‘ r xii < r 4 r r? . , ‘vv/pe: . E , a ‘ «l. E131... :1) E , . k .f x .C , Q..- TWO YEARS 60c PER YEAH YRS. ? TERMS léms of ion Work to Stud; Prob 25 d and: gan W ne 0 N 8, 2 H .C R A M Have We Benefitted From Extens An Independent . 4 -Wheat From Chaff—Commi ee .m .m M .m .d e .H d E as e m Z a g ,m N m m F SATURDAY, THREE or A KIND THAT’S HARD TO BEAT t - Fll‘ A Threshes F arm ' mice we I Legislat Electrié 5?? 1.5 , No. XII In isSue' VOL crowns; i g a FEW . ransom :beasi grey- ant Hotel. Flint, Woman, Wed- nesday, March 18, to discuss the bean grading situation bnought about by the'ifiederal Bureau of Economics which has established federal grad- ing of many staple articles of food with great success. Among cout- mading successful federal grading -mfieets that have .been recently no- ‘ fleet! is American grown cotton. The . adoption by English manufacturers .0! the U. '8. federal grades means that. American cotton is being sold on the foreign mills under the grad- ing at American cotton growers. ~ The other outstanding commodi- ‘ m- inder federal grading are corn, ' grain, peanuts, hay, included with . probably twenty—five other staples. Under the" chairmanship of J. H. Brown of Byron this meeting con- sidered the present situation. At present a telegram is registered be- fore Mr. Wheeler of "the Bureau of Economics, Washington, signed “Michigan Bean Growers Associa- tion“ which states that because of the present satisfactory grading con— ditions here in Michigan that the bean growers of Michigan are against the introduction of federal grades. Mr. Wheeler of the U. S. Bureau of Economics has granted a hearing to the bean interests of Michigan, same to be heard in Lansing on April 24th. The bean growers of Michigan, .' stifling ers of Michigan met at who nd:- 11an have admed‘fibidmgg large W of smafler‘ meetings; in the 30,000 to 40,0010 'bean mwers my base a voice in the matter. Any meeting of Farmers’ Unions, Faun Emma, winners. cooperative organizations, etc, may obtain all available information re- garding the details upon application to the temporary headquarters of the Michigan Bean Growers Association, corner Fort and Brush Sta, Detroit, Mich. Bean growers and others who understand the situation in de- 'tai.l will .be furnished for'fthese meetings upon request to the head- quarters. It was apparent that the bean groWers of Michigan should be on, the alert to see that their interests are fairly represented. The conduct of the :Sa-gzinam Bean - Growers meeting was severely «criti- ci'zed by some members presented. This meeting consist-ed of about fifty growers and a number of Michigan bean jobbers who urged strongly the sending of a telegram to Washington protesting against the establishment of federal grades or any interference to grading of beans as being handled at present. Michigan bean jobbers urged strongly that the costs to the Michigan bean growers would, be in— creased into hundreds of thousands or more annually. It appears that order that . rummage question... . j' 1% had 13m ‘ I _, " j? fore and cousin have been «easily understood as the Michigan Bean Hobbes! association grades. It. was explained thatrbecause the federal authorities had graded a large num— ber of cafloa'ds of heans under a dif- fenent gmde and , name than .had been used in the marketing of these carloads that it” would mean enorm- ous losses :to the growers. ‘These 'jo‘b‘bers offered no evidence to show why the some customers would not have accepted the carloads of beans because they‘ were diflerently named. It also seemed strange to the grewers at Flint that the’jobbers should be so solicitous of their interests at the esent .time by going so far as to and representatives or committees to‘California, Colorado, Washington, D. 20.. ;etc., with the mission of ob— etnueting the establishment of ted- eral grading on tbeans. "Stranger still it seemed, that the Detroit Free Press should have quot- ed Clark L. Brody, member. of the State Board of Agriculture and Man- ager of the Michigan State Farm Bu- reau in part as follows: “The establishment of .the federal ‘grades would cause Michigan 'bean growers a heavy annual loss." Mr. Brady, when interviewed stat— ed that he had not given out any such statement and strenuously de- . —:s Fundamental V Transportation Into the vast and complicated network of Transportation in igan have been knit greatness,y types of canines. Yet it is noteworthy that each of these accessory service of Mictfiganil 24 Electric railroads get their power ham coal. bring it to deem. roads bring it from far-away me, the masonic!- forthcpavedhifiwaysmwhidnmfimvehifism .Not even ships are dim Thdrwalmmg This“ 183?}? t the SAC I .4- 111: jug . 5-.-- -r..