mte thehlhmtionufigntoflstmmtmh-tabofltheypodbly difluhthelmhutheirghlctioumlptoflotm. Th'nnltentiouvonldoppomtlynotdtctholitolthuuud mtheoutehtedtoqmtificotio-mtiooedoombs. But,itwooldhe WhmfiWMbh-doofloofiwm, duos accord“ to Itflituinl unethical views, the W Whemdmaauctiolhwtodowithtbw ammuuumwwdmmtmm action. Butlhmnotyetgimthb'I—etheottutiooitm 6"....,[ v t. \ {A "\v~.if'rl’ {5;i Ha. 3.34 ‘M‘b‘ H! H H 09'! h 'i rr-I..«'r‘.’ 'tl‘! luoi’ ifflltll’fl’ ILH'K r'lv‘l " 'i ’i I. M NH ..' III-ti’i‘1li1i~x$“flt‘ 'nnt’ - gunk ~I In! E '5”? n , E. .: «um “10! um» I in ”“44! 113‘ H! Univhu'Olnn' 'U-«H’U‘. b 'IHH i'iiiwd' ”N .‘uMHl H ..| mm." a: -'-t~ Mom um lN-HM-dtu mm duh! l|'~.‘d.i"a‘,'!llll wur Mm 1. Mai 1w; na~m-.i»1«.:--im us li«;m.- «I i” In llo!~t~s‘1*_i"-lil Iztmmw H; (l 1.! ill! "II Htl In lo! .Hl‘H‘v on 6\ vaf-‘nvr'h III. "I“! ‘4" “4;.- ll 4‘ . . o .. ‘2 ‘5 . l I u an; Nam u.» haunt“. M :.:--.:.s ”Mum“! ma: ml... :4 mvll Mun-w b 5 hit: 9 rum! ”wl"! 2H1 in it§~1z:.“...~~-.Il we?! .1 ,‘gi. hi (:1. mum! 1:: hr 3:.1 :1 cu Imp.“ 'I. 'l-nfit 1m} h 2!“: I11] any... I ~ rump-gin. . . n . I " «NI ,1}, ll “-4... lwl .IH inumul wwn ‘m . ml 11 -’.rh -H.H.m-t \ U-ul "‘94’ Ill 18 u u] II 31!. 40.3.31!!!“ Hui] 'I'»'::.- ~. .H m EJiL.l ‘-’ "4 "33’ Vii" N's! Nuimvs‘lb biwu lllvglfi'lwl. .wH 4" Him ’I II .HoJ 4 rm; "0 I 'tl-Hul 1.! slui'nrumvmq- «* l-‘nh‘l I 'n‘uw n wrmnnrzu v.1! “(mum mt luisuu xuz' la) la. "Jamal“. In nulir'd u} 'c ...itt What Up'vtln'i '13“ r 11'" I is "li' dawn. lig-T! ”Ail! 5!! u] gulfi'lu u at: 9 .1“.- I : I l tin-WW" ‘uH I‘M” In“ It! 't'mi “curt: lit; in muffle “.0le 'I-II ‘;.'Hltuisll"olD" ltI“'u "I“ in é'w-Iiwi'n'vhl ‘uil Ii'll!.a Chi! LIII- “I ah ii“ I" m ‘ smurf". sq z'U'v-i N III‘UH"HR mi! ”Moi Nah u'rnu WI tun 'Ul 'i l Hui "an CHAPTER FOUR OBLIGATION, FORBIDDANCE AND PERMISSION 1. MORAL PROPER TES AND MODEL CLASSH’ICA TION In ends to include object m ucriptiou at obligation, mammmumwwumm. 1.9 Daontic Operators: O, F and P. The W Vb In: 3.2.12 OM 3.2.13 Fad, 3.2.14 PM. Themtotrunhtomfludthiorn'abohfigsdtohhgitfiont M¢','ahhbidduhomhiuilcit0bonttht¢,ud'abpamittod tobrhgitMthat¢',mtivoly. Tnthcouditio-mdbphyodby WM Forobligstiouucfiptiou: DD: hOa¢HD(-|Ba¢->F8a). Thi'ntony,a'nobligodtobriuitabonttht¢jutincuos wda’ohihmtobringitsbontthtfihthflabmwbo auctioned. 01’. {film mah- a’o “flaring auction uprevuttbio. Notice MWbdufiudhmdthmdebglfltydby hflingtohopobliptionnthathlilmdthopmitivehlfiflmentof obiiption. ThildiotingliohuthomtiaotDBClmmthouinwhichthe truthco-ditioudobfigflionmtacuminmofkeptobliptiom ' H ‘1 ‘ l , ‘5 A -0! 4" Inn-«o pm ‘1‘ M ‘Q I- I! ’\. V‘ Q ~— 0 \ . \ A. i boo ”Q a l‘~ - - \d a II. ’1‘ O .. 0-“ J" \4 VI ‘ I 1 1 I 1 l ) ‘ . I ' 1 l '5 5’ ..\ ‘|( I b i | i ‘\\J’ ' ‘I‘ |“ i \ 1 5\ \‘1 H "I \ Hi4." H1" _’QI .1.1’c‘i"11arfl ‘r‘ji‘M'J'gJ " if ;.¢ 'ytvlii I" ‘,I '1 nth. H; [Io-n- 9:!“ ”Us xHI'iHl'oltq 1hr ~l “‘9“ 1’ c! , p... ,,. "iii It"! -'lni"1 lath ””1. 1 § “iihi I ""t‘ i ,‘) "'1 1"": '\\) I. _.‘.,t‘ ..' “‘ 'tii’l :u’i:;‘z“.;" "“ , 'i“ ”huh. H ‘Qlll'tci w 1::- w 1.. r! “ Oll‘iw‘i ‘Hu- in or. n] H 1‘" 'iii.;o9‘,‘li u. Hz. v u 1 a-wn-sa'l‘u] a: 1." illlh 31.1.: him”. in ‘--1 Mid mun s'wi '4: =1] 1| .‘ ."u H. '! M ts width Wu; 'r'llui!.1oll'.~l wt": 1' zéwn‘ru? s1 hu‘ Muir. 3. .mM H‘ apart"! w. w-m Hi. 1.; r-wnil 1:.ulunmu‘u3- ! "1 .. 'i I ‘ ' 3‘! K w: l 1!! hp! 7 u :21 u“ in il “1‘11 1:] bum-“u I a .ihr. | 1 ‘1 h i ”1 Hi ‘1'!“ ’ dl 3' in!“ .i 7 Hu'i 111‘10- il ‘43; vi \‘1 .I.‘ J r' .. 1U ""11 "'1""N‘ ' wimx' 21".th #me u» ~ "n -» ‘Jil um! r. .» nun! 'd In? r— 1; ‘ilnli :n. I: L. I ”1"! a-j' "I?" “(qr-inf.) h: w.” Ali! 1" mill '1 ”I "in“ ’l‘ I li'll‘i: :i'g‘.’ ‘1‘! I“ 517"”;I10i'.” ‘illii‘t-t. ‘Ilii I.) M'IQ‘ti .5? {Lu} ' ~,H:1 [LAM 5.1:, {"2- 4 u. "ugdj ". 1 _ 1 1 a: .1! 1.4..” u. we. :11 “in” [.1 .' 1.. a .numn w «.1 . "2. arm.” 1: run; .114": '.n ‘H' .1. l~- rt «4 1H rm'hd 1!. ._. '« awn; . 1 mud ’n In [I mum...» “my 65 insteadofbtokenonea. Hintikkg, for example, recommends thutOtbbetrue justincuecb'ntmeinzllthcpouibbwofldowhmtheobfigttiontodocb iukopt. FIGURE 7 OBLIGATION ,/..} m, htorinthuo fiBaofi} -J Snppoaingnbthenutufliutmomutnhtivoto In, Omit in tn. nt 3 since in all historic mtfinhgmbpou’bkrehtivotomhwhich Milwawillhnuctinud. InChWTwoitwunoticodthchummm notoriounoddthauudDBCactionucriptio-thuuudhbdlingof thmtookadmhgcdthiu. Formphthoactiouthooryufloguof modalthu'anuhbelladD‘. hkuphgwiththuemtiouthis unloawillhotppuutinthilchput. mephflthoobfiption armin- 0a(¢-’1P)*(00¢+0GW) ii I'llpb' K. D(¢*¢)*(D¢-’D‘W). vim cachwcnmolOaflatuyag-nta)iuphcadwithu. Alinpmiou W't'pmdhgthhbdhdmwupmdormtunoddbto 1 g ‘1 i ‘ I‘.‘. ‘ . ..Y I Q ”‘3 '1: ‘0; J1 . 1 . I4 1 in -I P‘ ‘Hi‘ Hrlkn‘l r""- N N. "W": "”1 " ll. '0' t '1 i x l.‘ ': It'd s 1:1 In 1: 1‘ 1! 1’11 1" I.. In yta. .r . A U n H IE1 l - r» in; ul h: n! -/;i~:1 l Iclwu‘. H] l. .71 '10-) ff)“ '1 . . g: ‘3".‘1‘l'fl' r :15. 11:1 Lu 4.! ”mini: n! h~ nun ., -' 'H --: ".an IN 131 £11 ‘ ’1 Law; , a.- «H! 1.14” ,;.!.a-..~ . .. . in;:.y|1n.r;e. «1 Jun a“ .s‘m’lt n1 a?! 11"II10'. 3‘.” 21' ”h .314 ’1 "3 it” 't-i': 2""! c1 -" ’7 '7 oi "~1 1" w 1 H» I I I . 1' vv "1h! 1"3' " " 'H‘ U | .21 ‘ H HIH'V'. "i 1 1‘1“ ’ W ”'1. it I "Hi (”‘H‘h‘ ‘3 s ‘r .Itbih Jim ‘21! ulna! 5'; "Y . . £11.31 '1"? vi...” In . .b‘fll mt 4: .. i r .. 13‘ ‘l..‘ ”-l'nhl'! ”1": w." 3:! 92 H" m'wg" A Ii! ‘1 lr-gl‘Mw rJ‘ '4 ‘ I r‘ h 'H: n H “ WM '11' I1 .‘~t wl 1.": 1-31 'I'=l'§';tl‘» Hill IN HI ".3“! it hi 0; fl 1 stHI. "HEN t.‘ ' 1‘ ‘4' 15;. ,1! find. I: [,..',o , .k j- 1, I I “mug/inn .h ‘1 i H! "I a! “H H 1"1'11‘;‘*‘1 (J ‘~ My: '93" "1.1‘ . ' ‘ 1 tgll'o'i'll! D II) 01”.". 3 at 1'vinvu'1umi' ' ‘Iu hurt-1 a; “-111 w-H; m'm i'uini wlil Imamr-M .-,':nl-H.i» 68 befonndinAppendixC. ThemleRthoidainDBC: 111Eo BQHfl BMHOQ’W Button-Ila: 13.12 Q-fifl OM4O¢I¥I dos-0t. Contruytoaxpocmthobgicdwdwhtis obliguorymnotmlyohliptory. Ollywht'uoqninlenttowhatis OMB-boom. Them-ontorthilliuwithmtionucription. Failiutobtingfinbontdoanotutnilhflingtobriuviboutmihfi ataibv. Thqmmighthenpmvaubbvm'nhedilthcvontof thrhg¢sboatwithoutboingumhblymflediorhifingto brilz‘wdmt. Coin“ 'c. =(owaowh0aww). Mayhemlginnot: tM. an(¢w)-»(0awoaw. Ouwonldocpoctthutflabobfigedtobrhgtheooqjuctio-‘Avgbont thumbnhooblipdtohting¢ubo|tudtobriu¢ubut Theron-on aohhhthoWicldntb-ucfiptiou. Thmtunodolio pouibhdlceBa(¢A¢)doulo¢ahilBa¢. thhrdthoioilowhghold: N. fi0a(¢"1¢) RN, Egg Boundthhthuocuboloanbgybotmthoobliguion MMdDBCudthmdmddlymmu,N,udRN anhoidm hummmmxbm.m . l .1.‘ r- .h| 9103' l! “4", ‘ , in. I i" . .1, u”: ' , u, . j 1" 'y 1; C HH| "Ii! 1 a " u 1 ii" : .A H) a) ‘ 1 ’ t 11 1. a ll: ('1 $11.11)", ”“ . |’; .; 1 A .H‘ ,""‘l'.\‘ '.'.5’ '1‘ "g.‘i"i I ' .h H ’7’; ‘ “5’" ‘ ' ¢‘i" '1 ”Q?!” ’13:" '1HHQ‘.111H 53.1» “"11 l~~zl ‘Hfi In": zit " ’1 “éi' ‘5 ""II 05' I“I” ('Iii "id. 1’1 ”airfi'i‘. ‘0‘1‘ I]: 3.“..41'1 . a, 'I _<' 'it.'). Hi ' ' I I! 4‘ ')I’ """‘II J L'3‘11‘i ‘6'. -'.' Ni '01!""' ‘~O‘| ('M"’ ’iilfllb ‘gfl‘fiii an! ‘¢1...'| ‘ ' "’ "f‘ H' “”14”"! 4 Wk “VI".U "1 hi 1' 'Il‘.) 'mtl . 411:.” o ,ni. .1 1.1] ‘ ‘11”3‘H"! J} '3 11’ .1 "2511‘ 3,“;qu 1.3. .1“; H" u 3;,” .4 .:.!.','l 1114‘!“ ‘1 "1.1!. .rfl'" n1! 4. r; I . I ‘) 1* t A ‘7: 1 Im: 4 i4. 2' lehgms .1 1; i A ‘1' 1. A . . it ‘1’”"5 JAR} "UH'HIUIN‘Vl '1” ..,!F!i'1 "i '0 JO 3‘5 a. h ”in1 Irv.) 'i [Mir-fl "11‘ ‘* "‘~*‘- '1 "”1 .mmm v ”BIN“ m i-w. “mun .1 34mm cui . w...” '1 u. 4 n Hal. 2 illmlnl'flthh'b “nil *iuzlhnl‘vh‘ u ‘m .‘w rub'ltcéuatmil '0!“ OH «a flu ~. ' ' llh'v'I 1H! "9- i- l; A .;.-a w rm. ’ilzl:-'mni su-m 'tulnwhwi nil in 'ahn u i V I K’ I h" I .l-'I-\}—-. ’ ;.«i<' s' U1‘oswl . '4‘ .1: .h 1.51 "i this“ "'11?! 31:31 h. '- '1” "n1 ‘ ii'” i .H 'D'HHo'. ":91! MPH-4H 1m. It I! mix l-zlb' .h'r; h. 'I van! um?! "’ .' a . 1 v 't'-.---:."HI ‘HH u. 1.. :4. “tun , 67 mu,N,c,deEhouinthem. BntinDBC,eventhoughMould NomnottheauudRNodoeanothoid,Kbdou. :K. =0a(¢»w)»(om»W). Buttbbflowhxmtothowofl-hownmoddthuudomtz Bo #¢»Oa10afi¢ 4° flow-'OGOM 5° it 10afi¢40a10afl¢ Thtg'nlottthu'lnhoutexpuldingobliptionucriptio-toitmted 13.13 woman-vow butcithcfihntedobliptionucriptioucunothondwod. Thmthconditioubtbrbiddnce-cfiptio-mabopmtedby mdadafinitiondtha’a: DIF: hFa¢HD(Ba¢-’F8a). abbrbiddafrombringingitsbouttht¢jutincaonwofa brhsinx¢|boutha’abah¢nlctioudhthofnm Lihthedefinition brobliption,thotnthconditiouioriorbiddmmgivaintamdoim moistedwithdoingwhtouilpmhibitodho-doiu. Winn-obligation ucfiptioumtrlenhtiwtouiudmm-cfiptioum trunhtivotociudtmm TII'Idiltinctioucomportn with tint mmmmammuwudhmud mmmWMtMmtio-udthotbr oomtniningaction. mathemnvutiouofhbaflium,hbobfor lorbiddmucriptiouwillholollowdbytnhocriptod'f'. Thor-Infill, bulb: RE. M In: Fm“ PW. is .1 1 ,, .. I ' 1w! 0: Hi .H . ‘ f t. ' . .1 i' 3 -‘i~‘11 in] f Ii: v’ 1'. ‘Ih "‘ II ‘ r' "- uh. I. «'- 1m?! 1.. H ,1. [WM 1'! x t .LI il.‘."|lil MIN-11:1 11‘!!! n’ . WU“ 1.1.: I./lu;i '1 vi! “1': «i . C} 5.1 : ‘3 1“ ’. t " t‘ 1 sfl) :H ‘- .11 int: II III nuns-wry}; 11””...on ‘.;II'4~III~§/ o I. » ..,.-. . .il ; 1 vi .5 1 11.1 a 11‘qu ‘u '1'. " b‘ “'13; ' l ‘J' . Ix. \) (.t . I .xwu ..i Inn... ,. :‘g "’t 1148»; nil-I hum-u mun-a In: 4d; lu'nl‘! H. '1‘. (1:4. .1}. I}; it“! my V .14 ‘ Hi’lul 1U1 r‘fl " ' 13 NH ‘Hii r , .I . th‘ win; 3, a: H1 .0. " . +3. ' ~ i u . .‘u « :1 fluvialu': a 'i-u- ”1 19'1” 31.4! H. i: Ii .. a: 9 ”I m 31 I: '1 '1' Hr; 'e :tmh i- “:11 mix] “I: mi ml 1:: wm-h 4n» .wr' a. «:1 “wit. . ;.. 4.. 1 w it r‘ufl'I‘ol I” [rt/‘1‘ 'ilfi r‘t'ti; .? in ‘ tdi 11v! 1. . I... IIqVI lllg‘lf ‘1'.i'. liIiJ.1-' guit! 1‘11 swath ’11'91 «‘5 H :11 I" Emmi) “In!" l'l.‘1!:tti Flu .I We“) 11.!1 N hm'luin [12'1” i ’1: our 1» ~15 wuuqn'w; °~.~.3L! 144%! {1 .u. ‘13“ In rm" v: ”mum .. ‘l -u Wynn.- 'MH dual '1' “Inna. nah-nhwi' 11.51 HUM/(martw ‘1: r’-u° u! 'tll'hr'l ...;. .-.H 41:13: '13.L.: 111 ia'tu:t~oiq'l1 (HUI-.‘m‘lvn tow-.4. In nigh-v « " . ”‘I‘b‘. ”I “'1‘ '11] i=i'fs IIUHWB “1'931 111411111311"! ?:-!Iie§'l!-'f!-a'¢ “il '9’} MW". ‘1’ l"' «4‘1 ’1'- |"“'1'-i 1H;- hiil I" ‘Iniifi ' .1 , n“ 1,111 :lvh I. ' u...- 1- no . 1 4:91 3;; , lu‘v-idl'l u up s .‘l in... ,1] ”:1 1 H s ,. g, ’a r. ’3.“ .u; l ~u0~11 .1 13.14 & Fain-’Farw doeenot. 'l‘liiehobwiouehoeBaubdoeenotenuilBawevenifWiea hgicalcoueqneneeoicb. Itbpo-iblethtacennoteeapeilhebringed1 shontbetcuifhebrilp‘wwontudheoubrinx¢aboutwithout MVMutheeunetime. M,N,endRN,donothold: M. wFaMWPWamFW) N, “awn.” RN! Eran But the 1113 12.14 ung— IaFa-1¢. hokk. hotberwomit’llliveueflyioebiddathut 1¢bebeongltahont where¢hetheeh Since-ocuevaviohteethbWthenleie tektively We. Furthermore, neither 0,, K, B, 4, not 5, m theeee: 0. we (Fm FWPFawW) K. uFa(¢»v)-»(Fawav) B, fi¢+Fa1Fafl¢ 4, #Fa¢+FaFa¢ 5, hi 'IFa-I¢->Fa-IFa-|¢ PM '- ddled in term. at bebiddnce: DP FPMH‘IFM. hothcwuha'upelmittedtobfingfinboutjuthcueaienot forbiddenhonhrhgilx¢sboet ahpumittedtobfingofieboutjustin “-1 u. m u ,7 III M.» :31 ‘1': I! l-g'z w, 11" '3 °.1,11.:1|1 1" .1 11¢ 1 . 1 Wt 90 n ‘H 1 1H“... it.” vi: “.1 H.118 «Mint/'1‘! 4 "1111 but Wtwt' °11 11 ~ » 1.11.111 . 1| :1 r I-"lN' o 11 '.,.' 1H ‘1‘}; oHu"a-;1'Os 1h Mgsfl 'l'u.h 'iuu1 an o "a: in.“ i;1;...., d ragipui ‘H1 1“ “4,1 l'ui 1'1'u1: uquo Mr, 4". NH! ”4 H1 «11. .~ ”z'qg-w' 11!”: I'M! 1.1. 1 1111». o'- 1. 1’155‘11: 1.A 1 .4 1.‘ V 1 1 1,. . .1 1 311': 1| t..1 1- ‘ I 1 NHL! m1 .., 11.1?3 11 11.-111111411 .-.'.c-,r"l~'ni:' -: 1- .1'1‘,’.' 1 Mr! H1 "11 I ,qqu‘idnftul 2:511 . Mung; 1am «m. nu «an .M 5. ,4 v, 1:...” ‘Hvzi '111I'll aI'I . as” , ., 41-11:. . um E1 o: ”1 , ) 1311112! H1! .1 . .11: 1.'A~'*1'mt.-\ ~‘ .' 1.;1A mu .1 ~15; 1 1 a 1 . v ‘tl 31 1 « I '~ .1 1 t a .1 . .1; . $341.12: 6* 1111 IN 1:““391 .11 H Nwlrr'1uil"1 1-1 21: 1 ‘1’! m lr-m LI- 1. , ”I «I “1 influul'vl It . {'IHN 1"U*' 1’1 -..: ,- '11‘1'1 u! iav11u‘lg'n1 t: . ,!.n..m 2m .11'1 um)! 1rd ; 69 cuetheactionofbfinsinxlbtbont'unotteinofcomm'neionfora. hmmmdmmwmawqpbm atmh'vbewdatth-D(¢+wwu painted. Timmtwotheeeethatmenblethetheeeeefiminfledbythie move,nne1y: 12.15 unweomu 12.16 1:013:11»th hothrmuythingthdamfilybfinpeboutaieobfigedto beingsboutuduythiuthstaleoeunrflyhfletobfingaboutab forbiddeatobringebout. Shatteeeobligntiouudiorbiddmeecumer heviohted,theteeeemtobelitfleofleneeinvolved. Abo,itehon1dbenotedtht 12.17 t-Fa_L bebeMthtbtouy,evel-yoneiedweyeiotbiddelhomdoingthe inpo-ible. THMmbeWbytheddith-dmmteud emeoltheeeimpwvetheeinileritybetmDBCe-dthetnditionl medic-madeufichgic. Thblbwiunotetioulconmfiouwill enhancethepeldilgdm. H{DBC}'-theeetolelleeoepteb|e 13W of BBC, {@(nNhktchDO-t} '- the “beet of {DBC} catehhgjdthaethDBthae¢ieMtne,vix., theeetofnodehoffl Mk¢ebbnviste'Eech-enberdbiesmodel for¢". MthdDBCmthmehwhichthewoidmof Withhtlnbhnpo-‘bb. Itmishtbebelievedthtnndertheee WMBMWWVNBMNVNEM, wNiMMthm-dhcewtheeecondfiioumutbe .u! H :-'u 1.. m -. . 1 u «i ’1" u H. ‘- 1 '1' . m: 1. «(no ,4. ,. I; dawn 9. ’ vi '1‘; A! m- In 1,... .‘h1 WU 1. t .214: I m " ..‘ .1 “we .. .:..u H) .1. it, *9nl'rl "1' .. b at §I IHI “mini-10:11 h -1 "I11 Ii . ”521111.11. rm ’1‘!) "0:11 '11!” L’w‘ ;. >;I , .,— ”1] . ,7. q,“ ,. 1 1'1i1‘n'113 .1. H1811 wlum Iltlh .t -11‘ In 11-1 , 1 . '1 {It -1 . 9 . .rid .Ji .. Ifmlh "‘ {.mw J .11 via-u] . H.111 ‘ 1’13 In“; v.1 ..)!J 1-1111' H1 IUW‘II 01 9‘1 H1 H-.I HIHM'r‘th'IH .l 114:1 '.'-it...1.'- 1:111; “Hui... 'IHII; 1.1.... mus- .,; u -In-i'1‘.u1 ‘ now: m I ”-12.12. i»! 1.!» .--,u«-!h.,_.i-.éw " '11 "'11 , ‘ . '3’. ,.,.o ‘ognl' [re-nlsllv '1" 10 'I1HIIH LU qt” "1'1 ml I71 11§fl1 li‘al...‘ ‘111 1c,.hl|‘;r‘ 1| Aunt. ."- £3111: n:-.:,I 11414311111 «lg/1.1. r,‘ ')§;.}I‘l'g.‘| It! “1 r] I: “1 row 0 1. ”qt; r; ”~11 .- MQIHI HI c"x.1'o|!! *U‘iw‘fl 10 flu, 11'1“ ‘HEI 141 1? In H. '31 ‘- ‘Nl hr? .11 D1r'.-". :11 10.1111111a1-(i "r111 but 1(1’1 .1'1‘1fv'1‘91i (1.x.1lgi‘I) '1111 ‘I‘t"];!” "1" «HI it; 'H'NW ‘1. I] «'11‘I1‘11' III 1'! iglhu 10.1'" ul'I HUSH” “.7 I '1 .' ‘1 1131'.“- 'I 1” VHP’J’ 41" ‘11'HHU111 Mia—Jana. 1'». 1n 1w 'niJ «I 3 1'. s; 11 t. . . :r. 411””; “"1! "Hubs"! ~11; 'u Mama 41;! d ‘1-.. 11.1113». ; him . -*‘11"1‘.‘~1"’11'1‘01~1¢ .2 en.” 21117 13.1”“ r11 .. sl'l,|N ’11-1 11: Itllihl‘l"‘§ wul “in”! 1.4:? uloav.,g.)es'a Hart) 1. #1 1H 'o"'"'h‘ns| 15-h.1 w '7’ -1‘1l‘ . 11.1 in '1'?!» :11 1.. 1* '1' 1 ‘-.1 '1!” 1. W'muia. .13. «an 11 «a. N m '9'! n1 ~ '3‘ fr: 1 1n rum .‘ml 1‘1"”! 'nii ‘Jt-un/ "HM 1111!“ 1.111 1-‘s ,t : m1 1:} 1111 l. HAHN-H r'i "Email ‘lif-l I11 "HH’IHJ 1..» .' “.3 H 1.”: M. 94331.1” ,1. “,1” 11'..;.‘ «1 (1 1111113111)" '41 “13311 «HHUQLHL‘ ' . . . I 1 . N' h n and! 1;.;~~ m5 31!” '1 11'!" 141R In“ at 5:410 In”: n 1111441541 r1 1" 70 eliminated in the definitions of obligation and forbiddanoe. In the [We-mafia! intanntntiounnngontailforbiddenhomdoing Wonkilhtnnucnpchonuctionioraispodbk. Thentof MhWWFEmcmmi-duioflowm FEPFw401FSG. Shnihrithoutdm-ucopidinWWOE, inwhichunpnta'uobligedtodonmothingonlyifaucnpingmction hafntmpouibility. OEU-Omfi-bo-IFSG InthuainwanII-dthuillzfludw, 12.18 IBO‘IFSG nboholtk. hothwmficvayngentilmtedthehtmpouibflityof “pineal-0th.. TibimplinnthntinthuoinWMianIn-t mt,ththtony,ov«ylneuilmhthnt(h)m1 - § lam; u - - 1 {intuihuy v. i“... u [w- n 13. ans. imp-j wuH-LJ-vilhi 1- vsit'l“! (I: 1‘"'i}s'l' H'I'Nl (‘4‘ HUI/watt»! 