- . ’ pointment to him. ? stops. : day will ,he spent in Jackson. { remainder of the itinerary follows: April 88,, Concord and 'Tekonsha with E an evening stop in Union City; April f ‘9, Cation and Conterville; April 10, j 'Schoolcrart and Constantine; ; 1.8, Bronson; April 210., Quincy and aman ... .. ,s‘ we have . Metal: flnd’fiiast mm, 18’s the purchasers of Michigan beans in- cluding the bean manners, hean brok- ers and Wholesale grocers. .During the past nee m trementatives of these mm We met the Mining“ wean Iowan in Mention and negatith a ntrenuous idemp- , r prose] er the irresponsible. m of , Michigan been shippers. Likewise it is seriously qnestioned by Mischi- Mfled neat dad-rm diswsmctlon' mung ; ” gen been growers whether habitual - bean market manime :do not .keep the bum made in so much uncertainty that they purchase from other bean mowing sections because i of more staple market conditions; For example, where there were shipped from the two cities of Bil- lings, Montana, and Twin Falls, Ida- ho, not to exceed a dozen carloads " of, Great Northern beams in 1919, in 1924 there were said to have been shipped from these two cities a total of 1200 carloads of Great Northerns at generally higher prices than Mich- igan beans were commanding. At the same time can-hers who “know beans” will not buy these western beans for canning purposes at any price when Michigan beans are available. Ex-Banking Commissioner of Michigan Frank W. Merrick had or- dered a bag of the Montana Great Northerns shipped direct to his home. His wife can cook beans. He ,stated that the Michigan bean has a far superior flavor to the Montana bean. ‘ Mr. Merrick, who is the custodian . .of the advertising fund :being collect- ed by the Michigan Bean Jobbers Association states that the amount collected has been a serious disap— He advised the bean growers of Michigan that the bean industry is their greatest “gold mine" and that they should take the , advertising campaign into their own ’ ‘ hauds.——-—-R. V. Judson. SOILS FERTILITY TRAIN . ICHIGAN’S first soils fertility ' train to :be operated jointly by the Michigan Agricultural Col- : loge and the Michigan Central rail- ; road will start from Grass Lake in , A half j day will be spent at most of the The afternoon of the first , Jackson county on April 7. The :Cassozpolis and Jones; April 11, Niles; April 18., mines Gains and Do- wagiac; April 14., Decatur and Gales- :bu-rg and April 16, Marshall and Menace; April 17, April Goldwater; April Eaton Rapids. A soils laboratory will be part of the sentiment soil tests will be made at each stop to ascertain the amount «of nitrogen, potash, phos- md dime mount in the vari- 21, Albion and our; samples submitted by farmers ‘ mm when home at each stop. specialists ‘ Dr. ' M. M. McOool, head at M. A. C. soils j -' .' ’lewmlbeoneot_ W the many new IN :mx STATES 1m rim exchange against live poultry in «e!th shine December 12, has beenifltedinmstates, it was f announced by the department of farms and markets March 13. Ship- ‘ ments will ibe accepted from Missouri, 1‘ Nebraska, Dakota, South Da- - kota, Connecticut “and Wisconsin, but - the prohibition remains on Iowa, Illi- . nois, Indiana, Pennsylvania, New J or- ; soy and Ohio. at poultry deem declared to be i m moms am HIGH ICHIGAN'S exports a: Canned, milk and cream .rank eleventh among the state's exports, the department .of commarce ‘ Detroit ' , branch announced‘recsntly, :a dwere , prevalent in the 12 states was re- ‘ E, sponsible the embargo. ' 1| Nr'm’.’ “4..an ..,.. m... And...” \ " d . sumac ‘f NW I The Only Farrri Magazine Owned and Edited in Michigan SATURDAY, MARCH 28, 1925 Entered as 2nd. class matter, A it Mt. Clemens. Mich. under not ' 3’s, 3%: Legislative Mill Threshes Wheat From Chaif About 650 Bills Introduced to Date and They Continue to Come in Steady Stream By STANLEY M. POWELL (Lansing Correspondent of The Businoss Farmer.) HAVE sometimes ' wondered whether or not, if the Legislature were: in session the year around, there would ever be any let up in the number of new hills which would make their appearance. After two and a half months of the present session there are just as many new proposals being dropped into the leg- islative hopper each. day in the House and Senate as there were in the open- ing days of the session. A total of about 650. measures have been introduced thus far, 01? course, these later bills have very little opportunity of passing as the legislators are already confused with the multiplicity of'other bills before them for consideration. The legis- lative mill is now threshing out the wheat from the chaff at top speed. In the House it is not unusual for more than a hundred bills to be on the calendar for consideration in the Committee of the Whole or on third reading in a single day. Scores of these measures are appropriation re- quests totaling millions of dollars, and are passed apparently without consideration and often with merely a motion from some member that “the aflirm-ative roll-call is attached.” Only the careful wprk of the various committees makes such procedure safo as possible. The Senate spends little time in debate and manages to keep its cal— endar shorter. Thus far only one issue of headline importance has cometo a final vote in the Senate. The exception was in the case of the reapportionment bill to give Wayne county additional representation in the Senate. After-killing attempts to grant Wayne county eight or ten seats, the Senate finally passed by a vote of 18‘ 12 a bill to grant Wayne 7 seats instead of the 5 which they now have. In the debate on this bill; Wayne members talked eloquently about up- holding the constitution, but Senator Chas. Herrick of Fenwick reminded them that Detroit did not set a. very good example in upholding the con- Committee to Study Problem 0 the farmers of Michigan want electric service'in. their homes and on their farms? They do, and what is more they are going to have it. That question and the answer is the real reason for the conference on rural electrification held at the Michigan Agricultural College at East Lansing, Friday, March 20. Farmers all over the country are more and. more demanding electric service. The electric service com- panies, on the other hand, have been slow- to meet this demand because of the problems involved in taking electric pOWer to the farms. The satisfactory solution of these prob- lems requires the closest coopera- tion between the farm users of elec- tricity and the utilities companies furnishing it;,this cooperation con— sists largely in a correct understand- ing by both interests of the particu- lar problems confronting each. In order to investigate and study the many problems involved in mak- ing' electric service available to ram; ere, about two. years ago was organ- ‘ized‘ the Committee on the Relation ‘ of Electricity ‘ to . Agriculture. This committee is made up of represent- sttvoat‘trom thematic“ Farm Bu- If’ou non, National Electric on, . Americas Shet- '- ‘ p, Q , Com-m . .f stitution when it came to enforcing the Eighteenth Amendment. The Detroit members freely admitted that they wanted more Senators so that ‘in any future constitutional conven- tion, they would have increased rep- resentation and have more voice when» the State’s taxation policy was being formulated. This is just what the rural members feared. The House Committee on Appor- tionment is struggling with Repre~ sentative Chas. Culver’s bill which would give Wayne county twenty- five reprseentatives instead of four- teen.’ If they report out that bill or the bill passed by the Senate there \ will be a merry fight on the floor of the House. ‘ Road Program Completed Almost all of the important high- way législation has now been _en- acted. Both the Ming and Atwood bills have been sent to the Governor for his approval. The Ming bill pro~ vides that after January 1, 1926, the state will defray the entire cost of construction and maintenance of trunk line highways. The Atwood bill authorizes .the State Highway Commissioner and State Administra— tive Board to lay out 500 miles of additional trunk line mileage accord— ing to the routes which they shall designate. Recognizing the necessity of doing something to prevent the growing menaceof grade crossing automobile accidents in Michigan, the Legisla- ture finally adopted the Richardson bill which would authorize the State Public Utilities Commission to desig- nate especially dangerous railroad crossings and to require the railroads to erect standard stop signs at such crossings. Drivers will be required to bring their vehicles to a complete stop at .all crossings so marked. The Richardson bill is a substitute for three or four much more drastic pro- posals introduced earlier in the ses- sion. - departments of agriculture, com- merce and the interior. In view of the fact that conditions vary in-dif— ferent states, this national commit— tee is encouraging and assisting the various states to organize state com- mittees to undertake a study of their peculiar conditions and require- ments. ' Fifteen states have already organ- ized and investigations are under way. These state projects working in conjunction with the mational committee have served as a balance wheel in rural electrification devel— opment. The movement has a tend— ency to check over-development or unwise development in the applica— tion of electricity to agriculture. The purpose of the conference called at