19.} r 1 1 - ‘J I '1”: 11,.li‘11i1‘o'i" q“ .1; Huflu I: .ff #3“! HM! )., 1 In tin'nl h 2i 2““; H . ,‘m w» in On» nil l--.i::.':cn'a r1: .3... n u} ;..) I. _ ad: ' "ft MU .dUI- 3? J 'm! 1'! § . ‘1 ~ gum: ij‘H 5'4’ aii§s3'%":2’rhl! kWh” uiwi {,1 ; ~’ ' ‘ .‘% I : t w it Jim.» Int 1: Inn-its a.» nun: HI l»‘-;lloIiI‘-"i rt . n-wJ. r.“ “I '84“ “Mr?“ H s.:!5 I I ' - liu aivglbl‘)'lll'3~fltu in whoa ‘,3(H.;‘,;[n-I qgi: 3.. in; “why-fl 'Hnlhi'! ..si r. ”AU-3|; .1. 1mm pun»; ~ "‘- I'.' (.311Il H ‘9 t’i' J ‘ o 71%! ‘1!” '3'” '7 :0 .i 5" ; ".’ 1"]; ‘II o I: v, .1 t‘ l I” I 1"“ I )'\si 10 1 j“. 4!” ‘, .1] “!r“‘-’ o: (a -,u ?; Hui! ruiaolhm' {i‘i . ; INF!” 3.1 I]; '9‘ “1?! F n it; .4 H -'oi~. 51w '1 ll'o‘lin ""“ 3‘9: "i" 75 identicdufaruthesiohoodiscomed.0flytheoetofOK hWhWthuufldthusinthfiflcbbtthubinOK hmfim-thtthubhandthfive. 2. DEON TIC PARADOXES hDThWobflpfiou,brbiddu-ce,udpmhionm intudofiubhoothstoulyouoithothmmdhopfinitm. Sinihrto thWtbfldWMMPxpaflmw¢ba MdDThW WWW-inpmthohcidflionof thmdcooceptqbntthucbtdhdvuhgo. Lap,- 'Jouudiu'snd bramtgFm,'uinforbiddafro-brhsilgitnbontthatkneodiu'. hDThWFMHOa1¢buMudfmntthwith Fmitiolbwnthth-Ipa,whichintony,:'uobligodtobfiuitgbont “Jonah-«die. Butth'nbtoomg. Oumbcbrbidduhomkiflinghnea (bringhgitaboutthohdien)withoutttthnutimoboingobligodto bringitdaontthstJonudoanotdie. UndermcircWWhitois brbiddafronkiflthombntdouitionowfmnthi-thtminbo obfigadtohringitsboutthntJoudoe-Iotdio? GimmWhitecould goontdhbwnytomtoitthflhmdounotdimudhcwouldhe Whmfihfiqhthbmtobfimdtoboahm Forbiddmudobligflioumfudmtdlydifluutmof bohvionloautnints. Forbidducuooutninmhtonhdnfmmoertdn mmmmwmmm But,woording btrdithdhmifitythodndomittingtobfing¢tbonthno r! I 1.. 3H '3 \Q i ' Q ‘1“ I “on .. .‘ lnuni..- «H (a; H v I 1‘11 ' .1' w u}; r. -: t" H - n. m . m In QM. [mail w 1: "Ir 1 r: munl do? In. IQ i in fie; I” a" ..h; 8 LQ bun! h r'hwx'hi‘fl'g why. ’ I" t' to! Q ‘Q 'Q I‘ Q Q u-t n: 4 Mia: unturhm n HL'.£Q m m 9?.»'"i'l1‘-L.l i 3 m I; 21”! ‘olllhfli‘I-g 'Ni . Pu! .. '4: "H” in 'ouc- {Lin hail u» "I'M”.H'H'I w’an 4 H I“! °!'. i mm: on»! nimmml itmmlz. =.1-l L» I * ”-1 it. lfuldui Ii “I“ n~n~n~1=iw mil .- vim ;.;,..- 1m. rm. M 1+: 4:?" .. “mm mm i'i tu t;- n' I mt. :. I. In] ,'~‘jt. .u. 1:1‘ .I) 8 H vi 0H “-0 é’I’I'v'HlP » th‘t. 1H .s? t. n..l: lumiu u Wt’ mun ”WU: n: «n 5' mi .« In w. cut I-rwi mi; and! i . Q. mu 4. rl .... ..«1 «In.» Mr .11 i l m r48 H ‘HIHQ to! QI‘Y‘:QQQQH rt! 5 ,(cs/ 4' r4 [Q 'QJi” I \l 1,“! ‘Illii‘li H QMQ MM 314] ("Mat h‘nu» H I“ :‘(QIH .9 “A!“ H’i'i'I-JHIQ " ”L! "’Q' ‘N ‘1‘ ‘ 'I' 4‘ "LE, .H‘.‘ 31%.}:ill mumi mm! an”... 'MI 1.; Ir. i mu 1 n5, .2 mi; “wig, I] :m mi 1”. nqu mu viu: “NIH": 1'li'il Q 1- r' - 'U m... Ii :: H “....,~., It M “Q g u' 9; at min mm! luliéwt I I 1. s ' m n any-21M .. u um; mt -: H“. I '5 :1. I!" .oiiu QI‘II - .. Q) "It 314:! ’l nQ' . '1 , n4 4 m '* 'tQ'Dv'J ul lviih‘ ,‘uQa lull wad: r -‘ Q .l: .(' ‘u | 0 hi I. 'Hl In HUM |' . lul h '5 u! 1: ~"..: . mu 4| v-l 1.: l r .1 " :3 t‘ '1' ' I’l Q=‘:Iq:-IH.1é-' : v INN-{Qua IQ ; HI H.1tut’ I "‘. r;!-a‘.l thin I on r: us. .I..‘;...; al ‘1' illt'o Hi 1-33 '~..~-‘-'=H«"- "0 'oli‘L'ont-iiwt “qu '0':- t hunt a.‘ I I .q I ,rn 15 ab “I";QI I: “31."! HI HQ £17.." {I {‘3’rgltll '1‘. pilzhulsi'n H h: 3 ii; "" " '11!" 9 '- H" 'H i‘thwai'JEt’” “ASH“: w nu 76 diflorent thu the sin of bringing '14. wont. In "Saints and Heroes", Urmnoll7uotioodthtmootmetuthicdudymmnotabhtomthe “manomdnwmdoedldmordhemism. W,hDTthouwhothomkifling, {armadbepahboblipfio-inanint. Mimmkoeping dmhthimwithontwm. Onomight cflthbthwdudummwhkhtmnhmmmflonor fiWMWbWhfiM-abifity. mmmmmmmmmdmmd fichficmfioumofiaWWthMtboGoodSo-nfitm par-doubtprobknbrthn. Tummammtw “Mingus“ nifthogoodSmuita-helplkuwhowu robhodthJoumtobboda-dflitbmththuhmbbed. Smps'ThoGoodSmuitnhdpoJou'ndq-Umwu robbod'. MMtomadk-ymnbwwaqhqud 2)istnuhtoqu. Accoudingtothonlo: M— want itiofluwafronthdl)ad2)MF(paq),vis.,it'-iorbiddon MthoGoodSunrituhelpoJou-whowurobbod. ButthhpondootanotuboinDBC. Iath-‘Jolubrobbed' :fimn'Jominhalpod'. LotgduotothoGoodSmu-ita. Thul) cuboWBclp!APq1.(chmbbcyimtgbontbym Inn-ed aunt than nglaPGfiBsql.) Support; robbing b Ion-hidden for m,2)cuhotnnhted(x)fiqr Andimmthiothepuadmdcal deofiammoflamfionedinthe IV" '4', (- Ct f“ 1a H ‘ . h¢ v.93 h t . ' ...;. ‘- I e M r ., .{H'tli lb)“ 1th; I I"! -|. h,.;1 tvo‘ - 'II Oi*~ was i n . 3 9i _[ M; l- ' LID J)”; A"! 05 ngl’ in v if‘ N [no 'i- 13.1! H-UHH '.U 4 IrHH' ”Mimi"! R! W“?! “‘t"l/'1"J'D .H‘IHbil‘tH'OHII iH HI ,Ii'.fita "his“ A' ’ | l l ' l 0 '."H';-"’J ‘H'nll tub I! "Nil hm! h "I runl’d. win” 'ill my: 4 leilh ""U' t "'I 'lLl q». n“) W'ql;.;;.ith]ifl“ Writ ».t -'|v-,|lr‘ ‘g’¢l‘ii:” vu'} raj) “I ru'q-‘r _I:Ha In '1” n a zwrt nut-r. .mzsi I'M-.1, 1i via 'I mums I-rt-x; In ("-9 u -‘~l mi: n... :2.» Nu? ,; ...-j .Eq-a :q! ..::.. numl) ul inmw: gr) 2..“ I"’|.l\'3"l*g' "i“ -'| .g * . , . 1. - x‘ 3' a ‘1‘: {Eu-’3! I" f uulr'l.11fl/ ’It)”:.' In”. .“3. “I H?! lllll:n‘lt' itIItot . "3.1 .:.-~‘u.»;lc’ Ln...) wait Hui! mummy ii [ruin-U1; n- '1 nu. HI -' ml HHIH'i' ”H ....H r wan a'l-g uh! ll” r""'1 ,tgi.5|‘.';; mm} |.. m.‘ 1o] "g mi. {.3 g; m ,Hunnm. . ’ " 1 .'. ., u «..;.v ~';|t..l. (“l-'34! tn:‘.au\.g.h.'. hm; «an: {I H an} 4.8:! .‘JllHl3'Hl.Hf'. in ti $""‘-""I "i ”ISL H. 53' 11‘“ : 2‘1"] ”1 H 12. Did. i H -!1 RB” "'nlut- ll Ifii l-¢«l....-t ~ I ' . C ' ‘ a '. 'II' 'i ~- fi' i 45 o' ”-14- 3’ ti. [if-.H'lhti'fi’. inn“! ' ' ’I n '3 ’01.,03 ”.n . . _ 1, ; -' 1 I..- . 6;.A~.I .Hiutuiw‘i M H "lll Ml! "IHIIIU!" NJ JIM In“ m ”was ..nhlau .unl WHlttl'ou‘flw..l .r1 b Lb=¢u w: u \;I a:r~117 Ivrl a; hi5 (I in ruwssi~¢sst -3* Nu?” vindi«1 L . I V I I A 5 . t'nld .| m h “41! r"ult.-Ii. mg! on 3:. .i-hnn. lawn’ Win! In.” o . \ . hi0: V‘ ("3 rg‘..,l3*. T. {I i‘l‘l . )‘:§ ”l ‘l’j'fi jl.,'1;. I ¢"1f«.“ r‘. " ad-i ’: : ' r v [v- . I14”. I“ ’g “”4 fun”! ugil H.411“ 3. ’.' 1.. .. l? ,1 ,'-\‘t..! . y. Ln” ' V . I hi; h! I-h v- 3.? f:-.I(1 Mg 3!“. ‘._' on“ . w .l‘ . - .1 h-i { .3";,‘.. ’ ... “3" .11; . ‘ .‘. .4 ":5: Jul hm tug-1i; I In m. )aA -i 1‘ l ol M! In, h : 'lil.|I'lIl 3' . ”-a .h :‘ 'i‘- «2d? “14!! 8:1; wt tf' i NH i'fi'l' "'1 llh‘: q ‘,;v..,l,,., Huh at [-1] 9"...“ i! Hug/'0'» " Ih'«i In I J I“ I " “'f‘ 4’ II Ill‘: / ',‘ o" ?I-: "I’~H?l.'!.“ lHILv ‘ 3' 3:» 'l 77 wtofdeonticthoofiudonotuheinDBCaince,uiothecauwith WMhRmnquvfl,udthWonanctim’a madam”. Bntothtdeonticmpuficlhrb'thouhvohinga mmamw-m’summmm bonedlyd'lpcuedwith. Moonflichwillbod'ncuodhChptaSix. 8. DEONTOLOGLSM, DIVHVE SANCTION AND MORAL ARGUMENT TbmpthBCbhmdmbMo-sflymm. Ammmmwmmmdumhm idotkdwkhcuhhcmfidpmthflhmvhqwithm Witpmhcuorthouinvolvodhibhflut. “the Wmmmmdummmam mtwhodouit,vh.,hhbahsmctioud. Mm,thuoptopatiea hmtodowiththohdintauhdtbmtnardhghbgoodudevfl mwmmmummwwwh "axis obligadtobrhg¢nbolflhoquinhttofltbmibthcuthuab hihntohring¢ibontmuumubhthuawmhomcfioudfl hconpch,mcdhgtodooutobgicdmthomonlmiu dunthmnthhflymbythmfidpmfiuit In. AWMWWQMmu-euaho‘tnmfion’a mmflthcuhfladbyudotkyuhilmMsbmtita nor-1m Hyhidpofitioumhwhaouolthtwodomtiomd attains-him Bothdifinoconnnndviuwnndhtuifion’unm popnhtfomddeontology. Acoudhgtothoiomeroneisobfigedto 'M 'i W8) 'in ... .. rm. ml m - -m av , w. .4: u ~30~ ;- 1. ,. ‘ -.. ‘.' ‘ '\ u. -"l "‘ ‘ll r . 3"' wi'i‘ ”-3!" il‘73’ I... .:"I:' Ilt'.l ’ I‘.“» .il)‘ ‘: ..I" l ‘ I ‘ : 1 :!' 1| ,- i“'f\‘ ’, '. ”“I'II-‘ ‘-Q'-' .J‘“ .~"-‘ -"-I [‘l. Fr't’.‘ ‘A.’ I. :[‘lr't (.}/‘;!.‘ ““‘ L H‘ ”“11“ ‘}r¢.;il 4” I. ’H 1. 3'14"" "‘h' Juiml 'JIIcih u.- “‘li’l' I”! I ' ..- ... ..l Lil-H :1 vii". ' "II‘U' .'\" f }'l:‘I'. . :‘llfi ’ Iy‘g’! . r. ‘l ‘I f" '.. ‘.'. i‘ !! ‘. .g. I]! ..II, . “‘|‘l‘l: .y! ‘ " . '. 4 . ' . ‘ -, .ga!‘§” 4’ I” ‘ ’- <' 7,!2 H. i“ I’ r5 ., ;‘v9’ 0‘, “ '§;‘ .a’ tr" .:,'1.r’:‘ If,"‘\‘. I” ‘fi' 1““"3‘" 51‘1“ 1‘; No.5 I‘d} waif :-.J‘...‘\ ,irl \.:‘ \ :tl'x'... u‘ m "1 H;- w—u-n Jig: 'it'vI-uri! ad ..3 iv ~1 4! Men «'1 4?} !-- Hi i 31; v4 *odi Wu H ‘8 III: 3H ("35‘ up *! lc-fi' H" mi: Ir#:c~.l:!‘a:‘g"-v-I£':'v "boil «.3 ‘..-*li I-w'w‘ H‘t-F "I" “9. N ...‘\| I - II it I. u H ila'l'! [Inhal'ou’alln '- is” "I -I link is an" Ti; "H t”"1"!i .Iz-nélxgl 0' W (I! f 14:“ III] ‘botuti! In f‘? mi» 4.} ll r'fl"! v; ,1..- ‘-4i- In ’Hlll‘flrvlq "15 its ‘3k in r‘Néi'!§J it; i. z~ ul wgii ‘P1.tn.w"'ill r'“':||".'-g)" unn- at:. ugvvio‘ 'w- 1| ,lwiu' lug/l, .‘t‘ln.lil'ui'.r‘ )gaot‘NI did _ \ll 11 run: (all)! In . o; .: "t e ”:4 iumit chi 312.2315; --‘. 1!}.‘316 ‘9111 it» ~!<‘)‘.w?‘sl !»-"M 'NH til!” (i. m "Ind v. :.1«""‘;‘| Ithi ’I'm‘lbanl‘lur'v-un') flhb ls": I'mI-“II: ”Ii! Wuin'fl unit in"; . J ' . . 'g ‘ I 1' ‘ . . I u I! J‘ail’ 'Vhl "l|| li‘:l. .. "I” f] I] ;)' I“ 3 “(1.... g ,o‘ g ‘4‘“ 3‘. ....”"d ‘.' "'}.I%-i(l '5"°|'-“*I'Ui*' “if MN 1‘ mm -.; Minn-re um I. w dun Hun» . 2:12.! m «nag-u; I . . ‘”' "' "-’ "9 ”WW "I" M‘M‘Iuil h. :t,"ti~mu~us m ‘jm‘u'tunm arm“. I! m. 1. I I I . 9‘ . . ‘ H '6; "MN”: “dye.” 5’ " ”" ‘ "" ’.“ Human '1 In It. I! M hunk"; t.‘ 1! :h' tn; ;. H’ 1’ it; a" ”fin”; " "V” ”313?. “ii-...! WW I”!!a"ii "3' ' i‘:;|i\!'i ‘... § ‘ . l2 Rafi} I .-( .' .‘. |:.u~;g .w- «Il"olj'=|r lit-.7 u 4.“! (.l; u.“ (,3 "‘VBH" 1,". in. ‘HR ""4"“‘10VUUJ ' 3 ' ' n l . " - 41'4"" =3“ UN! ‘HH In ‘mu Ic «HI Hit/":1 rum}: M3 1.4.3.1 .us; 3:. ' la mu! ‘t! 'I; I“ Z '|'i.:. i'll‘. r r}... I '."..'.""c' ' n".-. .l‘i' ‘i 1"? i pl,’“l!. (. A..‘! .1.‘.;'§l. v.1 ‘.. 3 ‘1 H! wife: 1 ufll-t' Moi! (v8 \ .3 m1. 4.)]. ”’31,“.11'hr,“ 1., {”3”} 1.er o“ 78 bring¢nbontifudonlyifGodoommudsit,whethernnctionormud inwdthonctionornot.Aocoldingtonmm-fl- m—vadintnitionhn,ifwitno,itotmthianot Mbthtntldnyotkmmntdl. Timitcnnnotbeinienod onthobfidcamoothatinddmtacawhichbknowntobetmeud moofldmonl'vinion'bnqnhodoothtthotntholnonlucriptiona hpodblo. Itiufiomthiopooitioninmonlopilhmoiogthtthcnme 'intnitioniln'conu. Daontobgicdviewadonothitwollintheirmtdoldinnry mil which trout obligntion, lorbiddnnee, or permission ucriptionn no ontdledbyuntmnbontmltinggoodorcvfl. Formpie,it'utypicnl bro-atohoummabwheuSmithbobiigodtodomothingm bewillbopuhhodifhodoanot. Notnllmonlmtomdthi- Molecule. Muyofthunmcun'lticinthntbymbgythey nttanpttonhowthtncatninnctionidntypednctionnflmd whichuoobliptory. Theraknaddoonmm,wmost churlyinthoiouncmo. Anditwumba‘dthtoudthe tubdndaonticthoay'utooflunpmcdmhmvdidfmm hwmwutMMIW-Mthhhfim inthvnfldityudhvdiditywhnitmtoth. Snppouthoonclndontonchnnm-utbow. Itinot thidmiunchnmtohchdownbont thewdahriuing¢nbontorhrbufin¢fmmthm. In mmhthuewmlpocifiodintaudhnpending auction. flthuomvdidmtqnnthdwthlwtidiumis mired. Iwmmummwuwwmm. htheemingpmtntMIhvemu-nlgmbinmind. Byuing .n 11", a- ,1 .-..Inn~ .u‘a ,h' ,i; rizndu 4: gun! h r 4‘3 " H 'W "ha"... i H’ “W 1'1” ' .f Ii at I“ "INC 5 '-|1 I> 1 :H‘oh. . Ilw' I '5 |I~" I Jud! H ,‘uL; .1 -,.i.'.) h 'l- lltalil if," in "nixrvl ”~11hllhit‘. l‘|-!~j':i~' é~"1-!Ill "'l huiiifi) M "iii; {its in ou't‘OM; W Tug"! is“ in Ii I" I 1'” H3 i- J‘- 1‘ I 3 n - . . .. [1. M"! «i H! "Haunt 4 Il‘wlfl - “Harv. in inHA "Int!” 'u.'.-- in 4' a" nil ol'l rr‘ ‘ ls;l¢".fi imam! 3” Hum] 'm! ,- I ” i-thin'l rel vu- [xi/q «Ki-NJ in 'r'v ”'IHH’ OHM! H3! in”?! 1' ' Mfrsvs‘,’ UK}; N .{i i! i1‘i”~-" " H .. seivfiz.‘ '1 H «Luna; 4 r , 0' Hi! i H' Unlh' H I. 0" I" tJ-W h i "Ti 8H .- "J Ind! on. 45. (I. 3,; u. », sl..3.|¢.t _ 1 , . ,' . . . t . W" t: “in 1‘” Ni' 5'! it! "H‘Yi..ui!- fishi'i: . ‘H N. .' :1 41'” f1” . h r! III‘ 0". ll ‘SHIL " u" No", II; lurc"- ‘-¢h0ic -I i..' '4 ”0‘“ . My 1'] t 9‘ I u; . l l . ". "1': ‘ 1. '~ -' 911i ar' ..., to! l 0’ “-6-! K! “Hui ‘1|"'iN 51‘ I 'HHV'W) I" 'M h. ”'1” l--i (‘11 ii 'Hfi r~I| ,v 1. T.- l: [“5” £31. ’t.. ‘ in“ 3‘1. 1) 1" i. h .I..-..g.i'-| W1. ',, 4 l" 1' 0'” rain“. hi i; all m "H '--uii~t~;'v ‘I‘il: 113"!” in will! .‘HHN-i in m Itli .., “mun-m ii» mm as 'i» Will .0. 1n #1 mm u; M. WW! :4 .Imil unm- ”I Mum!» .7 n' r-wl m1 . Irl‘bllt ti .ulv'w-iuimr I) iu 0; 2H,“. w” u! .J'l:lih.u.dn rH. .- MN ”I , - ‘HT.’ Igiha 'n‘b'l aci‘gj‘b”! f! M. i335..,!.~ H ‘41] u g, | '{-.'l ‘51.] "5 IO‘;, 1‘] w ’1' ML I "turn“: 'tiH Ii! '1”? "not cu-‘M I: 1'5“!” H! '1 I'wml 'olimwi- b' Io ”Add .h'Ipu mil ‘i‘xstr-‘tsl' at; ”Hui at. w-imnul u..5| «iv-HUM!» iii-:m HUN” 31» em:- v'u; immu «a “nun It wuiu :Iiisitnm Mm Hli ‘3. min tr min-r1 .... --: H ..lfI r. bluntin‘t llh It I" Hi lI-li- 0“ Hi"! 'vv'ui ‘V!~§"1| aux-mt. H‘JILHIi'I: 4 "=3" tll Ul Il.-i—n|ull-' h‘ Iim' In! Mu .. r: 'hi llHllltil-i H“ J um” {.1 .17- -1 Uni-.us‘u‘wl H I "is ; ‘ my; 9 i -. « 3w -. 'U i i. unlw’r -m.| . ~" H in 0'3!!!“ II' l="'ll"°":‘ "'7 ""li'lt'LVHH' ""-.~° ""I"”i"ill\ HHHI 1.. : 43‘”le- tl‘)" it’ll-105'. inb‘u H. [:8 .niH'9lt..- ~;.. .' pl "I'M: ~V' .Ii H H «Ii In..- ‘I .294. in. [ruins-111)]. 'l E‘UHIII. Iii-“.iIb-i-witlt- to lull“ If" ‘iv H.” l I‘MYiH-Hl L o Ii ‘anH ,n Wynn i011/‘V 4‘” | ['l,;"x th‘ihj ‘v'n. ‘. ‘tfii ”a 79 several examples of mornl moment from the tradition of the Christin ocriptnm,lwnnttoohow,firet,thntthmeineidethebiblicdtnditionnctu iftheiroonoeptnotobiigntion,iorbiddonoe,udpndenoomnodifierent tinthaedthhhtahcntomhoththooewhominidethetrnditionud thouwhonnenot. Anddthonghthemmphooreoflbibiicnhlthinkthot obviouohniluitieodnonlorgnnentntionontoidethehiblicdtrndition hdiootethntthuebnothingoonoeptullyu-ulnbontthehiblicnlonee. hmmthemrdmmptodomthveoumhhcmm ondnnotherlornonchrhtioneornthm Seoond,bytheeemmpleo,loilntoehowthntthoronghgoing oouoqnentidhmudegohnmoorrectunetuthicnlviewo. Agninthot themaphooomehonthehibliooltrnditionehonldhetohnun reoommendntiontoChrbtionthinha-othntdeontoioghnhhnproperior them. Andtheoimilnritybetwoatheoemmpleonndutn—biblicdmonl momentohonldhetnhenunreoounadotionthntdeontoiog’umis improper for everyone, the’utic belieh notwithetnnding. Third, the mplee indicetethntit'unotdivineoommdbntdivinennctionthntbobligetion Mandthudivineoonmldvieweehoddherejected. Acoordingtopnndeontoioghn,oentenoeonhontmondue independontofoentenoeonhontohiiptionoriorbidduoe. Inlifitofthe Woloouoqmtiolwidonoelornonloonchfiouonemight hvornmorenodenteiolmotdeontologhthntnflowooontenoeenbont whatnflmornlucriptiouhntdounotnflownonlucriptione toutoilthooenhoetoow Bntbothnodernteudmtleontoiogi-nmrejectedinthe folkn'ngexunploo. IntheSa-iptanod’eoommudouemhI-ly mommiedbythreotoofpuiohmentond'lobediomeudpromieeeof - 'l. ».'t vtil i«> i- .i: , ‘1 t.‘ ‘.:a'lt i»; valii. .t it ‘«t¢:‘ 1'- # A :i’o * L! I ‘2 ‘.l t I ' ’ i ' ‘0 I ' " ": ii. ' .. :t’." ’J‘ ”r‘ I, I" I! . " Ilfi‘ . Ir ..;-, 4,. ..H on, qua-".13“; law. 1: aux‘,‘ .i1.‘ mm.” =;.‘; .1 win} .;;u '. .» H’ h .-. si-Ili.izu. al ~tzéf -'l-! 3'! 'tlt‘ {Iii :1 tr} .; I z}!:yci 1-; Y:! H 1 "118 is . .l in: -:. " . Il....i t. I ' u , lei ‘ ‘ i ’ l o t “| I. [I " I! ‘ ' ‘ ..b ’Do 0‘ .9 ‘1! b ‘I ' " '3' I .n I ‘II I .t’ ' ’ ”‘ ‘ l l: 3 '. ‘ ‘ ..Jnni In .....lci “hi! 