M. A. C. was to consider the desirability of organizing the Michigan Committee on the Relation of Electricity to Agriculture. The meeting was called to order by G. W. Bissell, dean of engineering at the college, who explained the ob- jects of the conference. Hon. Sherman T. Handy, chairman otfithe Michigan Public Utilities Com— mission, one of the principal speak— on ater commune, told what the Commission is doing to help rural districts get electric _service. The ban. ‘ exceptionally aspect t themed : trificat‘lonj forltflchtgan, it was. de- x. One of the most knotty problems with which the House is wrestling is concerning the serious pollution of Michigan streams and rivers through the dumping of sewage and industrial wastes into them. Charg— ed by Governor Groesbeck in his bi- ennial message with the duty of en— acting some sort of constructive leg- islation on this subject, the House is giving serious consideration to the bill sponsored by Representative Smedley of Grand Rapids which would place the authority for in- vestigating and determining instan— ces where pollution becomes a nuis- ance and requiring municipalities and companies responsible for the pollution to make other arrange— ments for their waste. Senate Passes Bohn Bill Realizing that the present system of distributing the primary school interest fund is not insuring equality of educational opportunity for Mich- igan boys and girls, but being un- willing to go the limit and adopt such a plan as the Meggison bill or the Escanaba plan which was before the Legislature two years‘ ago, the Senate has adopted the Bohn bill by a 25 to 3 vote. Under the terms of this proposal 95 per cent of the pri- mary school fund would be distrib- uted as at present, while the remain- der would be apportioned among the poorer districts in accordance with a carefully outlined method. As usual, all tax reform bills have experienced very intense opposition and their progress has been slow. A case in point is in regard to bills pro- posing to end the tax exempt bond evil in Michigan and to place an— nual specific taxes on such foreign and domestic securities. These bills have the approval of the Senate and House Committees on Taxation and of the Administration, but they have met severe opposition from the Mich- igan. Manufacturers’ Association, the Michigan League of Municipalities and possibilities of electric power on the farm. On invitation of those interested in organizing the Michigan com- mittee, Dr. E. A. White, director of the National Committee on the Re— lation of Electrictiy to Agriculture. addressed the conference on the gen— eral problem of furnishing electric service to the farmer, relating the experience of other states in organ— izing for a study of rural electrifica— tion. Dr. R. S. Shaw. dean of agricul- ture at M. A. C., addressed the con— ference briefly, expressing great sat— isfaction that an organized effort was'being made to get satisfactory service for the farmer. Dean Shaw maintains that the farmer is bound to have electric service, and that if he was living on his own farm, he would make every effort to get it. In his opinion the accomplishment of greatest importance that can re- sult from giving electric service to the farmer is the improvement in working and living conditions in the farm home. ‘ The afternoon session of the con- ference was presided over by R. H. Musselman, professor of agricultural engineering at the M. A. 0. He ex- plained to the conference that in organizing a committee on rural elem and the Investment Bankers' Asso- ciation. The original bills provided for levies of five mills on foreign bonds and three mills on domestic bonds but they now have to stand at three and two mills respectively. Have a New Name for M. A. (3".. Feeling that is was almost hope- less to get any change in the name of the Michigan Agricultural College through the House of RepreSenta- through the House of Representa- tives at the present time, the advo— cates of such a change have trans- ferred their attack to the Senate. Thursday afternoon. March 19, Sen— ator Norman ll. Horton of Fruit Ridge, an M. A. (‘. graduate, intro— duced a bill in the Senate proposing to call the East Lansing institution the Michigan State College of Agri- culture and Applied Science. The next morning this bill was reported favorably by the committee, and now awaits general consideration in the Senate where it is prophesied that it will be passed by a safe majority. Makers and sellers of livestock tonics, condition powders, etc., will find little consolation in a bill intro— duced by Senator Frank L. Young of Lansing to require the licensing and registration of such dealers and to provide for labeling. inspection and analyses of such products. Remedies coming under the provisions of this bill would have to be sold on the basis of a definite guarantee as to ingredients and in printing any anal— Isis, the English rather than the Latin terms would be required. In order to properly control manufac— turers and dealers in such remedies. they would be subject to license and stiff penalties to violating any of the provisions of the bill. Senator Burney Brower of Jackson has introduced a bill providing an appropriation of $75,000 for the Michigan State Fair at Detroit for each of the next two years. Out of this amount $25,000 would go for maintence and operating expenses and $50,000 for premiums anually during the coming two years. 5 of Bringing Electric Service to Farmers By RAYMOND OLNEY- sirable to call in experts on the sub— ject in order to get the benefit of what other states are doing along this line. He introduced Prof. E. A. Stewart of the University of Minna sota who is the director of the Red Wing project in Minnesota, the first project on rural electrification to be started in the country. Prof. Stew— art related some very interesting ex— periences with the experimental work that is being done in that state. The Red Wing project has been a real benefit to both the farm consumers and utilities companies furnishing the power. l’rot. F. D. Paine, of the Iowa State College, related in consider— able detail the story of what Iowa is doing to encourage rural electri— fication development along sound engineering and economic lines. Eugene Holcomb of the Consum- ers Power Company discussed the subject of cooperation by the public utilities companies. I The general discussion toward the ’ close of the meeting indicated that genuine enthusiasm prevailed for organization in Michigan with M. A. C. taking the lead in the organisation and direction of the movement. Judging from the sentiment that prevailed Michigan is definitely com- 7 mitted to undertaking a program that will result in putting rural elec- trification state on a sound basis. in - develbpmpnt in this” OOKING backward and summing up their accomplishments during ; their ten years of service to Michigan farmers, extension direc- ' turn in dollars and cents to the state has abundantly justified the appro- ‘priation of money they required and the wisdom of the Congress which in 1914 passed the Smith-Lever act has been confirmed. , The Smith-Lever act provided stat- , ed sums to be given by the federal government for agricultural exten- :sion work‘in states where the state “ legislatures appropriated a like ;.amount. In 'Michigan the sum i Ta’amounted to $15,000. To this the Estate added $15,000 and the exten— V sion work really began its era of ex— j’tpension here in 1915. Each year the sum was increased until now the to- tal from federal and state sources amounts to $300,000 which is the limit set by the act. Ten years have passed and the ex- ment to recount the results of their labor. Reviewing Benefits First it is pointed out that in 1915 the population of the state was di- vided with 60 per cent of the resi— dents on the farm and 40 per cent iii the cities. This percentage now has been exactly reversed yet, as is shown by the annual crop reports for Michigan, agricultural production in ‘ the state has been greatly increased. Part of this increase has been at— tributed to improved and wider use of labor saving machinery, and part to improved methods of farming, some of which have been learned from epxerience, part from agricul— tural schools but most from exten— the farmers and taught them how to increase crops, decrease losses of an— ipials from disease, and how to in— crease the productivity of their lands. - H. C. Rather, extension specialist "in farm crops at the M. A. C. in a re- port on the activities of his depart-' ment says, “The story of ten years of extension activities in Michigan insofar as farm crops are concerned . is one of the development of two “main projects———the promotion of the Widespread use of pure seed of the -most dependable varieties and the education of Michigan agriculturists 'ato a greater use of legumes. ' “These two lines of endeavor jus— tify themselves because they are fun— :“damental to a successful and profita— ‘ ble agriculture. In legumes we have the cheapest source of soil fertility " and the most economical roughage ‘for livestock, while the quality of seed is the very foundation of a healthy and vigorous plant life.” Mr. Rather goes on to say that during the last ten years the ex- periment station at the college has » If You Want to ISEASED, degenerate, runout seed potatoes never did produce high yields of high quality pota— toes and they never will. High yields and high quality