'Nol- 3H“ .9 . 33;;‘1'3ntuh’h it-i‘ltll In ! ”96!! 'u. rlttu u.” .‘n-: I!» a; f. I 'szis Ii:'-clss I..u?rl!llll I! :.t'i . cava . ..;.. !E« .! .‘t 'v; ‘14! IL« I ‘olI-193 at. ' 'H11 in ‘r’Q'H‘ ’10:. ‘1] I"! ':”At t'h'ji .l U t‘il ."':’ ”w! H.‘W‘H "it? -' i ‘1 In in 1‘ if ”4“ I) I’O'H 0| . 1 I‘d i '51“ i' ‘ t '. . 1“ O l ‘ u i I. 4'. . ~ g I! k . n I. . =.‘ in] (cihl’, 3 “lab ‘ tot'll‘: ' "' '1 l lii‘ 1‘ MI 11;; . ,2, .§ J l‘ a.“ ‘1» LI?! I. 4""? 6 ”UN lei/7:9." 3.? H! "3 '- 'H‘" o I I v :1 l t .1 ..;.,v -‘-| aa.t‘-:.I I::».:..-» a I nu;'»;! >.-? ‘.'= t‘:"‘! ...: ' , ». g'ttr ' ' 'ti‘ . r z . . . - :l :n'w'hz‘Jt m ”1' within-I) Jtdll "'3h‘whli- tin-17”: 'M !-!!:.!.::anuuo-al l' li\ H: i i 14! |~ v 9'11}: ?”-i‘lvii! ."t .» '!!i !! vi f»! .(i I "§t:‘-';:' -t‘ I lotil I}. ‘..' 1 I " erI 0.1;” rrul) {g .Q H'WHJHI “Ha-Pan'! |‘ rt; H‘Héb‘ ‘ri owt' ‘1' In «I ' " ’ 3 ' . t . " ‘ - t O c I ‘--Il -: . "w! Iodiil bad-II NIHEIHLH mm»! 0~’v'i°‘tc‘ "M'HI' "a i" ’. -” I r .2}: . «’1 iati’ lie-1’ Pix". ‘Hi;’!li HHS tannin": ’Hil-‘Ut ""i 'I l 31;.1‘ -r’~ I» I" *l U‘ -. ‘ u“ ‘t."l)”,a "o I}. v 4' li!" ‘~ 1‘..\ al' 3“: KCI-I‘ 'L'i‘i’5 ‘4” ., ’. -.'l’: v .‘ . 2v: Ir;:.ra vi ltl‘uiit r ‘..! .Iu we ,-a9 "-u~l .2. .. -~-:‘, ~ ' '. ;: I' ; J" it Mi?” iii “"l':.' 1'1"!!! it! .“JI. :71?" 31a -'ip., "‘ 5.1!le W‘ i' '1' ""1 z . ‘ii 1' 5'1! -aa: . r:'<::rw'i 'xtss'- ib 1"!!! 1-vi '% t1! ~i»: 1'» itet=It ’l li'rr¢!" h V'- 'vt' nut -it1u‘- ? 'I'! -vc. , ‘ it'a!:; ‘2 ’-::-.i.n‘ ?;‘¢ : allc”t'.‘-‘:J.Il«- .1. :': Iu.|«~t «it. : .5..,.‘. ‘~:( ~: u. 'A 11.1 w -'~.t. “J iIC'iuIII N 418 11:11 wwulo 'p'l F'Iiull'sll' 4‘ 1‘;qu 1"I," ul 5, ’9'. . . r"§|¢"|_'.fll’lr'fl‘)'l “5Ip'. "amt iuum ”I Ail! :I I: v‘ ... ~1 A.:.. ;s:r4 ’..1..|.u‘u 4 -i.¢: ‘.' lyrls tit§I‘O;I u I lit!--' 7::.; W l 4‘ HM. t-wvmo': r in. r‘c'n'lu ! ' "it. lsi .r' .4 x . 1 ’ o '_.‘.£ - . .. 41].; lg!§, !~ 1; '1 '*~ HM Hi 1;"_.'(“HM2 Isa riL-vnl Hi I- a.“ '1:,-» ., 80 mardforobedience. Theeethruteorpmmieeeueoftenpreoentedu mt evidence for, u implying the commands. Strictly, since imperatives fib'Dofl'mudtthmthencabeloevidenoefortheir tritium Bltil’it'uu—nedlotpupooudmmttht'Do x!“btutamonnttothedechntive,'xiobliptory',uBohnerthu w,fntmte-echinluboutmcfiouormudmymeu mum HWWmhfimh-emdthbm inthieway,thaeiprinofocicindicatio|thsttheymubdnotpnre dealtobgiflninthehviewofthenordconceptgahceulctiolud thmqmolactiol. Hpmdeontolog’nn'noonect,theanpposthod’lconnl-dltobe hfimwifiwhdbmriobeythod’oWhoflmmflno Momma-ultimatum EvuflGodwunotebleor dmpbdecfiedndbcmmthbthmudmkupingthe Muafluiflbeobflguory. FhutcouiderthemmutdICou-hthhulfi. Forifthedeoduenotn’ned,thaCh-hthunotbeanbd eithet. AndifChrieth-Iotbeanbed,yonrhithbfntile; yum-tiflhyoudu. Thuthooelbowhohvefaflen ubepinChrietmloet. Hulyiorthblflewehvehopein Chr'nt,wemtobepitiednorethudlm.... chedead mmtnbed,‘Letueotuddrhk,iortomomwwedie‘.(I Corinthia- 15:16—18,32b)1’ Thetbtony,iftbmisnomtionudnohtmmudor pubhmtnfluthbfib,noouiobfigedtonakothemifiou0hfinim d'lciphlhipdemnds. Ithtobenoticedhaethtmdingtheoencfificeeis notoeenbyPuluumta-y. Hebtdkinguhontthebuicmrifioee r U" ‘ ' '1 1' ‘ H ‘g ' , 1'1 t ' ‘lv ‘ n' h‘ H' v i I. It ‘ 1 'I u; u. d}. (Luv! :zllnt H!” I. ‘imou do; 1. W . .' in .I: :31" I l ‘2 1 4' o “a! 'vl um ”1:13! .‘9 {.1 In“ 4“]! [112“ n! '9’!” .' ”*1 HA4. ,..‘ “...: In 'h‘H'fit‘x In rm» git" lf'l { In? Iii-1‘ a H h In“ {Murphl in “Hi I .0 i ' III 1 l v . .... 21“": 3th. #0 / Huh". r-u ~-'.§ HI :Hi' 'HH I 4| 1 a .1, Irv” nu N 0’] In nun-4:1: it «uh. "”03.qu ‘m- .: 1'! :tn'n’ *r . Jar Hun . . I In rig-1!}! L 1». ".3 -I Wynn” mv-"u .w'p-r 1y I;<'.:. g.) h w 'l. ! 'I .leu .‘y ”ll -u| ! b‘ii H" I :1 "f! 'IsiiI “with éIJH‘ blii‘ HHHH‘ «I .\.-l u I; "It: “I “WI; H 4” «I’M 'fiVIHr r'l‘i‘ NI'H ”(tuna ' 1” I. u I I H H M 41-“ I HI. m4! :5 in w 'z .1 w Wu“! '»u~ In! NIH all?! ‘ J I I 's‘ t u; r'.)‘.‘.[.tli”|£)‘l r' in). ’ Luv». :jvgnw ;| .. I J‘. 3' a x; ”gr. 4.341;”. 1”... £4 ...: i: n ! ”hiya-:51” 4 mislluulullna r ;....' Hr. a ’1': L. wm r; In.” dun ..‘l m to win In: r‘t N tam} u I! H! .‘o 'H Ni. vi . 51: ‘1! on zmwn «'I'Ils 3" "in" LP! 'HH HI'j "U. .4 (NIH?! !~i:h rwaH‘ Hal MD» J :1: u! l'aI! In I Ml) "3.1tw u ‘e s in 'NI ...?- lzlmlfl ‘1!‘I\ul“lli“' t- Ftii-éLEHin r‘ I cw . i m 'or‘! I iirw" ! 1. i 3 2 .1 H‘rn1 lul rm} I’HII ) 13%;! ,2» an?! 1- a nu. a: sh -m: E! i ..‘A’H -! Hub! ‘1": _.vwh| ll't‘ni In" «4.11 ... .3 I It “HI. ,‘| "a ..i ‘2 11": ‘3“ N is ‘4 3” H Mil "Ai I" I.’ all '3‘ lib 1' l ' l Iq . I" ""f'lll wucl w" me as! In: :0" h l at u: ' t' ’ «cl |"' r s - t . ' . . ti '..D H [2221' Us mid: w; ~:l l. cut-i .1 : up mu 1'1? ‘ u _ ‘a l I g “c , «, *3”. '11! u. "pg-nun I..| ,A;. i: am. ‘1... MI I': {-c .a.. In” W 1 - " "l I “'1‘ "LU?“ u 1..“ Ira] 'Huige‘l ”,1 in”. ||-»i.~g,;./-v.g ”u at ”I 1 :1 ,Jrv‘ u! ; i: I: w -‘ ... ' - 41:3: we "(I' mum: u! d-‘oJi- J a 'Hl-a ml '11 m ' MI' H: m‘ ' ' c': «In a .- H‘l at: 1.1” h nil .u im‘at'ngl wt _J| ,1 1‘ Jun”: d 1". W}! In; " ' “' "'- 3 n ’3» ‘ ”Him at ‘3“ (1 3n 1'"! nun. (r H'rl 1.: . .. 81 involvedinmokingoneaChriatim. Itiscleu'fromotherwinthe pulhecorputhtPulbelievedthtGoddoeodistributeoomemudud meteoutmpuiuhmtainthbpmtage. Butapp-mtlyhedoeenot mummwmmmmumumm mmmmwudmmdcw. "Keeping M’sWhoflW‘hflb'WCfl’onflo hthhhnmarfibhmbdmmmmmhthe ththrutemd‘.fltbefabohoodoltheuchhmebout Weadbolveoblhfion,npmdeoltob¢yiormiaont olthequutiol. hmdthBCMPall’sWtie understood a the fiction thtt “um-Imam) uhib 10”. By oonhpofitionthhbhntmnttothech’nthflOmfiatflk 0(‘IW"FSG)- Thil'nentlibdbythBCudhi-ttbatdhneat thatevenmodentedeontologydeniu. MuyfinditdificllttoendouethethyofPul’smmt. Pul'nview'ltoouflbh,toohnmotmndtoochfldihtoheoonoct. But, thinPsdbpafib-bmtlywmmdam ofmonldevelopmtwhichmtomedeficiut. Iwilld'ncI-thilview Heron. Seoondly,thotoomyolthebiblicdmmtuhvemord acfiptio-loroonclldo-Mthtthmmmutfledby mhouubootpnnflmt.0olfiduExodu20:4—6: Mmtmdeioryounfluidolilthe dayfihghhumoboveoroltheeuth Youdnflmtbowdowntothnot ’ them;£orltheLORDyouGod,ama God,puiul|ingtbechildruinttheoinol hthetatothethhdadionrthgaeruionof ms: ? .1 'H r‘ ' . '9 t"’ H! o' i I. . 1 J‘ 1 ‘ L . no .. 1‘ . .u a: ...Is ' lho'i'c? ‘r: 1.1," ‘1'|u‘.||;. 1: r' I. gub' “.11. ; i"! tl'.’ 1 z. t‘ ,. ..a’l'i‘; « H2. ‘ "- 'i3ll"iij'1ql' H931. “'J'; "1' 'i-1 #34" H ,'1.; «gun! I 'lil’v 3 Wm! ‘ m- ‘H’1 I , “(Mind 11"“! "V ”W ""H 1‘ H WI 1“ w m '1‘ "w.- I "nu-1:: ‘* "- b": O {nu/1" Ir-g.‘ ’ 1U 'lslthi'tllo'J ‘NI? . rhi‘ 1r“ (I‘d-124111.” '3.” 11 11t1:.‘r‘r w! i ‘|'-*1 at 9;;Iaitatltv» , i {:11 ’ '. 3' ~,! 1 r 49~ge il 1 lit-36ii.ti-i‘- -'i . l zit-Iiiglb f’ r 1.. i1 .wl su .l:h.'-I| “r .11 "1139-14. H t. 9 ":1 I \ nn‘ H] v11 'nd #3 t! u'a'! 4311:.” 215- . ‘3’ Mia F{‘£.l-l' “(Will 1A) .uo' 1 «.1 n .1 1' Ii :13» ‘91:. ’1 'nt 1.11.3 UV“. iltw r! riisie'bl.?‘1nl ‘iul I xvi ".14- ‘3: " 1"} t; .ai-dim‘qii-lu 0 IA: Hub ,-. 1. 3.; 3%.. » 1 ill‘ :cil3"' R . 15": I (if :it-:sr. ' g‘ 1 ‘vs.' 1.. .-ual: '3 iii 1’ *'?' . 1 '!*- a. I?! J- ’ wing” |H}’.u' .41 1 MN? may '—«h 'HJ rt 1 ”'12.; . ‘1)! m 51...: ~- $24!] ”“1191 on! tel hut 'vitfiJH w r .11 um H'mhflhitw u :, ~I) ‘NH 5-93. m Inna ~ 1' .11 ~.. 1 ' '. li'o;'| Li‘! Al r411 .' I _ 1i 9 *h'Wéi 'l‘.-- H 4.1” ‘ ‘Hlsf JAHH II I ‘ ' "a H» ! czriiiafili r 1ilt. 1 l1: (Isixirt'l ‘11,; =n'!«:3 I. b .»l y?ii 427... ii : ...i v..s.i HM 1'1mrvs . n '1 i ..l gi-si:'ig' . ....1 1.1111 'rl;.;:;sgn.l:1 a» :5 nt-.'. ~< ....b r 2' u r z.': 1‘ t a. h; a n1]; 2.1%an I!” 1“,..1 1.3!. .... 11; (fl “HUN..." .11.}.1 in 91.314»; flall mui ’ Until) 1111‘: I J“ :4. :1: “u! u] adv)? 1'3. .2)! ls!‘:1::1-i‘n’ 1: H run in 't-iHi 3: '*‘!“‘:3l- it. “40-1 '91” in JIM-ill: ..~ H .11 1' ~zt' M LU!" ‘z'm .1..-. “51111:”; “rib! Hull ul-”'-‘!l1v rn 11.-H.131” Iui "-"'!).'I¥"t M 9"". in!» , i M11110 1 H! u mum"! 1.!“ 3&5 r “'9. NH». on 1 1:1 1 -2;' (It. I r it. If l|ii 'Ifla;ttl u 11 1;... l!:.' :3? .a. a ¢+113 z|¢, 1 ;9. 1».!c» us'v ‘a. 1:1 c1. 51:.i.i 1 'uso; I: > 1 . . {i i- ' Ill‘ 11] «.3 1: a? :1: aa.o 8‘? 'll mam Eni'wl “I?! I!'~ II Hunt»; ivn. I'--‘.II..‘ *IaIlzwl .‘Ati .tH-Lw'l M It; I I I II it ‘W‘JNI 'HI‘! "Ii”? 3" '~ h “I '1‘st“ . l-ti 51:7 - .3 ..‘° IiIIIJwII IAII 1' i‘ "E ii" I: "“ .l '-"‘ .I I i ' \4 l’lil; _ i ‘; 1' i 3"lI- 3 " Ii i I“; ' 86 of other systematic features of this semantic arrangement appears fruitful but ismtpnrsasdhere. Awardshonldbeaaidabonteoaditioaalobligation. Intheprevions MdOEadeEhWawaydimposingtemporal ahsohthmwasprssuted. Obligatio-aadiorbiddaacssametemalinthese interpretations. Oicoarse,allmmplssofappueattsmporalrelativityoonld hstmtedascoaditioaaloapropertissoftheageat. Forenampls,the obligatioatomgiteriorcomiptivemifitarymieecoaldheconditiondon thsagsatheingmalsandeighteu. Abo,theOFaadFtherpretations mtamtodimiaateagut-to-amtdiflsmdohfigatioaand Iorbiddanee. muddreqniriagthataflobligatioasaadiorbiddanoes beahsolnteinthbway,onemightspeako€obli¢atioasaadforbiddaacssas canditionaloaeertaiapmpatissolthsagent. Hahajsdgetheaais obligedorforbiddeaiaaspecifisdway. hudsrtoaccomodateeonditional obligationdhothhiadsoasmightaddptedicatssFo...F.tothesyntax whetormalasdthslorul‘.aareweflbmsd,whsreaitheaameofan agent. SutsacesdthstormFaatraashteordiaarysutaessdthefonn 'Agaataist'. Intyptcalmonadictrsatmsatsdeoaditioaalobligatioamdmteaees oftheformOdI/meduediatohglishas'¢hobligatorygiveathat 1V. TheDBCcoaatsrputwoaldheOaIII/thichcaahenadaed'ais obligedtohr'ngitahontthatpgivathat‘fl. threthsohligationis ouditbaflmapmputybehagingtomWwoaldheoltheiorm‘Fna whue‘nkhtheatsnporaloperatorPorF. Ofcoarss,thisdossnot dips-as with the dimcaltiss associated with attempts to define coaditiooalhatioaiaternsdtheaprsuioasalrsadyinDBC”. II. III’ . II I NI II .‘II 'O'I.II "l' I "If I.“ I‘. It! It III' I .. III lI'IIII‘III I ?r I I I. I ».'I III gtI-III. ‘I-IIII i3." )I:...dt iIlIn'II‘ I 4» «I I II I- I-IIIII I .I. ,I II I .III ”In.” In -t H t; rIIIII ‘-I II'ISIII I I III's .‘I‘J in I' I! II II: I" III III I. .I II III. .- I‘II'II.ZI§aI-' “II 'I.Il\ rI-IIM ..I III 'JII 'III (I‘M Im-Ii. «‘III I I‘hl “ I. “1!" ' ’-i ‘39-"! U I. 'I': ’I- "I in; ,‘I' IUHI .5“ . III» I ' . 'I‘HIII "I III‘. 'I I II‘ I» III “I EI‘IIm. I! I rI;IIIlIII I‘II r: II?'I I. ‘k‘i I III I'tI I I III 4.: I 'I II .I . I .I I II' I“? (4!. I II; ’I -l . It :I-III. ._. III iii IHH 'i I!!!“ i’ ‘IITI' «In! H . I17 'I III-I. K'iliiil "’ I . «I I'I? II ”II III I III. .f. In I I-‘Ii'III--I II. In; I! III WI. 'III.II-‘III:I-I I-I II x I. In I. I. -r-I I: III I~II -II ..~. an I- I.“ II III ‘.II.-I:'.rII in Ion-Inn .IIII" N‘IIIIinJJwI I , I" I»! III! II «Huh 7I- II .‘III'. I~ III .III III: II. N l.“ I'I H II... -I. ~‘I E II :9} ‘I' ‘ .if 3 I] :I II 79. MI“ in “III”! In; I | IIIIIH . I 13., ”II -I I II. . QII'IAII "I 'I‘tltvl' II)" It? (I, 1"“:I “I Iltxll .- I -I I‘qu 8 I" II II IIIIIIIII III I ’IIiI I II 'r "IuI (U . i , l r I? 'III IIIb II? .':III ‘IIIII Ki IIHI IIII.I‘ II- run-III‘ I In 630.” “‘Hi‘ (I -I'I-II.'~ II‘HIII‘H I: w/ I'II. ~i IIII vi 'IIII I. r'LILnLI .1 ‘1 m4 . III! II H” III‘ III} Ir '{II ..- {LI 'I'I I “hit I I II'I II 'III' )1 'II. IIII I Ill 5' .. I -I W -i' .. I! I“. III“ IIIIIIIS.‘ in II IY-‘IIIIIII‘I. '3” r‘II‘HII‘ I? '5" I -I' II i1 III II 1;; I {I 'I"; I} III; III... at 8“. rm I'Io‘g'.‘.I’i (IHH iI‘I'1' -:I II lib J II (“III ... I :a-vI~.I~I 'ul H'II II min . II 'III Mama JItu‘i I-"IIIIII'I II I II.» ‘.= II II I I' I ‘H'I’ I'Igi II ' .I i’ '31 I? III).‘ I'.‘ "I‘Iii IIIIIIII. H 1.: I" .Ii 34 I": I III”; III III ‘I‘i Iva-IN . III ' I II Ii I III'II‘III A [III lI.’II IILII -- I‘. IMI- MI “I :m» I” I III I I' I. I Np: :I.IIII.IIII-II I; 'III I‘: IIII Ii 1 I ., ..I angIII-IIII. NW N IuIIm med. 'lHigl'IliLl‘ -I:{I Ii'l N ‘Ir 1,», '. VIII III III' I‘II.‘ r‘!-1[I*“-I-i/' III! In IIII . III III-HuxliId-II! IIIIII CHAPTER FIVE COLLECTIVE ACTION AND COLLECTIVE OBLIGATION 1. OBLIG'A TION HOLISM Gmpodagntommetimanidtohveobfiguiou. Onemight unformphthttFondMotorConp-beobl'gadtomlhctmonly rdstivolynhutomoflhthtTomudDickmowpdtocoopentewith mmthainafingbrtbeirqadmotha,otc. Mata-melanin] mp0 8 "collectives“ philosophon lave acted whale ucriptiona of cofloctiveobfigationmuythhgmthuabbmhtioubroonjoimd Mormtobligfiiolucnptiou. Ammtothbqneotioumwtlymotivflodbythopohfisflion MmWfiIMMWthWW.Two ”mmththd’lpnte. Thofintcomthoumdacribing cofloctiveatitiu,“eoocond,oochlociacokaudthohnhfiontotho mam-cw» Thomtmveuymthofiuthu’uwhethor Mummmwmhwmhma thebehwinolhdividubcompanhgthocolhctivoorhmofthe rehtio-hotwouthuahdividub. Alumnuivomtothilqueution mflyMorfdbwithudfirmgtivon-pouutothoqwion,'m Muycofloctivepeuou?‘ Thedaialofndufinblycolbctivepmpefliea habdmdmmmopmt,n¢tqbficdm Inbeliovingthfloolbctiveondthdrpmpufiumotherthucomtmctaof 87 n - 13‘s: -.. ‘n u d ml 1.5." I ‘la .- “UV. u“: r ’5 .h {u ‘u'..:. H I «ha-nu M .1 1. "3M:- m ("U“gul ; 1m 3.- l-‘tv-i I H ., Hug); . lu’ I:‘ a . -. ~ - u' r man 'vt A III iw'l u'lu'i mu? .vm-a n .ai-h 3.." ro/HsJ H 1.. 1| ...-. H‘ .H' I. Hi N'v I": Ludo .’ '~ ll d-l 1'} 2:! mt LI 3 »5« lab aw: i "U ‘O‘HILh Tsu'Héfl ' Mr“ ”If.“ r' ;]-'r'-I§ .31 "'rilit‘li-I'" .- “HI I‘ i. ,7 H41 In} .mwum ; m. m wait ku . u.“ mu. ”delight! up! u g . in in“ 4H 1? I 4. ‘3' if HELP-nub“. ‘3'“. us”? ""6' ruli 'H t ../ wu‘" .wi‘rli‘wd‘lfll " '1‘ - ‘, -'~I *Ui'. Ill '13" HI ' "on! Ifi'FB (1 Ln"!!! In 3w U 2 .. -l l‘~M-!0r"11r -.~ 3" all -u. vI-w lrfi'I Hui Usug-wh ‘bu: [H h ."l; H: ' '1'" "at ' ”NEILI‘VI 13"“? but» ‘viuhi Lini‘Nm LMNW .ilt'n‘v Mi r «. eiu' 'hir‘ni‘ l'iH'qu in In 1‘ tr HI "III '1', HI .‘ "5‘13”.” 04': ‘14: I - : as n v. ruin: 3n (1.“: I Q . 1 I ~ ‘ ’ L- r" [I'd HI ‘I-nlnr ll‘uui'th 'Hl 1""un ‘ ”4’1 r'w‘l' "M6; "I i m w an. an 1:!” us]! In 1131)! [II '1“ QIHJ‘i‘iL! 'u.. I.(H‘.‘!". E-ra, 1:4!" .111}. .. Intitfii ..I whi J u: '3 «I we 3. l 'Hin:nH. u' '.' wing” v. n' u who M m: .1!“ "I I ‘1 00““- -- HT. --1 'vn'n} ': 51H¢1L -~ In; 53’! do" I” 'tHh' . ii‘v"l ”I: 1'. ' ‘1 7"}; I J; Hui." flu“! ix “it“ do ‘H’i ,‘piu. iv! 1.Hv!|iu . 1.913 ol :3 In \ H- , "..§:»-‘ 1\ In'vswqqo ... l-llh l‘\.\.."‘§ ~.|.".. Il-u‘ wc‘ni‘. .u w r ' 'I‘ i"‘ It ." !".‘ .‘.” O "'§""r“l " - *3." ").‘I’ "r" .