are essential for the successful production and “marketing of' the potato crop. With low yields, 'the cost of production per bushel is prohibitive and poor quality potatoes are a drug on any market. Disease free, vigorous, selected ’ seed is the kind to plant for better .x'yields and better quality. Michigan Vicertified-seed potatoes are practically "free from serious disease, they come ‘from vigorous high yielding fields and they have the selection back of them that gives them the inherent bility to produce satisfactory yields of high quality, potatoes. The plant- ing of 'Michigan certified seed pota- toes is the, first essential in profit- able potato production in Michigan. *Mich‘i'g 11 certified seed potatoes ' " need last year- by nearly v wire in ,47 counties of Mich- ‘hese growers practice the , improved cultural, methods. mention}? the highest quality ‘d ,se’ed; Ethey spray their ~tension workers have paused a mo-, sion workers who have gone among' a times‘fon more With bar-w Review Shows Resultsi‘n Michigan Cannot Bé Estimated Just in Dollars, ‘andicemnts .1 . By LAWRENCE McCRACKEN introduced to the state's farmers Berkeley "Rock wheat, Wolverine and Worthy oats, Michigan Black Barb- less Barley, the original and the im~ proved strains of Robust beans, M. A. C. Yellow Dent, Duncan, and an improved strain of Golden Glow corn and Hardigan alfalfa. In addition to introducing these varieties certified seed has been made available in large quantities to farmers so that today the average quality of seed has been greatly improved and farmers who do not buy certified seed are obtaining higher quality although their seed may be three or four 8611—. erations removed from the pure seed. Mr. Rather says there is 11-0 doubt but that well over 1,000,000 acres of Michigan field crops are being sown to seed of improved varieties and as the yield from improved seed has been positively shown under similar conditions to produce a yield of from 15 to 25 per cent greater than other varieties the value in dollars and‘ cents is obviously great. Mr. Rather’s most striking state— ment is probably his report on the increase in the production of alfalfa in the state. He says that although alfalfa has been grown with varying success for fifty years in 1919 only 74,000 acres were planted in Mich- igan. In 1924, 389,000 acres were sown. As the average yield of alfalfa is 21/2 tons per acre while that of other hay is only 11/2 tons a great in— crease in the size of the crop is obvious. Added to this alfalfa is easily worth $4 more per ton than the hay formerly grown and often brings $5 or $6 more. Thus he fig— ures the state has gained $8,000,000 through learning of ways to grow alfalfa successfully. This was made possible through work at the experi- ment station at the college where it was found that northern grown seed produced successfully and the dis— tribution of this seed was arranged in cooperation with the Michigan Farm Bureau Seed Service. Control of Animal Diseases In the report of the animal hus- bandry department attention has been devoted to the control of animal diseases, the introduction of pure breds, and the teaching of proper feeding. As a result’ the report states, “In 1914 the average farm brood sow was of a much shorter, chubby or extreme lardy type than today. A few breeders have devel- oped an extremely rangy type but the influence of extension work has aided breeders in selecting-and standard— izing a medium type that not only answers the market demand but pro- duces *‘more economically than either extreme type. Beef cattle breeders have been aided in selecting for quality and early maturity to meet the shift in market r‘emand toward younger, lighter, well finished beeves.” , The report attributes the decrease in disease in the state to the educa- , tion of farmers to report diseases and to aid authorities in enforcing quarantine. In 1914 the report states that the estimated loss from hog cholera was 73,260 head of swine while in 1923 the loss was set at only 17,535 head. The resume concludes, “Better means of sanita— tion as taught by extension work has resulted in better prevention of many other diseases and parasites such as ticks and lice on sheep, stomach worms in lambs, round Worms in pigs, etc. but figures are not avail—' able to make comparisons for the period.” ' Taught (“are of Orbhurds V. R. Gardner of the horticultural department reported that the work of his division had been devoted to teaching proper methods of spray- ing, pruning and fertilization. He says, “Eight or ten years ago it was the general practice in this state to prune young fruit trees extremely severely. The general effect was to delay bearing and interfere for many years with