‘ .l .v‘ ’ 1" ‘ ' 88 observable objects and their properties, holists deny empiric'um and traditionally they are hostile to liberal individualism as well”. Ithasbseasaggestedtbattherationalstatnsolontlooksasbroadas empiricisln or liberal individualism 'l beyoad mt. Although I Wlwillaotarglethepointhere. Atanyrate,itwillbeclsarthat bothempirichnaadindividnal'mnmotivatemyanabrs'u. Howthediscmsion oleollsctiveactioaandcollectiveobligationnlatestoholism’nplain. That coflectiveobligatiouoractiouueaotindividaallydefinable'lasnmcient (bntnotaeeessary)coaditionlortbetrntho(netaphysicalholhm. Throughout,by'actioaholism',ldeaotetheviewthatsonecollective actioasareaotindividnallydefinableandby'obligatioaholim'theview thatsomeeollectiveobligationsareaotthasdefiaable. Thesecond'lsaeintheeoflectiv’lt/individnal'ltdebateboverwhether thegeaeralisatiouolthesocialscieneuoaghttobetholghtoluexprusible asseneraliaatio-olaoasocialscieaeesinthewaythegeaeralisationsof chsmbhyanthonghtdbymvia.,as,iaprinciple,upressibleas generalisatioasolphyu'cs. AccordingtonostindividaaMsocialscienee geaeralisatioasoaghttobstreateduiltheyareexpredbleueoastractsof psychology’sgeneraliaatioas. Ahhadditioatothetuminohclcdd'npnte olthefiut’nsae,thesecoadatteatbtothestochuticelemtsdsocial sciencegeaeralisatioas. ltra'nestheqsestioadwhethersocialscieat'nts oaghttoeschew,orelimiaateasmnchaspossiblethestochasticvocabnlary ofsocialscleaeeaeaeralisatioas. ThedbcI-ioalollowingdoesnotaddress this-econdclasterdqnestioas. Negativeandalfirmativeanswerstoobligatioahobmhavebeen oflendandusdiacarioasways. Manselelasqaes,£orexample,claims that philosophers holding to irreducible corporate responsibility are j I ..L V l ‘u.!' ‘9 ll. ‘ ’ ‘ ol " L r" :3 ‘L‘ ,. . ‘ in w" H L. r at» ' v!" '3‘n“‘ ‘. l l' h ‘l I‘Lllll‘l ll! ("l‘l l" l~il I‘Ol ”ll '. 1" l ' l" l‘ l " 3‘ I 9‘. will In El Lil-L lu. ‘1‘ vi H. -. L . H lLL-«M’ 1" 3.1 ”iii!" ' l l.‘ ‘l ‘ i l,” I ll ‘ l)? ’il‘- l, l.' ' 1.. ’l iii:- 1 ..i's l' l '1 "I 'A .l LI A.¢ ' p-‘ll "l? "-'l.‘ ""I Ii. ’l‘\ I " ‘I Q .’| in]. ‘l‘ ll"-'l'l Ii. |l " l.'\ I -'i i. H ‘l ' l l l _ , t . a .1 :J-l 't In .. l .1 w I I -: ." .'n " a Li; *‘ l' v. -..|. w”. L ‘ ‘ t“ ‘o 'li'l! illl i‘ L ’ “Al 'll'lll l- 2] Vin 'li'il ,. I if": L mt . H. ‘n otl ll Il' 'Il lLl'tl" ll: s'll‘:l 'Hll ' o [3”; 'lH ') 4!: 4 "HI l"ll 1' t I 2 I - ' ’9 . ' . 9 . ' ’ t~| 'H'le' l.\i|‘ " H I l "l l.“’l’ ‘ , "u til ll Il’N )‘\ Ill .ll“”l l"H ' - .. " ' ; . l ‘ . / 'Nll ' t'Ll ll'vi". .‘Lm ’ 3 mm L " ' a main ..1 3 M. Lin * . Ll» ' 'tl'lts‘ll’l .h 6‘!!!“ -l' 1‘! ‘i'lt 'l't':ll l'-l W ‘ll ran... L... w n' . ‘ l . u u .‘ . I I , Ln! .1! I lli'} fit 'IlL-L‘Jlr i'ucuvtl “will - l't II! n»! ‘ull Ilt "Mr “I l-w o‘v ’NH '-3 ». ... . 1; In llhilwii' Li ”J 1:! . m wt 4'; w l;' L... mt In r'L-P‘31.-I:L ”run . ~ 5;) I ,3 ,itp ”bl ill'l‘J‘ 1”,] lg. [I NJ.’ Pt (3, utl'tl m i.tt1.r".{if' ll: (glolllgffl ‘ t L' 6‘ . I L it 9"”. W ii!!! an: L'. I” ,r’ls ,.\l I Hutu». Itl UH lc‘l " :51 'H? I'll: htlwcl .. vs ..- Li ,AIL gnu» =li‘1ll l‘."lll m um»: "I s v} . nlo‘ iii.) In mum. ‘ML‘l '1 L «U lawn w. Niall/r l! 11'“ "111 I‘ll“ ll «.1; l'\‘a' ‘1 nl MI “1.3!” "Wu ‘ ‘éll'l' " " A , - I I I , ‘ ‘ in "In “L ‘l‘fhllvtlltll’l'd ‘tlll «Ll ll Jun!” :1! .(Ir’vl ml )HI' 4 ' .~'.- 1 r. 2w: '1 '4 . a. t 9 ‘ t. a i q I . l , . . e .H .. I... '.;;1Ntlll’ ”'44. a. La. ‘ul «:l Aletlalu lwunmr will --o 'n I .l . it: -. Nil 4 M ILLL'M’ 1"11‘ Hl N in "HE” "P "le “Dam 'l .r-‘w-Hb L:-' u ‘3: h." A V . ‘ 4v ' ' . I l'h'lww ml warm! «:1. "till NHL-~- "3 a: ll mm “3': wl: Lam M» "r H m w“ ..1 W .H w ll i i l 10‘ w‘lxl! T'. :IJHH‘LLJl [3 I; I: M" in “I”! It]:iiélv,~; c.: ”I f I {I a")? l a will m f‘;0 I! ' ‘;;l l 11' Ill! Ill") l‘lr’ It I 's i .. , . ..L' L .al u” “‘1‘ ll- 13',» cu H! o-1‘ufl 9/. Lu‘ In It"! ’liilté tr - ' ... ' . . , 'U l 'l .l .\':H:nt.. Ll l’wmqy. r n: N . 1'.» m L m l.- » tl lm. er~ u . -p, ‘oIfI‘;' t i :1 Lulr '1“ -‘ é'Il- 't L :‘ jar-:25 4! HHS 89 unwittingly allying with a new form of totalitarianism”. During the Nuremburg triab collective obligation was a weapon oi the prosecution to bringgniltonasmanyGermansaspossible. Morerecently,thedefendersof LtWin’IamCalleyattemptedF-exonerationbyargningthathewasno norethanamemberolalnrgercollectivewhichwas,intheirreckoning,the locnsoltheobligationsviolatsdinthatinfalnonsmassacreatMyLai“. Anyaxegrindingofth’lsortlmightw'lhtoindulgeinwillbedone ehewhere. lntheloflowing,atrnthconditionalssnanticsisattemptedfor subscuattribntingactionsandobligationstocollectives. Thecentral qnution'uwhetherthetruthconditionsoftbesesentencesmredncibleto the truth conditions 0! sentences attributing actions, obligations or relations tosingularagents. TheminqnestionintennsolthesystemDBCis whethersenteneessuchasOonb,whereanamuacollective,arereducibleto somesenminwhichnocollectivenamesandonlysingnlarpersonnames appear. Somdistingn'nhbetweentypesolcollectives. Forearample,a govenmentorcorporationuighthaveobligationswhereasarandom collection,snchasamob,nightnot. V‘n-giniaHeldflargnesthat'random' collectivesdoinsonecoeshaveobligntions. JohnLaddsnggeststhat 'iornalorganisations' (e.g. eorporntions)thatpcflintheiridentity,even nnderthesnbstitutionolindividnab,ananewtypsdcollectiveentity. He clainsthatwhenasearlicdiscn-ionsolindividnalheedonversnsstate powerandauthorityeouldseethepointoleontnctinrelationtoasingle sovereign power, contemporaryd'nc-u'onscannotbecanseauthorityand responsibility are now dillnsed through “formal organisations". "...their powerandanthorityovernsiscontinnonsandblurred'“. sl‘ (‘L .‘L‘ IQ, [Heir 1.! L ' LLL'Ll N'a'l I. 1'. LI .. an. 1.4: and“ ill: I . II p l 14$ 9" II, ”L .gl‘l'l g ’3 ”I .lh.‘i I! 'lcpl' .. inn-l .Il'illl '1‘" ..1 9i “tit List- ‘ vl "lull H - I 'L "ili'ill'l'h' Him“ M II» lilz' tli‘l 'lll ' lli fjlf“l7'll~i I‘l Il‘N" t ml": I “II! it -l£'ii£’i'lb I'LHb ’ ”'14.; ‘l ’4 5 . I It” ‘ ' ll . t I ,I l tHl N '."l|$ot~l.5 I".'Il.l ‘\ l'u l°1l|‘villl b all all viii.” ’. L .- : . p I ‘ ‘ ‘I u ." . -. ‘0 a, ‘. . ‘ i“. i I . lu ' i~ .islH .§.. !.ll~1lil .i .9 I“ I hurl; I ’11..“ .l: ' ciLl u by m t'l “my i:"‘|!|l l !'-m 4.3: In Miami; ma; :u/ Hr.” H 0- g". t 1%le a. ".'lllllsil:” lufihlhiuw'v Liitill b '~ flit-.t‘9l Hi. It! :~l r HI! val :" (:l ('lillgli 3:12: tllh‘ rglvilt’fi -.Ui .--;.;»n ,- nz or It'l' 'l 11.5 I“! a] -.u'20'. ‘9' i in .‘(N .61. ”4.“! |tl.'il Hill 'I nll‘lllh’ l Ii ulv '1.“ H 7.“ (Hulil.'.§l'l-.» vtli.‘l'h in. il-ili’lb P"~'l’.t.ll‘l0' ll) (OIHE'li'llt l llll‘tl "all 1.‘ w 1w «LII iv. rm ml m (run-Hm lllt-ill 'D'Lu .rlli . '2': In?!" "w H! m; "i "IL «IN: La 5 h r Noam! I ... LIN ,L, AJ '8 i. mr r v ul'url '* «1.2.4: w ..; w. luulmzw slain E'L‘n mm: ”2' 'M‘» m: [1'4th m 1:” H! u' ..mom ’. "1 Us H‘i " I‘ll fil/tl i‘hl' 'l lit ."Nl,'l l! r'hlfll gi~tli Hui-'ila "Hi” L h mania nS-LLFBTLEMU .nlfm llluul ozutmuniwo In is: nu-‘Lmfi 43": "'w't‘té ‘ H' il IILU‘YIi / hm MAM} i. :. .LL :1er II a! . ..- rlr' r- e" thfil lltlul. .L'icll nih‘ffililn "H'Ll rub a ‘tnuv 1;. HI' ”lllllllt“" Illih mi N .53.» t" l-ar'l‘"! l’rlll l'.tl\r~tt~i:l".’\3'l ',.. 'l .Hiulfl 'i. In own-Lu: 3141.26 «m .eiiu'r in mm um t ”:5 A ~lll'iaii'Lil in tlwllll !""‘*U‘3 wm '- Min .«L- an muf. r'll hull! [Linn in r . 4v '1! ..:‘.. rm an Al-‘Il mu umi‘v um L . L wt mm...” Ill ltLLaLlw'c In inane: wt: 'i. lawn Illlullil'fi l-ilh 'li/‘Hw’l ,. 'Hlll‘li -a.-L.L:'v.= Linux» ,“ (wilr'JL JILI'VHQ‘LHI'M in)”: “‘2 minor a a, I l . : I ' H : -llh~'..‘ltl ltJ'llHl P 'I'Lv‘h-l lt‘! It...” h-ni “'lh Itltu.'-uc";r“’t l'°‘°lHt.l lair. whimiun» A nu tum I‘LLLMLHIL 11m; awn-LL 90 But I am principally interested in determining whether any collective units,actsorhnsobligations. Inheepingwiththecurrentliteratnreon coflectivensponsibilitywhichbmoreoccupiedwiththemoralstatusolthe corporationthuthatolanyothertypeolcolbctive,corporationswiflserve asexemplarycollectivesatthecrncialjunctureot’myargument. Furthermore, collective purpose and desire are more explicitly articulated in thecueofcorporatiomthaninthecaseofothersortsolcollectivesandthis mahesthemlucidexamples. Itmightbecontestedthatthisisnnfairand thattn’besandlamiliesaremorelihelythnncorporationstohavestatusas mornlagentswheathequantityandgenualityotsharedbelielistaheninto account. Perhapsth'n'lso. Butthere'lnodeliberateunlairnessonthis point. Andlbelievethatvariationinmmplesdoesnotmitigatethe sncce-ottheargnment. Asmentionedearlier,nccordingtoconseqnential'ltmetaethics,an actionisrightorwrongeocclusivelyinvirtneotitsconsequences. 'ais obligedtobringitaboutthat¢'bequivalentto'Nece-al-ily,ilalailsto bringitaboutthatfitheaWwiflbethecue‘.Di&renthecificatiossolv distingu'lh diflerent consequential-ms from one another. Hence consequentialists might begin contemplating collective obligation by asking whetherthespecifiedflrcssruulthomacollectiveactasdbtinctfromthe actsolsingnlaragents. Myversionofconseqnential'lnhsscspid,and assertsthatsomeone'uobligedtobringofiabontjutincasehewillbe penalisedifhedoesnot. Sanctionistheoutcomeolanactiondetermining itsmoralstatus. Sinceescap'umdefinesobligationintermsol’sanction, coflectiveobligationiscompatiblewithescapimonlyifacoflectivecanbe sanctioned. .,‘. It 9:» it : :lio'ln .Liull..l‘ .i. - Lx'l- I'lcl I.;l. w: , HI I I . -H- ,, ml in. :H' "Ill i 'I no i i '4 III mm " _-.?'lu vul ;. m 1; » Lo Inl'do' uélulu' Will uh h‘ l~ my?" ": 'I’Lwill r'l ll INT ’1 -/H:i~lir"l 'sl l-‘l ’u' ”f.” mluli‘. " l'llai .'= .: -lli\l.l 'ln "'1 ‘l 'l‘flliu Htlx l' lb H‘ 3' I" -' ‘-“‘ "’ """ L. HRH}. l"- .|'- 'llol-o? t: 1L ml 2‘!“ i=5 filhli'“ ' 'I‘i'llo' ' r’b l! 1:“ "~«l l- «ii. 'th .3 ' l; .,. v'. 0 If; I ”4h. will -lll ‘l I ..H‘ u I ';L It'll ill .I r l c’ l’llo" in I'LL. " ...-1L , us . .. Lt .: 'l in in .u : nut} ”-71,. 1.4.1”. o-i 3.1.80! Li mum: w I‘m-l m- I - ulna cl .-' " .u II when In! 'I I ‘i :l I ‘Hnul Ln? , .l .vL~.. 1- 5 1.45 t‘. m .l .g .' . ul ‘ll’ 1:. . :1- : I“: i I» L H’th n . L w ‘l m l J ail ll" ‘. "*' t-llll Dl.‘ L “.1 ml " ! 9 H l ‘r’ I H '1: .2 1 in.“ ... Hi 'th-t llll "‘H'I‘ ’~*;..h/" 3H "into“ I Li“ ‘0/01I"l t I.” ll" .5 LI' '1! l" h H5] :0 z... . L“, 2n: 1‘: v.1 3: so :mm m . LI ' u; 'l ”L. 1 ‘ . L l» .quw , .c ‘ H'O'ril nag ll‘l'l r.“ t' ”It at .' H' ’IHIII t"’ . L‘ 'H l .U ' ML -1 . .. '2 nhl u .t ..l ;; 1':. (n lg. .. . . '3'! ’1‘ is ‘l L. .... " :L '0 . . . unlit. 'tiiiu') i? EQILY‘t‘liit-I l A v ll 'hl lii ['4 J it hll . " Ill 3w 'ni. ‘~ " vi . 't .‘U'ult. 'i ' Mr H (n; M'i L- w" . 'ul'l' '. . .1".jl‘!.‘ I .L. -‘ H‘- "I'HI ' 'l3 '.» ‘fusn ll‘ 19’ . In?“ In -. n 'l'h .In. . .* L‘l lia.‘ :l ('0. ’0‘ 4! I {1; :1 H 'i .M ,,- is L r, ‘ t g: i, with?! '0 H in?! It) ‘kih i. I}. l‘ l"! "~ 3 l l LI »’4 .2 ...: In l-Ut ., ‘L'LiLI' 'c» l Lid-a i Mi will! .I i ' ., L L I'l'N.’ Hi) u 9. , M q is» m. u m It"! r u i. l L 6 .. .. . l“ *H'! L‘ L. “n '1; . I. . .. oh "1. '11... o 1 Hg" :1. ' .i :. ,i ,, x' 4 x H It-o o H mg. art n r. “Hut. l“ to ,. it now u 91 As we have seen in Chapter Two, sanction is ascribed relative to the victim’s preference or good. 'Morr'u is sanctioned" can be true only if Morris’preierencesamh-nstratedorilhlorrbsuflerssomeevil. Whetheror notcollsctiveobligation'ncompatiblewiththeescap’utviewofDBCwill depeadonhowprdennce,goodandevilareconstrued. Thereareonthe wholetwocasestoconsider. First,ilpreierenceisconstrnsdasaconscious desiretheathecompatibilitydepadsonwhetherornotacollelctiveagent hasdesiresthatsanctionlrnstrates. Thiisnottosaythatcollectivesmust havethesamedesiresaseingularageats. Collectivedeeires,ifthereareany, anlihelytodiflerhomsingularageatdesires. 'Collectivefibsanctioned' btrneonlyilflenduressomethingcontrarytoitsdesires. llnocollective hasdesire,theanocollectivecanbesanctionedandthnsnocollectivecan haveobligntions. Second,theprelerenceolderingollnnctiongintroducedin Chaptaqumightbetaheninsteadasanorderiugolstatesolevents accordingtothebenefitstheyinvolvelorsomething,andanentityneednot havedesiretohavegoodsinthbsense. Wemightlitpo-ibleworlds accordingtotheirbenefitstoapetunia,andhthissense,thepetuiamight havegoodsandthnsmightbesuctionedand'lacandidatelorobligatious. Thesetwopo-ibilitieswillbed'nc-edinturn. lnlinewiththelirstco-trnaLPeterFrenchattemptstoshowthat wastypuotcoflsctivodohavedeehqintentioneandgoabandthatsome coflectivesaremoralagents. Heclainsthatcorporationshaveinteationsby virtueolacorporateinternaldec'nionstrnctnnwm). Everycorporationhuuintauddeciioustrnctuncm structureshavetwoelementsotintelesttouhere:(l)an a'ganisationalorresponsibilityllowchartthatdelineatesstations and leveh within the corporate power structure and (2) incorporate decision recognition rule(s) (usually embedded in u..~ Lr .. . .. . l'sl; _. ' ' 0‘! H 69:: 'l’ ' I l' ' ~ ’; ' ' - ' w I‘ l it '_H{l‘v(‘ Vi l. ' ~ a ’I ll '1] ltt’. l» i ' cl} ->|l .} - 2' ,. 'L & l~ N'vil L 'uv' n3 uh . High ..1. 1 ;,-. 5! .1. :‘95 i": ll. "lull firm i L t "m l! '° l-:.: :u..._ mmw 11:1; 1‘ :3 H" lcl"~t':i' -' ti 'l lmlt ' .7“: -i ‘ li"""' 'l'. ‘ "'11: l'91'l:"' Ml .-o.. l “t" 4' a. '9 ‘."n .... 9 Inn '|« 1: :u' H w "I ,. I 1.. -. 5: u.- .. . . -1- ll . v/.' fill-a . ' :r 0| 7' u ’l l r”: ' L; L. .1 'lrm litn ' ti u' tLl Li3 ”Z 4-? :1 L -.'I ”I! 7r ', i3 " l - . ,- n" r'- “'I ‘l N 1- ‘ll "'ltl '2! “Hr 'l 3‘ ll” "n! I. r' '.l J" l:' 1h 5 .H.- H'Lfil l'lthv- I .‘. .,HI 'r‘lL. ...loi'a 4| ll viz?» | (’l‘ ‘.I 1,1,.Hunv L... 1 iv -' 0". HI M NH '1‘... il‘i'dl "’ I-.l r5. El lrlili ' u; u‘wll.. ~ (L. t ‘- . " l :L"? “we '«-Ll L'iun'?!lls‘ \.' LlI'FI '41. l" ' ill 4 'l‘- 113‘ ll. "1 ' Lli l~gltl"‘l' L-t - A ~ I 'lo-ll :. «Hour In ‘;.Hl'u‘>!~~ m- #1 l..i.~ul h‘o‘ul ”I" ’-'..' L IN I w H '. 'lll 131331" lllw l‘lll' .,l§.: ... Ia-I “t «’lll Will~ 3'1: 9'; H‘s " .. l'L 9‘ '1 '11 new; i. ii ..:L '7} -~:l ».- w m "IL 11 n! 2 i. --~..Ll -L . ...»; h. um "H'w «ml m Mm .c l. i -;_ x m «' vLu' L. Li: :I u»... "l“lli .Lnto lt'l ‘HerLwlth b fit it.“ l--:i‘oLL:.~«.v nl 'lI‘HH -:L .:l L41. “.W". Mull [1;1'1 :H i."- .L ._ L .,, , Lg .' ...c. w... ., 4. o . ' i y I Us ,3 u'fiitll' I.“ {l gr”: ‘1‘” 3| ”why—Hut: l'hl :IH Il'u H N!“ ML 31* l-IH. ”isn‘t! lIllB "linell'ilhl .f'ilirfll ‘0‘”: 6 ”ll r‘v.‘t3"::. -. l'I r‘il l W” ..,.,s u!" L.‘;_:| an... -_ IrT-liltl'l " qt. rutrhg'p iv! (in; 'p ;;,'|i.;.'¢ mus, r rill rsj w 'l ‘ ll'l llt'l’. lh-t"livl' H4”. null 'I‘l"'“i“" 6 l“ Whin- ‘ ) iIlnl all'ip'r u ti at a it c * Hi I t 'l 'l ll '9'» ‘ 0' I'll l i: if. 'l‘ll {l l l. t :1, .l I'~ a, .1 Pl!,'[ 1 LI " I..t, l I. .lslll l'.6l l tcs I ‘1 Li .7! . .I I 'H lt . [Lo :1 'H . Ill wnlful ' Illii‘t‘ ‘li!,{t1t.;| ) “317,5 llglgul’l in. H Itllu l' lt"'ll|3'l .‘ IMO I‘,‘ ' ' l OILI|:,I£"': .. .uc',.‘o- ‘I | ._ 9‘2 something celled “corporation policy”). The CID Structure is the personnel orgnmut' ion for the exercise of the corporation's power with respect to its ventures, and es such its primer-y fuction'utodrswexperieneehomveriouslevelsofthe eorporntion intoedecision—mhingsndretificetion process. When operstive end properly ectivsted, the CID Structure accomplishes e subordination end synthes’n of the intentions end ectsotvsriousbiologieelpersonsintoeeorporetedec'nion. ’7 If, as French claims, corporetions have intentions end desires then they heve somenentslstetes. Andthedefinitionofmentslstetesmightdetennine whethercorporetionshevethem. Itseemsthetmentnlstntesnrelinkedto sensory input and behavioral output. According to lunctionslism, e recent doctrineinthephihsophyotpsycholosy,mtelstetuuelunctiouelstetes ofuorgnnisrnthsthnveseuoryinputssugumentsnndheheviorsloutput ssvnlues. PursuingFrench’ssuggestion,itlnightbessidtheteoI-poretions hevehothsensoryinputwymeensdtheindividuelegentsthetmnkeitup) udbeheviornloutputwywhetitsmemberstogetherbringeboutorwhet theeorporetiouitselfbringsebout). Andefunctionslistdefinitionfor eoflsctivemeutnlstetes'luplnusiblesseny. But,lunctionnlislnistoo breed. Consider Ned Block's eounterexslnple: SupposeweeouvertthegovenmeutdChinetol-nctionel’lm, sndweeonvineeitsolficinlsthntitwouldenormousbrenhsnee thehinternetionelpsestigetoreeliseshumenmindforuhour. Wepmvideeechofthebiflionpeopthhinnnwithespecislly designedtwownyrediotheteonnectsthelninthesppmpriete weytootherpersonsendtothesrtificielbodyneutionedinthe previousmmple....ltisnotetellobvioesthetthe Chine-bodysyetem'lphysicslbvilnpodble. Itcouldbe hnctionsllyequivelenttoyouiorsshorttine,seyenhour.” Bloch'scountemmpletofunctionnl'un,ifsuooasful,nboservessse ~n.