profitable returns from the orchard. Much has been done by' the extension service to correct this situation though there is still need of instructional work along this line." In the poultry division attention has been given the culling of non- layers, introduction of pure breds, and methods to increase egg returns. In 1914 there were no cow testing associations in the state while now there are 105, K. H. McDonel. assis- FARM BOYS STUDYING TRACTORS AT THE M. A. C. A group of Michigan farm boys receiving practical training in the Truck and Tractor Course at the M. A The Short Courses at the Colit-go are put on in the spring of the year when the boys can get away from the farm without upsetting matters and an increasing number are taking the courses. By H. C. MOORE Extension Specialist, Michigan Agricultural College deaux mixture using high pressure Sprayers; they rogue their fields sev— eral times removing all diseased and off-type plants; they hill select their seed stock from isolated seed plots. The consistent practice of such seed production methods over a period of five years helps to explain why Mich- igan certified seed potatoes have giv— en such uniformly good results'wher- ever planted. Michigan certified seed potatoes are petatoes that have passed all of the rigid inspection requirements of the Michigan Agricultural College. All inspections are made by officials working under the direction of the College. Two field inspections are made during the growing season to see that the fields are free from dis- eases andvarietal mixture and that the plants are uniformly vigorous. When the'potatoes are harvested a bin inspectibn is made of all lots that passed the field inspections. At the bin inspection,~ th‘e‘potatoesmust be -- true to. " typé; 1‘ medically free ,trpm‘ ,, A, court, scab and other blemishes. fourth inspection is made when the potatoes are loaded for shipment. Before potatoes can be sold as cer- tified seed, they must be very care— fully graded to confornr with the strict certified seed grade require- ments. Michigan certified seed potatoes are sold in new sacks that'contain 150 pounds. Each sack is sealed with a lead and wire seal to which is attached the official certification tag issued by the Michigan Agricul- tural College. Each year approximately 300,000 bushels of certified seed potatoes are produced in Michigan of which about 250,000 bushels are offered for sale. This ,amount is scarcely enough to 'plant the potato acreage Of Mont- calm county ,_if all the'potato growers 'in~'that county used certified seed.' For the whole state of Michigan ap- proximately 4,000,000 b,ushels,_flof seed potatoes are required annually, - "so. if‘certified‘seed were used-b ’ - tant to R. J. Baldwin, extension di- rector reports. These associations test the product of cows for butterfat and help farmers to cull out those which are least productive. ' But all these activities are only a part of the servicewhich the $300,- 000 brings Michigan farmers. Fifty— five county agricultural agents re- ceive part of their pay from this fund and disseminate information and ad- vice'Irom extension headquarters directly to the farmers. Six state club leaders, with theaid of six 'full time county club leaders and 10. part time leaders, direct the training of 13,000 (boys and girls in sewing, cooking, canning, handicraft, crop raising, livestock breeding, and pouL try breeding. these boys and girls have realized substantial profits from their efiorts : and some have had a decided influ- ence in bettering crops, livestock and household methods in their commun- 1 es. Besides this Mrs. Louise H. Camp— bell, director Of home demonstration work, directssix state specialists and six county agents in the instruction of farmers’ wives in household arts. Two of her staff devote their time to clothing and textile work, two to nu- trition, and one to home manage- ment. As proof of the value of their ser— vices the extension workers point to the attitude of the farmers of the state toward them. When in 1915 they began their work, farmers ‘sick~ ened by the work of self appointed and ofi‘icious workers, Were skeptical of the practical value of the exten— sion service. Now when the chickens are stricken with a mysterious mal— ady, hog cholera breaks out, the bar— berry threatens wheat, or any of a hundred things, whiclr keep the farm- er’s life from’ being a monotonous grind, break out they turn to the state and county agents for help as- sured of conscientious aid not only to save their own property but to save their neighbors from a like mis- fortune. Statistics Prove Value Although the actual value in dol- lars and cents can not be determined 1 it is proven beyond question by dry