‘-i|c:'l.'!.'h’ -.,+ m t.ts|H mint-tut in“: 1:; ml «1| m la whim-nu I}, u: it _;2 ' at. mi. J M h rum" nl lh‘lll u: ...-.m lib i'. had ' .i .‘>3 ‘ {allnu'i ll "toiwiu‘pfll 5;! u- «in II Win” Hi. 4-1! .‘Nalil 3.1.33.” 5 I“! HUI MI “'4'“ . .r ..j. im. ... , Ii .1 in ' ?l (I! ‘il It’ll IH'H/ ’v' w (I «Hm I 1.1;”, -l |'-‘.' ”l .“l'D Ml It " W181“ and [Will Haul ' . i (_I1’.e. ’3”! Oil «It’ll .‘gglgt‘l 1' ’ 1‘! INF!) .4 ,4 n L4 I vll 1.1 l} “I . tr J .c i ‘U 'l' ‘.v.- .H I t u I ‘zl'l l I ' ".' l‘l 1‘! 0‘ l ..‘ l . i o “ q I I. l. I! lrul‘n 0"‘I.Ii.“.’ "" c'l " tl " It "’ I’IJII.’ Ii ' ' «‘i Ill ('1‘ all) ’ Ill ll " ’tl'lt’i'l‘l/‘l ”Ell' U! "l [lull 'llill It} ""36 hint km. f_.1‘i-‘l.ll!~al'!'trou h '~w| Iluuh l Jun l;‘1.1.: ". ‘51 O H l‘y'; :«z :— -’ll~'i"li 1.8!» >II'.'i'=iw ""3” ~ - ' . f . ‘ . l“. Ill H i tilt “ l l“ v ’i. .1: M" l‘llb~ llHllhllil Hull! 8 " ‘nr‘Ol‘fv‘lH ! it: ,. " FtWI' ...-...; : I. «mu Mimi-i la HM: W «ml l- 4|»- / -" li'ufl 'r"csl"lil l'tllr r4: ‘9'"! l! 1i ll r~l ‘11? :31 Jilin!" ll *H‘sil " l3 ... #1 lo"..ltll w... '0' l: in wt lu elm {- .1. ”0'! In]! cumin. In ' ml ~-H~ ¢;.f Ht. «m: In in 1: III Emil a; v i; w .il . .d r. 1.: am“... I 1%: mu 1 -: . a .ilviltdlililil u! an: g.. n: alum: he n ....i M *m. H mm 'lH~~1lv I .a. -I'-l ”'38 r tli Ir lhlll'lttl ."n-‘o ll'n-UJ I“ ml~:"-- usl'l “It "I ‘i'll-z 't , . . . H' Um- Hl NI INIB rut MIN '61» u. hum: M H: v Wit-I h In H! .m .Iu m. Is: In‘ la..;l i‘in‘m at l1T'3l1il H :lui’ ‘- ’i‘ r ll '4! "Il 1311!- ' 11‘ l r .1191; rt. 1: '04. '11 ll ‘ll r .1! 1"8 un'llu :SHH ".1 in "5:5 ‘HII c'u't Mull” HID-".1" :‘unl 'Hull l' . ' - . _ ~ .. l u .p in II b Emmi 111.4”! r 4'. cu! . H um” I I) lllt‘liu') ll1l£!i.tu- M but it 1 .’ ' :l' ll...i-»i3’nlel .. .v::- lip-"It; r 2.; ii «I! Iluiitw- 'I‘I'I ‘ié‘ . m o .;n--H'n:ul m . ..‘r. «w; or warm: w. 1 iv- mu: ll§l1ln|l um awn. . , _. , . I..'?1|fl' '35 iillihl'. f' xi"! 0" ‘l'ls " 'l‘- ”(I I ‘tly‘fit‘l 1'! oio-ilI-i'tflii‘ ”8 Idll‘tl .’ in 'H‘lllll'l'-.'t.;‘ finl lI".'L"|- WM ‘amfl‘t‘él- .u- .HIr '[i‘.‘l.;':- 41'! 1.1; II J? it...t til” -.!I . 3'! ~. all "II-w o uh I...“ n ‘v s l ' I mi lsh’ “Ital [mum at: .Hml Ii ‘tmwn M '~"~.‘- rm la n -;l.!ll' 4H lam! mifni I 911" 5 [iii N” 6”“? I ill ‘9! 3H "J (It‘llg'l sm‘ l" If” 't ’H‘i IH‘I'J 'Hr 93 counterexnmple to the viev that collectives can have mental states. In ThomnsNegel’ssrticle'Whet'lithketobeeBet', Negelsnysthereis somethingthetit'ntobesbet. Whntitislihetobssbetcennotbe csptnredbythemostcompletefunctiouldescriptionimsginnble. The quelitetive ”feel“ at mental stetes '- lett out”. Forourpurmthepointol’Bloch’sChinecountaexnmpleend qu’ssuumutbthuhrmemflthaebnothingitislihetobex, thenitishbethetxh-mentelstetes. Clearlythere'nnothhgitislike tobetheChinsmind. Thereissomethingitislihetobeebet,even thoughwecennpproechthisieelingoulybyimsginingoerselvestoturninto bets,which'nnotthesemething. Butistheresomethingitisliketotee corporstion? Formmple,’ntheresomethin¢itfeeblihetorecorporetion towentsomeend? lstheresomethingitblihetotestribe,etemilyore platoon? Th'l'ndmcultiormetoimngine. Immmebet,but Icsnuotmbeinxetrihe. Mwflhoutthbqusfitythemutnlityof coflectiveentitiesbethestsupect. Hcollsctivesdonothevementnlstetes udhencedonothevedednssndintentMtheycnnnotheesnctioued. Thueccordingtothefirstcoutruslotthepleiaencemhing,coflectiviesdo notheveohligntionsontheescepitview. Butecccrdingtothesecondconstruldprdereucewhereit'ntshen upodbrawhethuwnotapuetergthereisnosppereetobjectionto collectiveobligstiou. FiningChryslerCcrporstionlwmilliondollersbbed iorChryslerCorporetion,sndthecorporstioucenhesenctionedsndcen heveobligntions. But,ithdiflculttodetnchsnnctionhumthenotionthntitslweys involves the frustrntion of some preference or desire of the victim. Moreover, it seems to me thet in sanctioning situations, goods and evib for objects that u" ‘ . all? 2 i w! . u . . . r l: Yn.l i. «. I I H l Jail: ‘3 t '1 In . d . .. Int-m rz-l N H wl MAJ ,j z. ‘35-.” ' NJ is "l u.) r! I! 11.15 «mil‘m .; .1 f— .3 Mai n $h1.'i\i- to win an r i-;:.‘un 5....4 m" --‘ 'l- -:2 ‘*~ . I. _ ‘ 1' " l”fi"|i l‘!’ ..t ’1:";~s I-. “| .I‘l E;' e st ’ Q i"‘ iié‘l ...fa'u .' mum I-l mu r1 mm}. .1}. t E. 1; ~.";" .4 li'utl I: n. 1- 1‘ I""I.Clo’ l1 14 'Ill ntui , Inn-I w «1.3 It i. I- Hi. I l; to, '1'; I .l .I I "'iui'. “him .1 ‘08 q: , L , ml..i ’l't' vll n l ... mm s-I Nuri HM . n.i.‘.~« .‘m :1 sh.” ‘..Tl . {I ...l: :1~a:s':=z.-;~. .~! . m .t ... i. l 4} mid "I ll "wig: ..‘i —‘ " ' it ('1 lit-i "..f!ii':l 1"?!” m. h H .. gi ..g‘ I. « i I I ‘ I .~ .‘tuyl'ln l. 1:3 mm! aims] l. runwmna w; m: A 4 .m.~» 1w} ' 1' "TI. . ..i i’ “ilil it M H] 'txiil it It Y‘lllfiutl‘w "'1'!“ -’l i...~ ":l w" in. N u! ...i o. mr-wl -.;r .mm new i swim ...; '-= om lHl iiu’ 7‘! 2*» = 4153‘ w. -: .2; J: I‘ ..l ml 1‘! 'Muup .131 Hmfiuu lua/ mi.” 8 ‘9'.i3 ,HHM rug. r;- um 15 2‘) w 3:...;:;.m :13 . 96 to snfler Smith’s sanction after Jones learns about it. Or that Jones is pickedbyalotterytosnfleriorwhatSmithdidsinceSmithcannotbe located. Orperhaszonesisthsnsarestrehtiveomeithsothatcnstom appliesthssanctiontoJoneswhenSnithoaanotbspsnaliasd. Whatever thbtehtionhmppooswsadanfitothswfiolDBthueQrepmsents themtativsrslationbstwsenaandflananfltra-latesssntencesof thsiorn'fl'ursprsssntativsiora'. Notsthatthelsoanbeniorethanone wtafiwbrmotnonsiorthatmatta. DDoonldhsrsvisedas 010+: Df0+ WHD('IBa¢-'(33)(QIISAFSSD- hothawordaaisobligedtobfingitabostthatofijnstiacaseitis aeoessarythatifahihtodosothensousnprsssntiveolawiflbe sanctioned“. UnderthiscoastrnaLonsnightholdtotheobligationholist visu-ooilsctivescanhaveobligatiou—whihdsnyiacthatcollsctivescube sanctioned. 8. ACTION HOLISM Whatthsobligatioaholisthasyottoshow,¢ivenhipnunitofthe mutativsnnctionmnte,isthatactioaholhniddsndbio,via.,that thueanooliectivesamongthsaguts. Thanarspn'uslsciscasesof irndsciblyoonsctiveactiouFormmpls, 1) Ton,DickaadHan-ycanisdthspianospstah. mutant-amount» 2) ToucaniedthspiaaonpthsstairsandDichcan-isdthspiano npsta’n'oandHaI-rycanisdthspianonpstairs. ThepianocannotbscarriedbyTomalone,Dickalone,orHarry up; it) in my 4 "a. n .‘iui ' .g . It w, 1.1.. . z ‘ f I; "'0' f' r ’9 I‘tgbl|' "\ ’ "31 ' lail'fli "" 'l - "‘ i I" "‘ . it “:n“ c do :0 ‘3ini,i'-'I r “In“ ‘ H '4 r 1] ’ "bait. l ' il'3|.u'l } , «It r u: .3». .t t; ‘L. In . s Hiigflf H ..l I] r‘lun in I). 1w“ '9“! ,. 3,.“ . . . .1! .' .,. tl'uu N "4 i ' . N ‘Hll U. . lol~il "I ' v. il'Ilo 5' 4' 4 i: "‘ o"la.i iii-2.: . “,5 tultx 1‘1: 4' ' h i II" .t' '1 t (“it '19] .21. ’Hh' {" T'HI‘ "N. ”b"! ii)!" ICEI1‘ ‘I 9 t'i '0 - . - in I". f HM“. Hi, ‘ . V ‘. ‘ ’ it: 1 '0 ni Lin: 3 l ' i i‘ai., ”I I 1'. L: a! Hi 2.. v .. ic‘,;,:'l t.‘ vi 1] H“ int ‘,',i\_ ; J i‘/ t i a H ”4': n, km a: Irv ' 'lltu'h n W? I: t. ‘w 4n II . d' I x 3‘. :n . ‘ I .. ,~ 5 l N. Us" In In 911-:!‘t.‘ai-;‘Il Halon H .1] L.“ ..i u. «‘4' i ll 4. (I), . vn 5 U '1' th’si!’ "” ‘Ill- -: i‘l' 1‘ “3-111! "1‘! .1! 1'1' ii" f‘lh’ 1 3|! * i"1!""121 J :H i - H-‘J 31'” 14‘; Ili‘u. ,méu a’.i'ii:1,"‘i.|ti ')l’ i I}; l rug; man: 2,‘ g, .§~ ‘H‘ 6; HI | it I c|§ t . ,i A . . , 'V i ‘ l‘: '4" !l." “‘1‘ f"! a J" ‘1’ ‘1‘ I t, t'. l ' :1 “".‘J‘ " ‘ ‘ J' 'I H. i .' ‘ I ‘.rg‘ " n r“ [3 .ll“ l: 1|; :OQ it‘. ”I J" ' unsi'n i. I ’ i II“ " 3 II r' mm; tunihi "t 'Hwisr (in H ". ‘..'tf'u: ii ' W. I! 1n» i ‘ "_..g', t 1.,i rtlt .1-1 'uiiiii D'3 {i u 1'. '11 ,-.. :1 um. «; MI 3 r um . 9‘ {wt 4 H: mm! M : ‘ I 'rl " ‘0 ) o‘- x , "l‘i ?' “ ‘J II " t , A 3, .1 ‘ . 7 . _ n a. . 2;} lw sin ,1 4.; ‘4!“ r.«.[ ~‘-- my] ”it l It! ‘0 I : ".‘s.l MIR] 1. ‘w- :t was“; and In“: rm 4 u: a u 5: l D II " ' "It lib A t: a' :i {a} . ol"1t{'o wi 5‘ '5‘ u. y 'n. t 97 alone, but together they can carry it. Bringing it about that a piano is carried upstairs seems to require collective agency. No doubt, there are otherostasiblyooflectiveactiouthatdonotrsquirethementionofphysicd pal-I'bilityJormue. 3) Tom,DickandHa|-rycaniedthepencilupstairs. Obviouslyasiaguhragentislikelytobesflctocarryapencilupstairsbut princiseiethetruthoonditionsolB)mdbtincthomthoseol4); 4) TomoarriedthepencilupstairsandDickcarriedthepencil upstairsandHanycaI-riedthepencilupstu'rs. GeraldMaueyhassuggestedthatthevalidityolcertainarguments involvingreierenoetoooflectivu'anotoapturedbyboohaspredicatelogic andthatthhbgicisinsuficient(evenusententialiogicalonebinsaficient toa-essthevalidityofsomeargumentsthatareproperlyassessedby elementarylogic). Hisexamplesot‘inierenossnotcapturedbyboolean pndicatelogicare: (Al) Tom and Dickcarriedthe piano um' Dichand'l‘omcarriedthepianoupstairs. (A2) Tom, Dick and Egg are shimates. DicLI-larryud'l‘onareshipmates. (A3) T Dickand are TomandHu-ryareshipnates.” Suchpredicatesss'canied thepiaaoupstairs'and'manufactures wvehicles'annotusuallyascribsdtosingnlaragents. Yetthese pmdicatuaresyntactiodlyinditingubhabbfiom'osniedapencilupstaiu" ud'madeahookrug'whichare. Masseynotioesproblemswithtwokinds of argument. First, with those involving collective actions (Al) and second, those involving the relation between persons within a collective (A2) and ' 1 ~ I l‘ ' ' y, 4 v . ‘. .1 i . l‘ ol- ' In: . . I 'Jlir‘i. i~ ‘ugl. "l .i‘ '1. z ' '2 (in: it a: P.) w?" \(l:§'- 143 (v!) 1,. ’1'»h 1‘... , ‘3‘ 0 lo I 1 l J r .../'9 "I1 .l.t/ ‘i i "'lu.a~'t' H at 1 Mil lr‘l- : | 5'18 1 t .' Ii I' . v! t ( llgil’l“? li' {; «I f ".1312: I l 'tulh t. . ’o'l] r-‘l cc 'h. , 3. It rl'n’ ,t' it} " 3 li' ‘Ih'lx J l‘t. (in ’Ih J "'lt I ‘lti“| Hi. I) ..l '1 ‘Hi ".‘ ‘ ta t? M. 'Ml I H!“ ‘I .l ml I’M; r; ’.~= n I" ‘» ' l- ‘l4.o-' uh I ‘l‘ "' ‘1‘. 9’ ' "I L" . ' ”I c. u ll“‘ fil. ‘f'"i‘l Ilfli"i.n I! a '1 a) L. I’Hil- I H‘ s W! P" ' ‘ Dr (I w"“ I a, . l ”I ”b it! aq‘n i ll l‘O'liil-ll- I1 ‘l I: "'1 l? I Ml 'tl l’in 'oif.‘ In! ’ iii.‘ I‘l (" Qii""a ’1" ll ll .3"?1. ’4' ”I. t ‘ 'l ’3‘ i 'l-‘oii «'l l ‘l ’I ‘ ,3 si' itl‘ lahrrt'n-«h 'fz: °'l'( H. is.” . «in c, "I or in M .o. i I H w» (-1 ‘I‘l [ti I-WU? )t,‘ it!” tf'v find?“ )1 I‘li~l:¢~.i~l'l r'oii \ NH I‘ll illalt .I l 0‘ ' i‘ ,- :«;.: .HH; ' l N'st :i H H! u' l A: ' '. r ,‘i‘ ir‘(!l '1.‘|\ ' g ‘A".i'i o ""'l ‘l“‘* ..il r'" 1 .17 " h ' it i l n .i If; n 1 I l I ‘V‘ 4 I. r -~l' 1!» mi» mul MW. in“! Jul 1 ‘ ‘ . «wen-(~14 w”. ,I:;.. an» ,4 A .h l t- l ‘V H . ‘! ‘t.h . ii is It Hi' I ‘ ... gw q z ,1, ’11.! m ”mu; " It I IH'Ht‘ an arm w? l s 4 . l :1 I. l - .‘t{ r ‘i' -b l Sit ti. 0” ‘j'hsit t" '3‘,“ .' lot" 0 a“; u. | .I i ii ( ' n it iI '1 .1 i“‘¢:li{'1 tW‘ 5. H! J '01! .(H .l H . I": "u " , , ' ‘- _- . r v 4 [i 3] Jult.»:l » “at"; f! . 1 lg . II _31 4.x. 4 h 1. ‘ ‘7' ’R. I,-'\ I ‘ .‘JH ' J' l“ i "I. 2. 'Il.‘ 5.13‘!’ "Ju a] I" o: it t'lql‘ '( ‘.- ‘ - l .N .n "v‘ .; Pitt 311% ' viii : ' .i 1 98 (A3). I do not plan to treat inferences of the second type. With aspect to inferences of the first type, DBC oflers a solution to Mamey’s difliculty. (Hi rev'nion, called menological predicate logic, which allows, for example, thefnsionofDichandHan-ytohaveapropertyincommonisvery interesting, but will not here be d'ncusssd). Aslightrevision'mthesyntaxolDBCallowsiorcollectiveaction ascriptionsauumingthat any actingcollectivecanbedenotedbyl’ntingesch singular agent involved. Let 3.2.8 be replaced by 3.2.8‘ u iollowe: Where each a, '- a name 3.2.8‘ Boo...a.¢. For example, if 'a' translates 'Tom' and 'b' truslates 'Dich' and 'p" traulates'Thepianoiscarriedapstairs',thentheDBCssntenceiorl)is 'PBabp'. Revisioninthesemnntics'nahorequired. Let9.12 bereplacedby 9.12* as iollowe: 9.12" Where a, is a name and 45 is a wfl, gflBao...a.¢I)‘-t ill (i) (A-flm.ao)f\«nflm.a.)*(X)(h)(x€A*:tI¢B'-t)) and (ii) (1"-“mail”*(le(x€r":lI¢D‘-lllo The function I has been designed to depict the bringing-it—about-that relation between agentsandstatesotaflairsasananowingotalternative soenariosthatcucometopnss. Thesnmnarrowingtahesintoaccountthe statesotaflairsbronghtaboutbyallagentsatamoment. SeeFigureO. ABinferencessuchas(Al)arevalidintherevised DBC,whichshall heual'terbecalledDBC‘. InorderiorMassey’scI-itic'mtobelethalto DBC‘ there must be some sequence oi terms ...,a1,...,a,,... such that where d) is a wfl w- (B...,a,,...,a,,... -» B...,a.,...,a,,...). _/il-o Nile. I a. 1' :i. -'.l:ls( b "'I'fiQI ’1 i ‘9. 1 if”) ‘ ° 'l ' tlt' :. -‘ . L‘l .« 4 d”; ll-lelil MIMI “Iii? ;:.--',} Mu .'-.,w":‘|‘-.cl l". '. ,sl‘ 13"; will; . ,3 . pm): i m llrtqmu) a; HILrl Hi 13H. 3 Em; A - I in Hm: v.3 Itli ”PM/:1 will 'hl ~«tl‘ui l- n in” Jul .h'r'w .w ‘4' 1).; ill; I H 3" “pl ’1'“). "43! J" EL”: " ”ii; iii ll » "i I" It: 2“ I. 1 u ' ”Ill. .t 4i i'x'l’ll “l. "J I'II' " ‘ ’11 ' ' yétl '4'. (h t ‘l' ‘ . H." 'l- ‘H‘ " l H .’ ’2'! o ’l #8 ‘ t I! l i this a. '1 l l») ‘ , hi i,’ . 1, mm u h M .211“ u- : ~ - ll: - r ' u . . hm, A 1‘! rm «*an ii l-IIE. 11w. "‘*i1~l~‘.ti I. ll w (win -'~ In! , . I .. : ' , . . ,, . ’ ' . 'I ~ 'Hl Hn'luvr‘ ’4. : ‘Mi: it‘d! . (nun-no l'atllt- ’1 nuts) m; Infinl hull H ' '0 ‘3 l! l ‘ 'HH ml Ll‘ ’tl l-‘lervl \ Th w. (nun 2V 'll nl 1..(/I...I ”'12": . .' n (It, ,. g . .,. ., . , . 1‘ " .1. 7' i ‘ t" H .g I 'l l t“ ‘l“ l. .. ‘. . g 1’ a (‘J “r ‘ ‘. {fl '0‘!" l- ‘ ." A ill! . .E." ; -; ‘ .... --‘| Mum H ...!t‘ ..‘H “all 3'1 ; 1- u; s- «‘ ;~-ia u v... «M l Hull 1.; l -:..| (i ‘ . ‘ l i‘} }.'\'l”l‘l ‘10I’ 6 If: r' ll '2‘” it; f' ', p “LI: ,".'."‘.’ u _‘ f,‘ .l “‘4‘. l"‘ ‘. 4W»! r~ ml.” whipl ‘ ”Indus“! Hill? 4;: .r‘rt.) ..l 'vulul 111-.» um: r-wuulnfi I. '1“. t 'm’ if -1 :m s ... w'i: :L. lit. I-i mu»; 7:2 .‘h-H «1253:; in womb t ‘u-J . "l i ir'li” ’l ‘N- :‘I {film-3 W}. l'/] r.” li 'f!’ I” ll . cil l.f " ' h ‘1 ill I. liilli’l r . n ;.,. In. (.l H; :zl .‘ .2; I I i;;, I ...; (mfg. ' 3 . ‘1 Us « ll U" . .‘, . 'i_“l‘vl l-‘- ' xi ".5“ w “51'” "i 3:"Ulgl ' 3 . l'i‘l It '1 l l 99 FIGURE 9 givutbenctionnolanndfi nflmomentnnooeunryntm givcnfl’nnctiann Bnttb'nbhnpodblodncetbonttboonticinmcfionthnthmAinthe condition'nonlerblind. Bntnctionindividuhtnincflnctauutthtthotntbconditiomior any antenna of the torn BarnBafi are the name no (3V0)...(3W.)(Baovoa...ABa.V.). For mph, thnt the truth conditions for 'Dicknndfinrrybcingitnbonttbnttbophnohcnrriednptbootniu‘need notmtiontbofnfionolDicknndHnrrybntonlytbodnuhrmtDick nndtbooinxnhrngentflu-ry. htnitively,wemightthinkofthew‘u dotnifingthobodflymborpbyficdtombmubtnbontbyTomud Dick. Haenpncticnldiflcnltym Marathons-antennas? Can netionindividnnl'mbomnintninedwitbonttbem? hordinnrydioeourae tknmmcoflecfivcnctionuaiptiouhtwhichtbmmnomm mtmiptionndtbomn'litonort. Buttboplnnuibfitydnctionindividnnhbainilutothephuibifity oftednctio-dcbm'lttytopby-‘a. Tomyknowlodge,noonehu estnbliuhednphysicnltrmlntionforeverycbemicnloentenoe. The . I Pt" I" Hi in M. l‘.'.r‘ --ll r. {111” II- r'zh 1.3. .J. n]~51.4 |.l m n 'i *2 ..1,| "In“ :11 m .i I! :“r'v‘ O I'i.‘ r :9] .l“ 0"! 'l g in; . . l-HK s l- ”Lulu m! fl--.. l . . .' A! r ... x.” 11.. u .Iw r' r e H" ; 'l', 3, .- fli';ilt l1 JI HUI. I'rl‘ )3! 'l.;‘ gil In ‘I '9 1 :i: an 1 .1 7, hi 3"” ; ...! l '!1 fi| Ii' .1, b" l‘v‘ ' "*Jlfl 4w) ”H‘li ‘H,’ it I' l;l ‘- !29 H “ l: J H, 1 r'.‘ 'L “IN " :H' "3‘ ."' ‘r 'l H, "i a; 1" "1: i'i " ivl Muuslyi 'u: filt"‘ 9r ' it {"91“ "i 11.] ‘1 v.~A. a O . .' l 1 l 9 ' - r I I. ‘ o « " . rl In» * hi 0 n! '3 +12; '9 will”; ”ml IRE! h J, l; ‘ l 9 3'th l‘llls A '3 é ' r' I‘M -. : ’ '1» ..1 Am Ind wull mu. '4 ."l h ' 1 9' W1" :1 43. mi sun ; O ' o : nil 1k: “1sz ‘H'J'l‘ 't'J ‘ ~HII 4' (I'LH v.‘ ‘1'. .' .‘ul- ‘nh .o l ‘ _ I . I I ' 0': t 1 um ax-v Hi Jim!» “Prilhhl r"="t‘~o {ts-Orin} In M‘ I: :h-IH Ill: .-l 'w NH. .1: l J ‘5 “I”. ‘!r N” "HS '.\l'it ‘l-uu-W I 7.!) Ital" l ‘\ u ; iri.. .' . . . 1 , . . . . " u» .h W. us- In ul r ’l "'1'!” as‘1:;;.*"s«:t '1: mvuhoU-I am Wm : J3. x ‘3 H8 ‘I"-111 H 4:!” :3! ram! 3;: we: ”'h: m WP; 3.4': “U" .m ‘H .1 I'hw w-wldp"! “1.13 In .1011 ‘l. 3 Mini tn a we!" m lei-33‘ rt Mir-Hum “'1 -! u-n' 4‘ in r'm-‘t :1 ,; m *6" v H i "’l ("'H‘i l'..' ‘4'. r“. 'I‘ ' “‘ Hi Id '31.; t' ' n 'l I "01’ U i" w m w. 'esulx '. ..1 .: c .1»... 1* u my . .. ' . tn. 100 motivntion for showing thnt the chemical—to-phyeicnl trnnelntiona are pouible wee systematic. And if put of the philosopher’e tank is to elucidate the relntione between the sentences in different scientific theories, the ndnctionotchem’ntrytopbyeicewuvnluble. Infnvorofindividnnliemit shouldbenotedthntpmponentedthieviewdonotclnimthntoollective netionnentemeehnvenoneefnlfunctionorthnttheyehonldbebnn'nhed fromthedieoonrneoleocielecienee. Bnttheydoclnimthnttheyahonldbe beniehed,ifpouible,homnphiheophicdnooutrnctionnnditnppennthnt ehnplicityudpuoimonymmedbynctionindividul'lmmorethuby netionhol'lm. Pahnmthennnlogybetweennctionindividnnliemnnd chemienl/phylicnlrednction'ltoonnguine. Puhnpetheteble-epistemic vnlneinehowinghowtheindividulhtdiepeueowithpncticnflyvduble eoflectionnctionuaiptiomthuinehowinghowchemletrycnnbendnced tophynieo. Therebnnotherpncticnlproblem. Inordinnrydieoonree,wenre necnntomedtouingindividnnlumenforindividulngente. But,eepecinlly inthcuedhrgempotumcuwennmenflthelinglhrngente involvedinnnonteniblyeollectivenction? Whichngentlnretobeinclnded onthel'ltao...a‘whenwenreeonlidefin¢thenctioneol(}enenlMotom Corporation? Thiienpecinflyeomplicntedoincethelbtdempbymetock holders,etc.chnngeednily. Theeolntbntothiedmcnlty'lliketheeolntion tothelnnt. Inprinciple,iteeemthntthereienorennonwhythelietof dunkmtninvolvedinhnpouiblenlthonghverydificnltorpethnpe impouibletonnoertnin. Thimblemnndtbelnetindicntethntnlimitie behxrenchedinhnmuepitemiccnpncitywhenindividulilmiemnintnined. Adechionnlntivetotheindividnnl'lti-neeeemtoinvolvenchoioe between two dkvnlnee. On the one hand the individunl'ut rinks poetnlnting U ID I t e . [f‘ V ' -c I f. t‘ t H g I ! 0' :i‘ ”1"Nti int” 3 N' 1:! .... In3 H‘ ' ‘ L "t '1' ’19 1 ~ Wuhan I ’ l"l.‘ 1:. mums I ’ , u. Hi ;I‘ . :s 2! u .t- Bu '. I a , ~IH in rlu'nt.u['-i¢ 4 vi 3 trilhvaw ["1‘ ”At! l I' ‘f 't I l”. H 'Hl . . i '. l I 1 j » Hm“ I 1.3 lhul In” . A I ml l. \I 1'! w L. I ~ ~ . . l {a ll l t'l4 'lily l ," 3?. ~‘ r I! |t\ .al urn .:. l-: IR |_ . ‘ law '1' i an git. mm... ”In: t . 1 MI.» u ;.. I- it”! it 7'1. l ts U l ‘4 ' :Hoh fl. "3: t. -3 'a ' ' "" -'l i'l"-sl' 1". -: l" "13;,..?§i" W", A ”"1" . l I l . l H I in .. .s .i "I a" ' .a inallfll Hill" u“ 5.3, l ‘9! Uh ' J 'i U” ‘- . ”I 't 144/!» 5"!" i“ h 4‘ at? 'N .. “t In .2.Lai' H: h rxtui H ' ; , l‘ , «IV D it! i f tit D s l: ' ‘ llt t‘ r‘uu a ‘2 . .;.l .46 3: ‘ I i' '- 1! “:1 1n ‘nuti ”‘1 1 - -;2'..!in’l‘w! ‘ c ‘ t n .‘ iH >M ~ I ‘ ti v D r. ,1 3 J ., ; l ”\ ‘3! 1M1.) 3, . I I1 :h - ' [. HIM. 'a. ..H " H t 4;, 3 'x ?. .II II I!“ _r y I I;:', ttl ‘r!’ 'l‘t’ 'l,l:i' i: g, :“l 'I l ' ' :1 li't‘.’ ‘3 ”.3 AI 1"] 4.1.15 "lfl' all I; A u ..31 . a ' ' ' I ‘l'l Iltf’ ‘| t '3’. no‘. " "I ’|:,‘ . ,‘, -‘§ i” .‘ I t I «i Mi u’. . H :1 It. '11 ., u ,4... .,. «1| - :11] c 'x {I - ‘lw' r: u I ldli 'l-’ i! til I l s 0.3» ’; 1*“ ‘l 'l' ' M [It .. , l 9 Q“ I I " Ii .m- 0.r l .13..1 “‘5 HI . ' l - , . 3 . , g ‘. cl In 'i I 'l‘ 9‘ ll' ' ‘ ‘tlh'l It o ‘H‘ln! 31ml ; | t '5‘ ’l' '1l’~ I; . ‘. r p I l 3 l'l I 1', l.’ k' H ' 1' f ' h’ I '. I"! I In 5". v ' I .i r >|l t. m. 3'. : .. i" , 3. li;* ‘ } fit': I ,7 , ,., ., . .' l‘ll't H H ...L 3 IL! , I I i'il ' .l- .L . . ~ I. r‘ ‘M' ' 1*,lu 1|1 i t 'i til .1, ..t a Y . ' '3 101 truth conditions which are out of humnn epistemic reach. The truth conditionseitherholdortheydonot,evenifnoneofuscsntellwhether theydo. Ontheother,theholistviolntesordinnryscruphsngninstthe «items at irreducibly collective agents, or worse yet, collective persons with mentnlstntessndnll. Itseemstomethntthereishopeforlessoflensein theindividnsfldhection,nndthishope'nmorenttrnctivethnnviohtingthe dictntesdpnrsimony. Amgthethesesforcollectivenctionsscriptionsis: 12.20 un-IBao...a._|_, since the intersection involved in the truth conditions for collective action ucriptioncnnnotbeempty. Aboitintobenotedthnt 13.15 béBaflo...fl.¢->Ba¢, vim, thnt (I together with floufin bring it sbont thnt ob does not entail that a nlonebringsdinbout. Abo, 13.16 staflo...B.¢-’ nBafi. hothawomitdounotbllowthntilatogetherwiththecooperntionof Bo...fi_brings¢sbout,thenadoesnotbring¢nboutslone. Furthermore, 13.17 fiBmfi-wuBaflrfilp. Thntitosny,thepouibilityisnotrnledontthntaslonebrings¢sbout and a in cooperntion with [30.43. brings ¢ nbont. Moreover, the collective versionofRE‘holdssndRM.doesnot,nsistbecnsewithsingulsrngent nncriptions. 1.11.. « t o p . if H ti‘ o l (I - i a i I“) '- 'H . :v 3 \ it al "u L . l i" i'i' ‘ 1"..11“ "l‘-'-"!' “‘ ..g r .,i.i-r ,‘y... J wfl.’ : .11 M‘i l'..\1 ‘uii t! I)" ollii :lI-r, I) 1 -' . v, i“! I I; l' ‘iil ‘i. ‘v .I l" I" . ,i’o‘clu ': 49 H “11.4 1;” r hi Ill "3“! (a . n! lmi» 'Hll c"- rail” ll ii» mm ”Jr No.1 '5” Hum! u 3! ‘ 15) 115112;. lull -l mutt ...3 1”“. 'HH ruv In: .i‘lnlil'.“ m. H xv! 11.31 1! ' ‘1. f ”I " ‘tlilfl u e~ H“! ’r‘ III! r .1: 11.; .w. mil 1 n ".hqu.‘ . . I- i 'a. .uHJJI lnrl -.4~H 1n. 1'. .‘l' ‘1 ur 1“” lil it"a"’*’ittlii i!" "-1'. l: H! " :l ‘- . t't “l ‘1 - . I",’Il'! 1'1 it 011;! 1' w I~ ti : . . ‘- . ‘ t-fi'il't it'll K'Hl: ,' ”Hit it. ' n ii 1.11 l l. 3'1 l l4;l=’ l ll..1i .1 V.“ illnnih’ 4 r :1"! Mini. Mi * ' t ‘t v '1 i ,.,.., 'ill! "in/'4 in}! Hurt it 1:33.‘ If! ’!i In" 3"“ ‘I H ’ lw’l l 2. ' ill '1: fH‘t ..1 sin iluvih : u :0 l- u .2 cl: ’3 u nil “H.313. r",la.": . “s. .1 * .1 .t kgkl'i‘i th'lln s' 3.4!] 533.: hue-l ‘Lll rtl (E.l’ it" H :Ili H H, at ' '11 . . l ,1'3I‘ti'i‘flis. idol-3' ‘ v 4‘13 in l «'l .o . l' ' 1' i -t C.” 'ti“ ll 0“ it." Nil 7': r: hu-l ' t ~31 it’d in!" H lsh: c 1 u! n J"! I rd. 1. "l CHAPTER SIX THEISM, VOLUNTARISM AND DETERMINISM 1. ACTION POWER It'nwidelybelievedthatthereareseveralagents,eachuniquely contributing to the way things turn out. Any position regarding determinism oughttogivesomeaccountofthisbeliefandintheprocessexplainthe interplay between action ascriptions and descriptive natural law and between the actionsofdistinct agents. InChapterThree,someattention was given to coercion and in Chapter Five cooperative actions involving several agents wereconsidered. Inthischapter,theinterplay°ucenterstage,especially wheredivineandhumanactionsmightconflict. In the semantic structure at BBC, the moment In 0! evaluation '3, fromitsownpersective,theprsssnt moment. Theset{x:Rx,m},istobe thoughtofashavingthemomentspossiblerelativetomasmembers. Itis intermsofthissetthatthetruthconditionsiorsentencssottheformD4) mpresentedinChapterOne. Thesubset {meflmfin represents the set ofmommtsnecessaryatmgiventheactionsclagenta,crmomentsthat actualh'utorymustpassthmughbecauseofwhatadoes. Characteristicsof thbsetalongwithtruthconditionsiorsentencesoitheiormBalpwere uploredinChapterTwoandobjectlanguagesutencesoftheformme weretakenastranslationsofordinarysentencessuchas'abringsitabout that d". In Chapter Five the feasibility of collective action ascription was considered. There the set {xszKm,a,)n...flflm,ak)} where each atII is a 102 s . V‘ I. .- --.- .r ‘ " i ' g i l ' ’I'l t. 11' ‘ ~ ' ’ ' i h * 'i l c‘ . 3 '0. In. H I/. 1" ’4 il.! ‘ ”in ”an, uczl . 3 i ‘ - In lulu; 1'; ill .1 In‘. . NH .1." U ‘leHWm I H. z a! .‘lvl ".11? a H! 4 u . ..r;.. ”,u?.1',1‘[ f r w.'- z 1' fl». ' if: r' x': b I ir _ i3. - l 4 '9!!! - [Hi '1' 1' ti 1 I" 1n; ' I i' w g” “"0. ' ' HI ,- 1“. 1‘ t , ‘ . p1 , .t- . ‘ ,. t t 1... .. . H H i Tim»: 1 1 .i- , 3 w: 1.1.. - 22v 'azv‘d t In W In vuuwl Mil , ii- i h "I‘ ' "HM = W i 1 :at . : Jir ‘vlt 'll'U-‘l‘lill . ’F’ tl'.‘ :33 '1‘! t I-" II 1’! * .' in. .l ”:slu” . .-. 'vl -. {Li't‘l 0! ' ii "s1 Ilnun- "*7. .1: mi ..ti .4. P u ‘L‘ "...! '1” I an m' «'1v‘l""$ ‘. «ins-g! ' .m‘ ;~ '2: 1‘ . 3.; 1 m .. "l" ‘ MM 1 r} 'wi: ‘H:: -. 1 I- I» 5 m t-v‘n "! nu. vuwu' -' it: I. '1 14' w :t. H H‘ 2. . ml rm: ' 1' {Ad , "lv ' 1 id .8 'i . i‘ 1' .h s l I 1 hi I l I. ., "I 1 !H r' In Ilw « lHi , I ll ' l' I H - . 1' v f lnzi . i 3.. n v ' , 11 ‘. J I I, in .5 .4' I nl [H i .1 1|. i.v: ' 91' .g,» p, 31', . . , 1 I. 1! ~) --,I' ( : . ... > I 'l 1.1:! .» . I v w! tll L I“ 103 name, was to be thought of as the set of moments necessary at m given the actions of agents away Sentences of the form Bum were taken as translations of 'a and 3 bring it about that W. If the list (11,...01,l includes a nameioreveryagent,thesetrepresentsthesetofmomentspossibleatm given what every agent does. In other words, Barnum is a translation for “(b 'u the product of all actions". These situation are depicted in Figure 10. HwetakethefreedomofquantifyingoverwflsoiDBC,wecansee howvariousmetaphysicalpositionscanbeexpmedintheaotationofDBC. According to some metaphysicians, the iollowing is true: PU (¢)(¢»(3:.)...(1s.)3s.,...s.¢) unleadicontainssomewflofthetypeBMiasawell—iolmedpart. One might call this weak personalism or pluralistic voluntarism. According to thkview,evmythingthatisthecase,apartfiomactiouthemselves,springs homagency. Thisviewrulesoutraadomnessifwhat'utruerandomlyis not brought about. Butinorderforaneventtobedeemedraadoln,notonlyisit neceuarythattheeventnotbebroughtabout,bataboitrnastbethecase thattheevent'unotcausedaccordingtoanaturallaw. HEDW-vmholds onlywherethereisaaaturallawaccordingtowhich¢iscausedbymone mightcouidertheioflowingthes'nwhichseunstoapresathemajorclaim oinaturallawdeterrnin'un. Thisthes'ucornbinesDBCnotationwith LU (¢)(¢-'(3W)(1P is 1‘ W3" Mnl Null-fit! aEUW-*¢)). laotherwolds,everythingthatisthecue'ndeterminedbysomedescfiptive tutu-l M W- The theses PU and LU resemble those that follow. According to the first, called PE (th'l resembles PU), at least some events spring from action. Hi- I. ,' II '- ‘ '5 ll)” 1". it: 1 mil”! . I All ‘ Hi“ i 1‘.“ 0'1: l"!.‘ v twin!» '1 w .t «i , "9”.) In” [1: .» “if a bum H ' J] 6 ii . 1.: I n In“. D H ‘- " H31” . I f' ‘ ' "J " 'i i.~ 3...;1 ii ‘ J} In 4 1'! ~£O I ' ’l. a: v" t ".r . it ' . H. . ' 1 It In: ' A .. ii i .u -:u..; .. uni .. lat ' 1| 1' t' ‘3 ‘utr' 40! la. t E 3.1:. s l H l u: ,, . . ' v- , 'v-. . n -z..«. -a . .'.i .. s. w. 2 :"J 'l"’(I '1s31'. lily l" g,]:-. . . ”'3 ,fi. at: t It! '1 mi N. ‘ l w. it '1' Iol'l ‘ Ml ‘c * 3‘. .9 n .nm a. f I m “m. y. x ’. z‘ 1 i l i l J .1 1 Own \ ‘ , .3 1n 5'; 'r . s . 11.. "a ‘ ‘1 .11., u. |‘ no. *"l [win 9 'th Hill‘i’ .'m;'. we" r .' r'l 'a.‘ Aul‘ ll ‘iu’ H .- H': in 1 tin! l7” .3! ’1' .' "I; i .. p'. lihl E ii" I zlz 'Nl (ll 1. '1! 9|: ital '11.!» . mail; 1;" ‘ « h. l.‘ m al in - . M. .I u "Ti .3 ”'i “:1" l l 1‘ ' i t 1.1 'I. IN“! ' t it.! 2| 1’ . I! u ’o « ‘ Kn: '. . l‘ Um- u.. um i» n - 'i: t "5 .-, s' In!” ".1 L. .n H H. b' 'Hii . . " ill" lll‘vr' u’l- ‘ ' "'0‘ t ‘lltv'L'z a 1 'Hi If 95 H ”.1 .4 ‘1' ‘l l/“*. . V I) e. '1 . 0‘ ‘ i i' n ' vl'i in» #9 L h t in 1: ‘ b ' o/s I , [35.1 / IJQ. .....g. M - .1 ,1 pm az- ‘ - vim...’ ‘13... 3 u 1 w: I I 4 will .‘a in "gill: i H g. 16- I t‘ o 431 i w . i H‘ .'?v ‘i '.i '0 It‘ll ‘. i‘ l 4.1K” I 6 .~ 'l l ...; In i 2'. 3 .t 0" 104 FIGURE 10 ACTION, COLLECTIVE ACTION AND POSSIBILITY SCPPOUB¢btraeiacross-hatchedmud TRUE SENTENCE m z// '/ . {when} 05/“ 4%; lam) 4’ ’/ Kyéflm‘ o4: 4‘ ’1“: (3%“,7,//:,/; ”Wilt-54 xr “Bat ?/ ~ .= «W: '1 715,59 ,1? I .'1..—.”f’///f‘r 113m ’ ‘ $4”! in, ’6", vi ‘ in.» ¢ 10¢ 90¢ '13” 4’ wo¢ 18m '13“ 4 l I ‘ is..‘ ‘( i,l " " J l " l r} imam.” ,-~ HI mil ,1 . ...... 'll _ 1' .1 tf‘ ,‘ “l D it t ‘ ’ I plll l .1 1': ’ ll"! “fill ’3' It! I“ :1 ‘i./'; f':|||§;‘lql1 i». * um 105 PE (w)(¢a(3«.)...(3:.)B:o.-.s.¢). AgainitseemsthatwffsottheiormBfl'Wshouldbekepth-omcbinorderto protecttheplaasibilityoftheview. Accordingtothesecond,calledLE, thuearesomeaatarallaws. LE (fiN‘thMW is e We at“ MIN“? AEDW-'¢)- Neither PU nor PE is incompatible with LU. In other words, one coaldbelievethateverythingorsomethingsspringfromactioaandatthe sametimebelievethatactionsareasubeetolthinpcausedbynaturallaw. Thbgivesprioritytonaturallawoveraction. Hencesomewouldwantto holdPUanddenyLE. Butthelatterviewcountersthepopalarbelidthatagencyhas impersonaldescriptivenaturallawasacontextaadthatagentscanase lawfulconnectionsumeauintheaccomplishmentolcertainends,butthese lawfulcoanectionsarethemselvesnotsabiecttochangsonthebasbolagent initiative. Haviewingreateragreementwiththispopularbelidisdesired sentencesottheiormcbofLUcouldberestrictedsothattheycontainno well—iormedpartsofthetypeBap. OronemightsimplyembraceLEand PE. Anotherviewadvancedbysomethe'stsisthat Tl (33)(¢)E(¢-'BI¢)- chueisbutoaexfikethhwehavetheclaimolsomemoaotheiststhat Godbringsaboutallthat'lthecase. BataccordingtoDBC,some constraints on ¢seem in order. There aresomeaentencse, 2+2-4, for mmphwhichanneceuarihvtrue,that‘n,theymtrueateverypossible moment. lnondertobring2+2=4 about, Godmustbeassigned every possible momentatevery moment. ItlollowafromTl that ¢+D¢isa thesi. If we suppose not, then there must be some moment m and sentence .H‘ :' I ‘19 I I v IO '1 i I .1". .. 3 .I; I"‘ 1‘ mm ' .i .x ..3 '~ H" 0U -i~ ') il.l‘. in!” a». H. ‘llll' [in ”'5' is. '"l' ""‘j it i 0 3m ‘l" .““ r .1 r 13' ._ l 'Is"'i ‘ k” ‘1? 13‘” II: I-"i. -‘ culi‘ .’"'l n Hii..:l ‘ l . :6! l-Il l. 3 ll 2. "', all 3 h ..a. :1 'i I» .il' t. I. - i ‘3-01' 05 ' H. linl 3 ’ '1" ’1 ’ Mir - '1'” t. » I 5 I3 l Inn .1 431‘. h - i; . .5; my! Eli: r- i'tl ”I! ~ ' ' , W» 2!!! 'l 3 l 1 o". '.' "a! "L: t ’ [:1 .3 u-3 i ...Hir‘ . 2 3 m it; ll' 3 4.i I. isi"ltr“h -‘~ 3 '-' 3 .l -. h{[¢r-{ 49’ "VI ti 1‘ l f 3 i. ‘I'y )1 7|} . i. ‘i‘ w 9 9 ! ; l n I; I; i" I] .lU-‘ 3.' l “[1; -v. H. i“"l l’et' o IilJ 'illlH “‘ o . ,"a.. f'UII’ i :3" i I3! 3:: I .u - Hi I. .I '4 . It I; 7 q .i ' l i ll 3 I .. 1‘! III |. .s, . it. .1" r“ . ;=',-92I £ch "3.! Min“! .'[.th;f; ll"'1i’lr 311-! l 106 V such that at some moment n possible relative to m, w is the case and somepoaiblemomentn'possiblerelativetomatwhichWisnotthecase. ButinorderiorittobethecaseatmthatGodbringsaboutevery seatence,includingtheaecessitations,hemustbeassigledevery moment pomibbrelativetom. Hso,itwillbefabeatmthatGodbringsWabout, sinceinoneoithemomentsheisassignedatm,uamelyn',¢isfabe. In otherworfiTlruleaoutthebeliefincontingeacyaltogether. Noeventand noactioniscontingent. EventheactioaolGodinbriugingeverything about'naecemary. TheproblemTlposescanbeseenbyattendingtotheDBCthesis: 1231 (WWMWWMPWW)(°VA°1¢AW)D- Inotherwords,atanymoment,anyagentwhobringssomethingnecessary about,doesnotbringanythingcontingentaboat. Someweakeaingin'l‘lis moreinkeepingwiththeassertionoletmngthefuticvolutarbtssachas: T2 (3I)(¢)E((<>¢A°"¢)-'B¢)- HereGodbringaaboatallthat'ucoatingent. Thiincludesactionssothat accordingtothbview,Godbrinpaboutallcoatlngentactions. Butsince 12.22 (4’)“ 0W 0 'NMM) * “Gil/)(DVABG’WD. ilGodbringsabontanycoatingentstateolaflairs,hebrhgaaboutnothing nece-aryandthusgivesupanycoatroloveraaturallawiftheseare aece-arilythecase. But couider another alternative. Assuming diagramming conventions asdepictedinFigunlO,wemightsupposethatateachmomentthepictur-e issomethinglikethatdepictedinFigurell. 33-ll . .3 . .r 71' it‘ *l's "flllli‘ ‘5 lili'll .qlr I-il '3: n 3": IR 11311.1“! hut unturruh.’ i am... ’fl‘li F “; 'I Q. .I b . y ? 'liti ll! I " L" Hi ' In; 5 II . I ‘i f I I I ‘I " 'lll :{o I. :5, ‘/ i‘s‘ ‘I 't I; I“ ‘ i " '. .t. I‘Lll’ 4: .I III lb '1 ‘ IIH "II 3.: n w' ‘ ii In ' " :I- H -8 . was: in 1,: :Ipl , ‘ )uot. 33.1 I , In I . I. .3 m u. -. a: wl 1.32! a. H m "r 35 3 u 13mm! .w I: . Hf‘ .- 3‘. - u ' H. -u n .3 "I; t 1.. 'l u; -.. 1.; :‘l ,3” I I ,-. .3 c ' HM: r 3:3 't :. ‘zul all a , In t" .. 'h '34! l' i H:“ . . Kg.) ~li u g .3‘ * I1 , "I Hi :3» ‘~-‘ ll 0:! 3.. Av . 3 x -. m. 3 3 I'll LU: .. HILM r,9‘,|i - .‘I ;* I-ll-i u” 3. I. h it. n H 1. MI W ' Ht .3. hi "3 t ‘elii m. 3" ~I - . O . 3 ,' --; '{[..lll, i“ ”3 l H. ‘ it 3" l. H t I at} 1”] gidh '. :L~. A . ’j‘ 1:. I "91' H u: .--n ..- Am rail ‘33. 3:31;“3'3‘: rt 5. :11 m: Ill-v”. r ”1.! ""I- c " Hv’N‘Vl lid .H"Nib " “31" I“!!! .” l’ ’ ... 2 A, ,. 3 g,:...ial. ~... 1.3.; .. 4’ ‘1“ -i I”; "It " ‘fIl l" 1'21" '4 «El ’1!” I HEM "H" is . 0 ~ I I 1‘ it hm U H Hill 'l"l‘l I!” 83.: I WM; (:36 .; HIE I '!L IN Illl Il" ’II .4 H: ‘ann .ri(l , 9| 107 FIGURE 11 lnth'ndepictionwem’ghtthinkolGod’sactions as narrowing thecoarseolevents with variation accordiagtotheseveralpossibifitiulabellsdflm). PerhapsGoddoesnotdetes-ninewhattielwearatm. Bat,hemight. He mightdeterm'newhattielwearbatnotwhatkinddsandwichlhavefor lunch. ThevariatioastopsshortolGoddster-hingwhatbaecessu-ilythe cmwhkhhustraagecouequsncssaswehaveseea,butthestrengthof God’sactioacanvary. Perhapsitvarissfromtimetothe. PerhapsGod asrrowsthecourseh’utoryioflowgbatdoesaotbringabostevuyth'mgabout that(shortofaecessity)happsns. Thissssmsaplaasiblealternative accord'ngtotheDBCsemanticsandisdeservingdmorecareful coasideratioathanlamabletogiveithere. H .Ht It! I. ~rI I:» ”'1! 3' "i III to. 'o.. . 0| «Mn: N. P IN“) N loL. .. 'I‘l‘sg'h ' II I HHIHM rim. in A: i. h' ..-1 MN .3 3142.4 34,». He nl'rH ‘~ 1?. '- r-" H‘ I“ "ii?" '1 ' ‘ll'll l~ ..H.‘ l 'l "‘ u I 'l'tci‘-"""5; "'..‘.O‘ 0" 'Hi t" ..tiwi "\ ., iail u! .MJ 9U H; 1th 2 'ul 3M!!! ‘nm'é: V *' but r" E! l-» i filmii ' :3! I Hath”:- to 111.54 134:” in“ m. I. m I a: 3m” =iIHU'I'H'I) H0 u! IHIIS ”on! ,4 EM?" L. 13 Hull“: 'Ila t‘ H in l.~"" '; ‘r' In! cum}: I! . ll Mm {twill lI'.‘ ML? “3' 'L'I—r ‘bi- II ‘6” 'I a?! H .._ g- 3 ‘ Viv-.5». .351 u 4! f! h' ‘ “"f’w’l'oi .‘NIHI 1.3 ”I”: His-ll . 'H~I Ii ~ 43 - 11., 1:: H "I m r Inu‘ 'u.l'. ‘_;| “.Il‘nl‘l ill” 6|, ;_q'.lI-l It”. .I'n:|. “ii If“)! I ."uui ..I it)" '2“; I ltd ’6‘“ 'IV. .ilzml r. ...,- (Il‘: nul'fl‘i-a 3 3 in: I.l "'1 I It! . "‘ Pl lzi ‘HH. i'-"'~l. f‘l In“. - blithyi-i- HI , pgi ml Hint...“ , Hi ' .1’ 5 3t. 2. ,2 I I ”i .: . I .3“ ..H': 108 2. ETHICS, DIVINE POWER AND PREVENTABILITY Consider how these matters impinge on obligation and prohibition. If God’acommandtoatobringcfiabont'uenficientiorD(1Ba¢->FSa)then onemightaayGodcontrobth'nobligation. MootChrietiaathe’utebelieve thhwenfltheyholdadeontobgicalviewofmetaethice. HT2iea|oo embraced,Godabocontrobwhichobligationlareheptaadwhichbroken. Animilareitnatioahoideioriorbiddanceo. Butth'n'nintolerahleiorthe'nte andnontheistealike;fortheietebecanoeitoeemetomakeGodgufltyforeine (althoughaewehaveoeentBMdoeenotentailBflaldaeioobvioue ngBa¢dounotentaflfiBg¢)aldiornonthe'utohecoueT2aflowetoo much divine control over actions. ItmightbeargnedthnttheDBCanalyebolmoralproperty aocriptioneie,eepeciallyaparthomthebticconeideretioae,tooetmng. Snppooeafaibtobring¢about. Thicaabeaeinofcomm‘uiononlyif theappiicatioaoiaanctiontoa'nanpmentabieainpflciter. hotherworde, auction’efntnreoccnrmcenaltheuetoppobie,notonlyaofaraoa’e powers of action are concerned, but as far as anyone’e or any combination of agentactiom'ucoacerned. Butanetioningiloomethingthatfallibieagente do,andbecaaoeo(thereaioccarrenceottriedactioaothatfail,itmightbe thateomeonetrieetooanctionaintheeventola’efailue,bnteomehowor otheraeocapee. Ifhecangetawaywithnotbringing¢abont,thntie,if hecaneacapenece-arypu'nhmentalaconaeqnencedhiofaihretobring ¢abont,thenheienotobligedtobringitahont. ch'neitnatioa’utakentoindicetethattheDBCanalyeieaeit stando'ltooetronx,aomeremedyhpouible. Onemightweakenthe nnpreventability requirements of the analysis thus far presented. Instead of H '0 x ‘, J ‘t \ i t l .. Lu. ...:H. In x ~ mam. rm; : t mu 1 q; I ‘3. .1 0 Ir! it!!! i...-si—' r! iil‘A'li .. f. ”.1 ll 1 HI I Uta.” .ic. [“10" ‘ .3: It: ~; H ’1' 3,4“ 4.?! r 2:11.3': ’u I I. r 1.; , .,.u H r.litH'H -.u i. h n! q . “'1... «to .. _, -.,.. H u ' .H! t NU” it”. "5 'A "If. (v’ Iii. I1; .- iii.i-"' ..EIH" ’ .' 1" cl : ' ' no. I J Win-ti 4‘?! r. r Ii: ‘3- , —»:,l. «0233”: . ~|i i ..i' : 'rf- ,‘ "'iHI- l' i I u. H 'l - "a: t 3’ ~ " i r" ' " ¢\ "1 ' ""‘” i“ h Iran ‘. u... . in: u' . I. mi H at. u u u‘ Hui ;, n. o- i !» MH-‘lwii v .1 o .. . . .;o.:u Mu . u > J v. n. A " I i .. a i- ‘ H .I it ' Ii u! ‘i .13.”; ’ti I "i it. I, «i . i ' it. hill . um; . . 4 m n:' m '1'! I‘m: #1 3.1.: . u - .; n «. r .345}! i. t.'r h “‘1 HOE: «.uii illtnlz- ,. Yul !' ti Il~¥ .. ;-'h Mi ~ ”I | -'.~ \t nun-Hi ."tt 3.;1- PI 1‘ I I" 2 l'fr' .u H- ! £3114 ‘t..i I r: i! 5: I H 'l "'1." {-iiralll Hi in.“ M “v i1.|,'1a- 1:; .2 h i - i'~ i h r 1"” I" ' "DI/HF ’h [iii an 'ilwi ' d I“ I a Mr. ‘ . | ’J‘I“ sl- ’.i in.“ *3: H5 .niaw «I U'il' - .1 at... . 0,1";IIIIJ ’ . I .1,” f HT ' II it; l'i: um.” .h l but '1 . I; Kilt .. Ln. ..5 l "U: , V! 11' . ,ulc tum “:5 pita! . r' ' i“ in. a .3! . ,.\? st r - ' . Moi w- . 4.1;] - «HM ' "'l‘.‘.'HIltl lam s n l- at» b"! 1‘. i it é '3» r ‘n * v r” i . ‘I i'HLru I i K 8 iv? UN. in; [its-{0" ”I i ; 3i 9|: 1‘ ~1‘. i t.l i‘l it :1 *3 I': t" .“ ill'nii ?.7 )t' i “(I I 3' '9cl Hi .1. ' li":.i "i i’ i-LHH!‘ v'!o'i i‘ o- ':i '. g r Phat-i] r1] . an -I ‘v..l‘ r '3‘" 'rn' 1 n. F. ‘ I: It 0 «i ". {153. "i3 ii '0‘ '1! J k i t' 'I n i 109 OmbbeingeqnivalenttoD(-IBoaI>->F8a)aehaebeenenggeeted,itcanbe treatedaseqnivaientto UhBads-iF-IBa-ISa). Accordingtothe latter,aie obligedtobring¢abontjutincaoehecannotpreventh°nowneanctionin theeventofhiafailmaithoaghitnighthiltocomeaboatloroomeother tea-on. PerhapaBakerwillnotbeaanctionediorfaiiingtobringcbabont andyetBaker'uobligedtobI-ingdiabont. Bakercannotdoanythingto pmenttheaanction,bnthemightgetoatofitaonethehu. Thieetill leavesitthecanethatifacanhimoefleacapefatnreeanctionintheevent thathehibtobrins¢abont,hebnotobligedtodo¢. 8. PRUDENCE AND CONFLICTHVG OBLIGATIONS hAflcoryofJadichawhchimothatthed'sthgni-hingieatmof ametnethicaltheory'nthereiationiteepoueabetweentherightandthe good”. Utilitariantheoriee,ioreacampie,aeaertthatanactionhobligatory jantincueitrenlteinmoregoodthanitaomi-ion. Aawementioned winninPriorbelievedthattbeucaphndtheAnduoonianehnplification waonotnatnral'lticbecauetheneceuityinvoivedintheapplicationof anction'mvolvedthemoralnotionofdeaut,via.,abiorbiddentobfing¢ aboutifandonlyilaonghttoheaanctionedintbeeventthathebringacp about. Theweakeningconaideredinthelaataectionweake-theneceuityof aanctiondefinitiveofobligationandiorbiddance. Andth'nweakeningmight bepreierudbyonewhowantatoavoidPrior’aargnnentacainatthe Batifitinnot,there'netillawayolmainta'nin¢natnraliemwithin theDBCanalye'n. SnppoaeMcClellandrobothebankandthatheienot pnn'nhed for it. It seems that McClelland was morally forbidden to do this i . ‘ I "y r' ‘ ’ L 1‘ ; {I 4‘ bl'u . . H :H I ‘.v,' i, I ..f t .1, ,z» i r“; 1:. ..g‘ "I «Hi “twang; in i|.s 'Q '\.}‘i ”I lrul ‘nwzz" quiz'i ..l 1. . ‘. I., I)! irl.u'l. .gttn‘l (1 e. hi I!" II F loo ‘ l; ‘v! via... r ;l ‘I 1'!“ ...: m'u: 1:1 1:11... in; fr u "'flgJ‘ n: '1'” h: ., I~ .. i ms. nu . I u.- i ”'H; mt tui'.“~ ii! i H‘ 1:. . ‘3'“; " l" ”M " "' ‘ " ’ . r vi'Hii‘Wl .u H II! Jun [’1 ‘1‘ 1.! ' iWi . ‘II n' 1: 'li ' "i" "i {I III .{H’ 'I’Il'hl "Ih i'”. i. ,1 i H! ’ H it I! -l.’ 4 ”r' 3i ‘ ,3 CH' H: i"""71=i - ;‘l'_! «2] '1 li'tuig‘ "a ‘ 1'? i r! 1.7 ' 5' ’ s'il ‘ . . Ii". fix»; 1! \Il \ 1.x. 2' ‘t u 1', “t 1!,‘i'4én w”! .i n? mung. :3 Ho ' 1 H . 3 .m out o .. iHI '; ’l ‘~&Rl ‘I “Hi H: "" 3' ’ Ii 2. .1‘. Nil ‘3 I‘ "fl is -3 $"'a .19 IS In :1 HM! m m. M .I f; w a. i! ...ith ‘l~‘ ’Ql‘."'$il 'X- l ' . :Hl " 'I #s' 1 , » t 1‘3. ill '. "v fund '~‘. r~.'/' ‘ ’3 ‘brt $11 no "iii‘;l“i' MHU 'ri4 Hi ‘il in I 7%.”! Nil " I it" u! ' I i 1..” l'4‘3;i aii 3““ 'igii H? i‘" iii a .1“! mu '1' '9' in H- I. . {11 i! ii “M '-I {I‘H‘iWi T'I’I w I . .. I .1 i» m Hm' wt :. ..5 “mi i "I-vt. Hm - 1. it out M. ii m-m. ‘n‘ri m inn. ..l |.t"'un I: x z- in.» H u .‘ r 57"” nil I'll nu. J! U '1‘ I *r 3 '~‘ H! Luisa/1" v ‘m-I“ i‘ " all I ‘0 band ”I" i 1‘ "I“.I- ’W *‘i-' *. ~.i;‘l:'i't 4' ' "‘ "’ i: ‘ "is m '21:! 'h - ar 1! a: ’1'» 0.! M an“ m ., a"! (i I. N‘ ~I Hm!" 1511; 1'.» vi ... : ":r:. “”1131 1“ ~ ... ... .H K 1" v" "1 *ll' «til 1 H h JH-I '. Ni lb? 2 limit; 53 9hti ‘ilqi - I I it! ‘.. -i pll’ “law. 7 l" ‘r It H]. /.i .i .9 t .i , .1! i ,2_ ‘Hi -‘¢ I ,t'g.’ : . a."_ o v‘ *“ ‘i ' I i I H O; .‘lilv- 110 even though he got away with it. He ought to be punished, even though he is not. If a naturalistic view is behind the escapist metaethical doctrine, one mightsayoneoltwothinp. First,ilone°latheist,onemightmaintain thatGodwillpunhhthisdeedinthenextliIeevenilMcCleflandescapesin th'none,andsoit'nindeedmoraflyiorbiddea,eventhonghitboksasif McClelindescapes. Hewillnotnitimately escape. Kant,iorexample,in thencondCritiqegbecansehewashothendbytheineqaityinvoivedinthe goodandevilconsequeacesevidentinthhlife,argeathatthischcumstance requinsthepostulationofacontinnedliieafterth'lone,andiorsimilar reasonsthereisasnpremebeingwhowillseethatpan‘nhmsntsandiewards commensuratewithobedienceuemeetedont. Thisseemsliheapiausible viewfortheists. Ofcourse,ifthe standaidbywhichGod'appropi-iately" dhcatupenhhmentandnwardbnotnatualisticallyundsrstood,naturalism iaihevenhere. Onthsotherhand,onemighttaketheintnitivelymoredificultmute andsagpstthatoarintuitionsbehindthebeliefthatMcClellandismordly iorbiddentombthebankaremistaken. H'nescapefromsanctionerodeshis moraiforbiddance,sotospsak. ButtheintuitionsaboutMcCielland’sdeed alenotentilelym'lguided. Someoneehe,orsomecollective,oughttohave sanctionendClellandiorhisdeed. McClellanddoesaothavethemoral iorbiddancebecaasesomeoneelsedoesnotkeephisobligationtosanction. Theobligationtosanction,ortheobligationtobringitaboutthat McCleflanddoesnotescapeil’herobsthebaanightbeconsidereda secondorderobiigation. McClellanddoesnothavethefirstorderfobiddance becausesomeoneehedoesnotkeepthesscondorderobligation. hbothdthuepositionthuebconsidenbleintuitiveoflense. The oflense comes when three beliefs are attractive. First, if it is desirable to u ’ s . 9f; .t W!" t' w 1' o M .. in }:-.u- e;t|.;i:l.o~.l I «.v! all I ".1! Mi 1 ’ r: 5' t. Hv. .. 1' 5 s ,1. .fi. m "Hm 41 1H t. rl WW It i J. .30 «'N' iH m . 13' T, .1 . . . 4 ”L1 I: 1mm :3” iron a“! m I'm-m ri~i 1 m. 1 HM: w» : ,. - c ( vi 1 z is m I! I v t :i. r‘ M! .‘Ifi’tmu ..‘w‘z u: at H cu‘ h... tn. «..i" 1 Itil’h “ ‘lurl 31“,] ‘u‘cgtvu: 13' ‘o.,[} i” "1!. igou ut‘ «i! ”j i153,75,.' JJ, H- '\ i-Ol‘ll 'g,| 11’1“;qu 'Ili? Hi io'i‘l uhni v" '1 "Hi 'lr italli um i". l in: . o "I" 0 “”13 l- i? -" vi)‘ 0 it. *‘n-i II I“ a; a -: H 1.: ~ H . it i 2‘,“ L.” I-mr 1 xx .‘Hlu "ml rum; f'i lku ‘1): s, In a .: f. ’ ...; n? - 1.; n n. . :u' ri'i‘ifloti 'Is'lt‘l : z I rm Hg! .3” .‘II M Mr 1.1 .. s; .: r 1.: up .. it ' unit} 3, :44 rd; o'v‘ r;.:l tin IN: ; .1] Hit: 9'1"! rut a lid ...... :|-- .33....- Ii‘ !:.l’ a '3: 3' in: ti 1511; | iv' 41., wzl‘ o ~ Itma t -i i"i§' l-i . N-wq‘HI‘KH ,ivtntlvl d ..H I id"! : 12:! ff! 3 n it Huh: {1 m; a " 1 li a"* H o.- "’ U .1‘ ‘;-«ial ‘li'iIH'uhH ‘Hii .,.,’.‘ 1114:! win [-83 U ‘ in 'H: H" in: z I ...-4. .. J, :euf: } a; Li mil irmgé M an nil-m mm IL. I I w r» n. ‘ r .. w H»: mm Imni 'm .. . ami w mt Mn N: i w-H w i m n n w: ‘ f r loIlIAi. v1 3 u H! n‘: . 1:!1'. Mt we ., :3 .1 u, v' ..,- .‘ :.~.' 'wl'. I s t . it" a u. .z m ‘I‘tin/ 1‘: vi» ..Imt. : My! «n: J“V'!iil‘- " ,1 a .12 . .J u.” ,..,..;, iq . u a ., ..; 1.; 14-. -'»i I I: . n1 um ‘t'l c! I Hi ”Him..-” it (it: ti INA. '4)" r"'\..! 0.'.r ul '1‘“ OR!!! . ¢. .. '- A I ,x' : :5 {.‘ig’ui HI I! -,9' _[ LI ' I In ”I":i . 'Vi I.i "_ . 14-! 4“: mi m M ”th ‘Ilil mwl mi N u 2"” r’“"i' vino . W I ‘ o i“ 17!!!! 'IH ”MI l-n. r"'l'~t' l'ul l I 4-" 5- ¢ :. Ii " '- .1: :1 Hr l;."ll~i ) ‘I '14) f):;.. rir «,1! qui I: g; . 1i - ,~ H4 - ... w: ...: nu ., in Milan ”'4; I “'srsirv‘t 'I ‘H N' .izlut’v n! ‘1 i i-- iilw'i ati '! i' 6: 3 'rfii ’ I ‘tLiirh‘ “ u r“ H “l “rat“? tl lio’. " lll disbelieve that God exists, particularly, a God who interferes in the desires and preferences of humans and has ability to sanction; secondly, if the belief isattractivethatdeathisfinalinthatthereisnolifeafterth'nonein whichtheapparentinequitiesarersolved;udthhdly,ifitisattractiveto believethatthebestsanctioningmachineryallowspeopletogetawaywith doingoromittingtodowhattheyan—relyforbiddenorobligedtodo, then,ucapilnuanaturalisticmetaethicaltheory'nunattractiveindeedu comparedtodeontolog'lm. Itloohstomeasifsomebelievethatpeopleare obligedtoactasifthere'naGodwheaofcouuetheremightnotbeudif obligationistobecountenancedatallwithoatpresupposingtheism, deontologymustbetheonlyoption. Th'nloohstomelikehavingone’scake andeatiagittoo. What about prudential concerns? In Chapter Three, Reecher’s semanticsforpreferencewasintrodaced. There,itwassaggestedthatina sanctioning situation SaH(33)(BsbaAa1¢/¢), vis., a b auctioned just in casesomeonebringsitaboutthatasuflers¢wheiehewouldprefer1¢ In Rescher’sterms,thetruthof¢mustbeafirstorderevilfora. Sentences oftheformM/varetruejustincasethepo-iblemomentsinwhichcbis trnearehigherona’saidologicalscalethanthceeinwhichWistrue. Moreoverthuelocutionsmaybetakenasdeclarationsthatpbfirstorder better for on than is W. In this compu'uon 1mm) must be larger than y(m,a,¢)inorderfor¢tobefirstorderbetterforathanw. Inh'narticleRescherpresentsanothersortofgoodwhichhecalls 'diflerential preference'“. To adapt Rescher’s position for BBC we might add “other function * lunch that *(m#.¢)-r(m.a,¢)-r(m.a, 14>). Intuitively, if 5(m,a,¢)>g(m,a,‘1¢), then at m, a has differential preference for ¢ over mp. New sentences for difl‘erential preference ascriptions of the 1‘ l l l'g . Q]. Q ‘ . l V I ;.\I" l I . l“i l' a; . ‘i ' ‘1 l‘ “ v/“ iiI‘ I l. }‘ «v1 Igtt' ill:' I‘ o."' .. ”I. "vll ill‘Ili‘ lcl“x'-'l'|.' '0‘! ‘l '1: 'l' . N at' I” l . wl lit-"'1 TJ. '.'li~1’. 1 I6 .‘ului 'HH" ir‘hl w“ 5‘ .il ' 2 all "I q. l » 'ltll hi “I ln’lul “N“ . ... . ,y |. 1 .l ”I 'u' ,v p l, ‘. r I I u :1; Hi i H .h 4 In . lb 1 o. l u . “hi I i ? ll .‘H V 1! ‘HI i ‘ in" M ll' 9 all 'l .11.)! ' {'t. ‘vtd '3’ (A ..Il 3: lllrt ' I: i 'II lawlr-iql t vm ful I" m "Tull ' l'w In i. .. . . ..' I rl H I H H ' t " l" I‘ . H" -|. aft!“ j‘il‘; .012.‘ l4.‘I ,... ... ‘.‘1, . l? .h-' Ml 'o , " . . Molt) 'Ill - '. . 'L..(i.,i . 3| “l ~‘,..I;\r; (x9lmiaflpli otherwise it i3 1'. Where *(m.a.¢)=r(m.a.¢)-r(m.a. 1d,). MAMrb/Wllht if *(m,a,¢)>*(m,oz,¢), otherwise it is f. i=O¢H1C11¢. i=SaH(3:)(Ba¢aAa'I¢/¢). =OQ¢HU(fiBa¢"FSG). =FM“D(W"FSO)- i=Pa¢H1Fa¢h measure: it (x)(h)((xehsxeNa,m))+;qsa¢nr-t), otherwise it is f. “mania: if (x)(h)((thsth(a,m))-v:(Ianp])3=-=t), otherwise it is f. Oaths» D( nBa¢+(33)QasaFSz). I!" . . : ' v‘ I' h ' I ' I 'k ’ ‘ I . , ‘. ‘l I; I , .. t‘ I .i‘t I 'i ll ' t . . ; ' p.’.")]litt ' 'l I ~ " I.‘-"l ll l , . . ti "w i I, t ‘ 1. . " ] ‘ 't ; .-'i .- = 1 "i” i ’ ‘ Ill . i" I. ! s t I )1: 1 ' .M. E I . v I ' ' ' .' ‘ ‘. it [v rl‘i' ’ * ‘ .' t l: : . '. I H ’ (‘0 ‘ ‘_ —.1 I ‘., I. . 1" I l on 1 " " ’ ‘ f I V. 1 i.’ ' ‘ w, n. H, v H APPENDIX B THESES AND NONTHESES t= ‘IBQL I=Ba¢4 1(33)B:r1¢ 5% '=B(X¢-"W t= 0M» O¢ t= Elm-r 13¢ l= (Baucha (WM 0 111/) -> ‘IBa'w t=BaD¢H DBa¢ '= (3)1141" HGSM '== (33)G¢"G(33)¢ |= (33)D¢-' UGSM’ '= Amt/we “AON’M = “WM ~= (M/pAAap/WPWN =92— I==Fa'1¢ '= DEM-'0”. Ind l= D ‘IBmfi-rFmb i=Fa_|_ FKI= 0 117801 i=Pa¢-» “loa‘l¢ l= fiBao...an_]_ '= (¢)(’W)((D¢A 30¢) " “(EN/NOVA 0 ‘WABG’WN '= (¢)(( WM 0 WNW) -' ‘(NHU’WABOI‘WD HLHW =BG¢H 30119 5% i=Ba¢-’Ba‘l' '= (WARN) *BOIWM‘W) =Ba(¢*‘W)*(BG¢*BOI’W)- ”Well i=Ba¢-+ eBa-ub l= ‘IBaflba ‘l¢) EQ— |= ‘IBa'r¢ 121 13.1 13.2 13.3 13.4 13.5 13.6 13.7 113.8 13.9 13.10 13.11 13.12 13.13 13.14 12‘). r: eBa-ubv-Ime r=0a¢<~>0mll r= (WAOGW) *OOIWMW 1=00l(‘li"‘l’)“(0011153001110 =M_ 1= Fa¢HFaw l= PM» 0 “IFSa I=Oa¢4 0 nFSa = 101101“ '1¢) i=0a¢+ nOa-Idi i=0a¢+Pa¢ =00!!!“ 030195 t= Fab-r O flBa¢ =00¢nE001¢ t= Fa¢+EFa¢ t= (3:)Oz¢-» (s)Os¢ *= (whit-4317:3111. i=0a¢+ ‘I(3:r)Bs-|Ba¢ '= Fail-r ‘I(3=)B:Ba¢. 1=Poz¢4~> “IOa‘up bé P¢4 UP¢ e orb-:Bwb be ‘IBa_L it (BondivBa'W) —’ Ba(¢V’W) 6* Ba(¢V1l’)"(Ba¢VW) be BaBMi-rBwb 1=(3103le3010160111 .... (30431049 (NW) ¢H(33)¢-»(33)H¢ and 9* C(33)¢-*(3=)G¢ 9* 0(33)¢*(33) 51¢ is...“— 4W séOaOmp-eOaa'i M_ FadwFoM eeyap 123 st Hallo... 16.35" Bad), be Baflo...fln¢-r ‘Ime. be Barb-r 'IBaflo...fln¢ .... Bamv 'ub) ES; he 8044:1111!) -* (WABG’WL ¢0al¢h1lil *(WAOGW #00131»! 'Mb) 5%; herb-rOa-IOa-ub héOGIb-rOGOwIi he nOa-ub-rOa‘IOa-ub I?" Fal‘bh‘l’) *(FOHIM F0110) #4:an 1¢) 5%.; he (waa FG‘W) -> Fama'W) ... Fae->19) -> (Fawmm stop-v Fa-IFa-up st Forth-rFaFadi st ‘IFa‘I¢-’FG‘IFG'I¢ APPENDIX C PROOFS AND COUNTERMODELS Several notational conventions simplify the proofs and countermodeb. Let (Xialldlllg‘t abbreviate (x)(h)((xehAXEIIm.a))*tflollht). Let (x)fit[¢D§=t abbreviate (x)(h)((x E h ax E (y:Ry,m} ax ¢I(m,a))-r:(1¢113 - t). Let (Monongsi abbreviate (k)(31)((x€hax€flm,a))agfldijnxst). And let (3105111ng =t abbreviate (3x) (3h)((x E h ax E {yzRy,m} ax £flm,a)) agfllbllxs t). The same conventions apply where t '3 replaced with f. REa BQHfl l= BailiHBmII. Proof. Suppose t=¢H’W. If RE, does not hold then for some interpretation If there is an m and h such that either (i) gums nBaWDIst or (ii) hU‘WAmWD‘3L If (i) i! the case “MI “MIND!“ “4 (X)ECI¢DI=7- But since =4,qu by assumption. (XMIWl-t and (Xth‘lIDI-f as well. and it follows from th'n that if (i) 'l the case then :(IBwWIF-t. But this contradicts i). The situation is similar in case (ii) is true, QED. RM. EL mesons. Suppose ¢"’W is (paq)-’p, which is a thesis. Further, suppose (x)a[[(paq)])3=t and (x)&[I(paq)D‘-f. By truth conditions 9.12 it follows that g,(I(BosIJ]]3=t. Since (x)a([(paq)1]1=t, (x)a[[pI]3=t as well by truth function. But if (3x)E(IpD‘-—-t, which is not incompatible with 124 i ' ' i p s i I {If I' i I l / 11 v‘ (' II I 3' i i 0‘ '. lisi | ’- i i . l., ..l' D 1 . "' v 'I. ' '1 I ‘ ,‘ t i ‘\ ", oA ' v" ‘ 7A.. l t 0‘. ~i-i “i ' ’ .H . >3 w : gf' . A. . i . ' l . l :1 it'll ' i ‘ i' ' 0‘ t ‘ "' l i ‘1'. i ‘ 3 '1" ' "’ ' H ¢ . . 'a' n t- .1 ' "’ ' it ' t;. . . :H H ' ‘ " ' l - . i .I . I -- ”hi .3" ' i , Hi: i .' l ‘ l i i” ‘1 V 'l‘.‘~ ‘ l .9 v . o 3 , ' i 'i‘ n .1 . at I i i I: 1‘25 (x)fi[[(paq)])3=f above, it follows from conditions 9.12 that gflBa¢D3=fi 21 is a countermodel, QED. (31‘ = (WABG'W)"BQ(¢A’W). Proof. Suppose “Bum 3010)]th. By truth function it follows that {.[IBath‘xt and gflBmI/m‘at. From the former by conditions 9.12 it follows that (x)a(I¢D‘-=t and (x)?i[I¢Il3=f and from the latter that (Klatl’WB"* "Id (X)5‘I¢D‘=f- Th5! MN “I“ (x)atI(¢W)D‘=t "Id (x)flfl(¢AW)D‘-f and from th'n by conditions 9.12 it Ms that fulIBa(¢A‘W)B’=t '9 W011, QED- M. whom-«ammo. Prod Suppose tint (x)alI(¢W)Il"-t and (XWI(¢W)B"-f guaranteeing the truth of the antecedent “Emmy/)1)! Suppose that (3x)(fi(I¢D‘=tAE(IV/D'=f). This makes gamut-f. From th'n it follows that {MWABQMD‘BF which makes 3 a countermodel, QED. K. =Ba(¢->w->(Ba¢-»Baw. Intheprooftherearetwocasestoconsider. i) First,assumethat flm.a)¢A- 1f :flBa(¢-W)D‘=t then (XWM'WD‘I'R But if so (xfiflcbn‘s t by truth function and it followe from th’n by conditions 9.12 am amntsf. summing that the eon-squat oi K. :uw»mn* is true thus ruling out a countermodel in the first case. ii) But, second, assume that I(m,a) = A. In this event, the truth of the antecedent of K“, .0 126 gIIBa(¢-Ml/)D3=t, guarantees that (x)fi[[¢->¢Dx=f by conditions 9.12. A countermodel in this second case requires gflBa¢D1=t and from this it follows by 9.12 that (x)fifl¢]]3=f. But if so, (x)(‘xfldi-vwn1st which is impossible. Q.E.D. 13.8 at ((32)Ba¢-+ BaCle. Suppose that gfl(33)Ba¢Il'=lt. By condition 9.13, it followa that gum/5118:: for some fi-variant 3 of It. If so, (x)(xflcpslflDU-t and (XWUMKD”=V I-lld hence (Xlaflatlflls't- But “PM ChlaflW/ 311““ for some fi-variant E of 2‘. It follows that 1(x)E[IBa(33)¢Il'-f and hence hflBa(3¢)¢D3=f making 2‘ 3 WWW QED- RE0 0==QH1 n=Oa¢HOaVA PM 53PM “I“ '=¢""'W "Id hflWBht- By D"), hfl0(fiBG¢*FSOl)D"* also. Hence, i) (x)(h)(RLm-rgfl'Ime-rFSallxa-et). Assume um A={x:Rx,mA§flfiBa¢D3-f} and that B={x:Rx,mA:[IFSa]]3=t}. Since BtfiH‘W it followe from RE‘ that (x)(h)(xEA-bgflfiBaWIflzf) and thus by truth function that (x)(h)(xeA-rgfl-IBa'w-rFSaD‘at). It abo follows that (x)(h)(xEB-rgflfiBa'w-vFSaD‘st). Because of the truth conditions for coaditiouab together with i), AUBcmeLm} and hence (x)(h)(xe{szngl-rgflfiBa'w-rFSaD3-t). This makes %UD(WB¢I‘W"FSG)DI true so that {HOMD'Bt only if gflOa‘WD‘Bt. By replacing ‘W with ¢, the same procedure as that followed above shows that “own!“ only if fallMDht, QED. “tr '1 i‘l' ‘1‘: l Ht I .; t. 1 ." I ’i; E. .J I it Hi 1" v. 127 0. =(0a¢.0aw)->0a(¢w). Proof. Suppose not. Then ,‘JIOMAOG‘WD38t and “Camry/mud for someX,handm. FromthefabehoodofthelatteritfollowsfrcmeO that gflD(-iBa(¢Av/)->FSaB3-=f. Hence, (3t)(RX,IIIA§fl'IBQ(¢AW)DthA:flFSGDxBn. If :[I-IBGMA'W) then by truth function and 0. either :tI-imeD3-t or :[I-IBawn‘st and hence either i) gawwamnrst or ii) gawmai‘SaDI-t. If i) is true then gIIOaIbD‘sf, contradicting the assumption that gflOwaOa'WB‘It. But if ii) is true then mownhf contradicting the same assumption, QED. M. ammo-«0mm» Proof. SupposethatinXthereareonlythreepossiblemomentsrelativeto m, m, m’, and m". And further assume there are but three histories in 2‘ distinguished by containing three moments, meh, m'Eh' and m"€h”. At moment m, gamer. uFSallxat, at moment m', fiflmfiafimFSallxst and at moment m", 2.414“ WWAFSall‘I-t. The action assignments at the three moments is as follows: flm,a)-{m), flm',a)-{m',m"} and flm",a)-{m',m"}. The antecedent of Mo must be true in this situation since at m, gtIBaMA'yl/m‘st, which makes the antecedent of Mo fake. At m', 'gflFSall‘st and at m", guflFSaD‘st making the consequent of Mo true at both moments. Thus, gfl0(1Ba(¢A¢)*FSa)D!-t from which hIIOaMMWD’fl folio". 30*. M‘WB‘“ Ind HIFSGD’I? mtkins gIIDthp-eFStxmsi'. From “in it followa that {[[Oadilflaf from which the falsehood of the consequent of Mo followm QED. ‘ J‘ ‘1: 9 . z . '1 .1; 1 ; .. 1.“. t ‘14 l.‘ t. i o ‘ 1 -"' ‘ illl ' i . 0‘, .s i o' ti ii I- H. . a , .t_ .3; m' : mm: t4" nt‘. t : lit‘i ' . H 1‘ i ' I t-9 '1: 'Il‘ It ~H. It ‘! "io'n t‘ ,i lot I Ill, '4' OA . t H. m: .l l: .. .a . . .l« .' crs‘ 1m; . u' 11.;- .‘ h .-r lu . a. ' ~ -t I. Hi i ,1 u i, ’i"t’l -* ‘t t Ilatfl ch -‘ I .t t— " . i‘ ‘ i‘nll ‘ H ,. ' . .- , ... ' c‘ t . i'I'n u‘ .I .' .H .1 . 4. “i t 5 . l‘r - I 1 n. ’_l " 1' ‘ q. l I. i 1: it ‘1 ' ,1. '3. b ,. ' , "llc, o ; ' l.) ., ' I . ' v'l'i“ ’v' «' la‘i - 'i . ' i l ....“l! ,: it o_ '1. t 1'. l,‘ A .1}? 5,. ' ' 13" 3 ' u. - u ;:,.' f... if [it ‘A . . f. : . , _\ '11 1M: rffl.. . . .. H use. :1 i n '1 r i; ,, ,, /t 128 o =00t(¢-"W) *(W*W)- Proof. Supposing U at m and h 'n a countermodel for K0, it must be the M ““3 HIOMW’WBI't, hflMth‘ “Id tailo‘l'blllx'f- In order for 9. 00¢me there must be some n and 11', such that Rn,m and ‘;(IBa'¥/I)3=f and I",(I-IFSaIF-d. There are two cases to consider in the falsehood of IfiJIBtrM)‘. i) It might be that (EMafl-nplflat. In order to maintain the truth of :[IOaIbD‘ of thesis K0, it must be the case that .tIBaell‘fl “110° ‘LU‘FSGDI‘L and ““3 (”Quaint lid (lel‘flfl'f- Bu 00, ‘LUBG(¢*‘W)D3=f since at the X “Ch “I“ "",ll"‘Wll"t "Id ‘le¢ll!=*, and since fifl'IFSall‘at, gflOa(¢->‘W)]]x=f contrary to the assumption. ii) it might be that (3):)EU'WD‘IIt. But if so,,([Ba(¢-’w)])‘ will be fake as well and since l-‘nfl‘wFSaB3=t, momwwnt will be fake as well, again contradicting the assumption, QED. The following proofs show relations between diflerent interpretations of DBC as depicted in Figure 8. {LC}->{OE}. Proof. lfxatmandhisacountermodehthenforsomeagenta, gflo ‘IFSthSF. Hence, {.[IDFSallI-t. But since l-B'1(¢A1¢), FB‘IBG(¢A 111)) since (¢A‘l¢) must be true at the moment ofevaluation in order for a sentence of the form Ba(¢a '1¢) to be true there, and th is imponlble. Hence, gflBaMA 1¢)I)3-t and th'n makes gflEKfiBama u¢)-’FSaI)‘=t which by definition is equivalent to ”[0“ch '1¢)I). But this makes the thes'n of LC interpretations false. A countermodel is impossible, QED. H l! - i t h l". l '- .1 H ..;1. , ..3 , . g. .1: l lrtc‘l l ”a... i i . 1, l ' .. a. .. t (a! .. is i " z .7 I ' .; ' 1 -im m-. .. .. u": . A — r ‘._ .l' .“y ‘ lhi l‘Hfi l i . g , . v ’lr\! ‘—‘ ' b l g. t l I H u“ w ! l."' l l I ' " ei'l " . i e. 1' I: ‘ 1 ' i . ‘Qg.‘ t. ‘-i" . ' l v. i ‘ I. c .a , [J 3 : iflf'i'oi‘t'l ‘. f H l e j l‘ s I'I}‘ ' l ' ‘l l . vi :,' '. l- 1. ‘ ‘ l"t ! / 1 lit, 1 u l! 'i ."i 129 {OE}-{LC}. If not then i) Homo. -1¢)D3=t for some 2!, h, m, and ,0. Since ‘IBG(¢A 10b), gflDFSflllxxt as well. But if I=Oa¢+UuFSa, then by i) and MP, .510 1WflD3-L This is impossible, QED. {FE}->{LC}. Proof. Since I=-IBa(¢A mp), so is Fatwa mp). If Fa¢+<>-:FSa, then it follows that = OFSa. But if so, = ‘10G(¢A mp), QED. {OCP‘lLC}. Proof. Suppose not. Then there is some 2‘, m, and h such that “Gama ~1¢)])38t, vis., gflDhBaMA u¢)->FSa)])‘-t. But B'lBa(¢A 14)) and so for every x such that Rx,m, gamut-h The thesis of 00, Oath» flOa-Mb, requires then that 5:10am. ‘l¢)-"10a‘l(¢A‘l¢)DxSt and since the antecedent is true, i) {[I-IOa-IWM fi¢)1)‘ must be true as well. It follows from this by thes'u DfO that gfl-ID(-nBa-i(¢A-1¢)->F8a)l)3=t. Since it has already been shown that :flFSaD‘lt for every x such that Rx,m, gum-Bang»; w¢)->FSa)DIst, vis., max-um; mm]! But this contradicts i), QED. {LC} *{OC}. Proof. If not then gflOmbAOa-Idmzst for some I, m, h and a. I'lilk it'i Alol' HHI‘ Hui 1.. 130 t=Ba¢v-IBa¢ by truth function. And for all x such that Rx,m, and :[IBa¢D3=t thesis D. requires that, :[IfiBomquxst as well. But since {(IOa-ubD3=t, :[IFSaIFat also. But, for all y such that Ry,m and :flflmeI)‘=t the assumed gflOalbD‘st require that, :[IFSanat also. But since {szs=xvs=y}={x’:Rx’,m}, gflDFSaIFIt. Because t=-1Ba(dn\ 'I¢), HIUP'BOIMA ‘|¢)*F‘30)D‘=t “Id “In! by DD. hflanM ‘1¢)Il’=t. contradicting the thesis for LG, QED. {OK}-b{LC). Suppose t==Oa¢-'0Ba¢. If tat-10a; then gflflthL-rFSbIF‘Bt for some 3, m, h, and b, viz, gflOcLLDxat. But it follOtVs from the OK thesis and MP that gfloBinist. But this is impossible since =18a_|_, QED. {DC)-{LC). Suppose that gflOaJJW-st for some 2‘, m, h, and a. It follows from r=0a¢+Pa¢ that gflPaLB‘ct, vim, gII-IFalll‘st. According to DfF, i) ,‘,,[I<>(Ba_L-’FSaD3=f. But since BuBaL, :lIBaL-tFSaD-zt for every x such that Rx,m and hence {[[O(Ba(¢r1¢)-vFSaI)at which contradicts i), QED. il- . l l 'l t I l-il .‘ 1‘ huht 1 g, in lvl’ 0 :” . l I . ,1} I Ht 'd‘ (”H l l ‘I ‘ t . 1 3' ml 9. p. l I, i l f 1 1 l '.“.l: ‘l I 1 't II. ‘ t, :1! ' . l " 3 1‘ : . '5 ’ 131 12.11 r= Audi/10+ “IAa‘W/¢. Proof. Suppose not. Then gflAatb/wnx=t and gflAa’W/¢D3=f for some 2‘, m, and h. From the former it follows that g(m,a,¢)>g(m,a,¢) and from the latter that the denial of this is true, which is impossible, QED. 12-13 '=(Aa¢/’WAG’WP)"AG¢/P. Proof. Suppose gum/enlist and gflAa'W/pn1at which makes the antecedent of 12.13 true. It follows that 9(m,a,¢)>s(m,a,'W) and thus that y(m,a,1p)>g(m,a,p). This makes it impossible that gflAmb/plflsf, QED. 'll "Whhhhhh