crop and livestock statistics for the state that powerful agencies have been at work in the last decade to better the quality and increase the. yield of Michigan farm products, Allowing the state extension workers credit for only a small part of this improvement they believe they have proven conc1usively that the'federal and state appropriations for the ser- vice were wise investments. Proba- bly they have been proven wise be- cause the men selected to carry on the work were themselves farmers and appreciated the difficulties of making the “back forty” buy shoes for the children and Sunday dresses fer the missus. Produce Choice Potatoes You Must Plant Good seed 1 duced would not go far in supplying, the demand. Last year Michigan potato growers bought 70,000 bushels of Michigan certified seed, While potato growers in Pennsylvania, Ohio, Indiana and‘ other statesbought 180,000 bushels. When 72 per cent of this certified seed is sold outside the state, it is evident that Michigan growers are not as appreciative ofChigh quality seed potatoes as are the growers in Pennsylvania, Ohio and some other states. The out of state demand for Michigan certified seed potatoes is due to'the excellent results that are] secured with them. Data on 916‘ tests that have been conducted in. seventeen states .during the past four years showed that Michigan certified seed outyielded seed with which it5 was compared by 56 bushels to the, acre. Just ‘as satisfactory ,results‘év- have beenfijseciired in {Michigan with; tests of this; kind. ,‘_!,Th-ree.,rhiindredf and twenty roger; , tests flosfiuet’ed in; twenty-dour ' ‘ anteater “Michigan; shpyvsdueni.a19£ese increase in raves ' or M higan;,mrtified seediof :73- bushy? A large number of: “THE OL’ SWIMMIN’ HOLE.”—-Doesn’t this make you ISN’T SHE S‘VEET?-—Thls is \VHAT WILL GRANDPA SAY HEN "E SEES THEM think of the good old days? Mrs. Edw. B. Cole, of Mt. Golden, daughter of Claude Purk- ON HIS FENCE?——E. E. Ste-urns, of Dverfield, IS being visited Pleasant, sent the print to us. er, of Hopkins. by three of his grandsons. “PI‘SH 1“ ,."—Kniel, son of John “IN THE GOOD 0 I) 817‘ \[ER TIN! ..”—The children of Albert Broodwood SQI‘IRREL SEASOTvr—Eumi Ruthhun Meekhof, Lucas. and his kitty. * and Robert Smith, of Mikado, enjoping themselves. Mrs. Smith sent the print. of Br) on, always gets his share. ‘ “'HO VSAID‘ YOU COULD NOT lllILK A COW JUST HAVING A GOOD 1' \[FL—Fred Berlin, of HOLD Ill)l, BOYSl—“The only one of its kind PROM EITHER, SIDE‘I—B'Ir. and Mrs. John )[e— Blidland, sends us this picture of Karl and John, of the we saw on our trip,” writes (3. W. l’u‘triek, of lnnes. of Silverwood, would lead one to believe. that same address, playing with their pal, Brownie. Even Bellnire. “Plenty of does but the blleks seem to the statement that you can milk a cow on the left Brownie has a. smile. on his faee so everyone mun-It, be be about all gone." “'e wish you better luek side only is wrong. happy, He time, boys. ., . e ~ «4 ~63< IN THE calamar- ox:an ' D. " 11m RURAL m oAmimn 1m. 1. n... J Green in: ‘ , .v , , . , .7 .— . . a] mall can! t “17136013320 01!! sherryntroor Whore « Lake" 0d0983.'und' his faithful rord. Lust Octobzrhe, paint'edJHI of the box 3n .9 4' M ~ 1’0. ’r 1119;”! 6. nah; white” for .theunnin part, red for the flag andjblne for, the new 3. M $50.; akaggzéiai :5Bervlce with o snille’.’ and‘says “The best people in the nth] *. r - I ET I was of Maria. . You know last summer a young? fellow came along and stark telling about some works of art he has. He is in the picture has- heu and if maria would give him an ordinary photograph of me which was sitting on the bookcase, he would have it enlarged and make it. look like the one he was showing, all for $2.98. Say, Maria must have been proud of me to have wanted such a colorful looking resemblance of. yours truly. Well, the first I heard of it was when the express man says to me, ‘Thene‘s a package for Mrs. Ed- wards with express charges of $9.62 on it. A picture and a frame." I wouldn't take it before I phoned Maria but she admitted it mustwbe all right so I took it home. We un- crated it and here was yours truly painted up like the new clothing store across from the court house. “Like it?” says Maria. 1 “Sure,” says I,.rather doubtfully. Didn't want her to think I wasn’t appreciating the compliment. “But it was expensive," I remarks. “Well,” says Maria, “I didn’t plan on such an expensive frame.” "Did you order it?” asks I. “No,” she says. Well, we dug out the order and here it said that the frame would be included, which Martha didn’t read when she signed up. Say, I got a good laugh out of that. But that picture was worth the price. We had it in the parlor till Ruby, that's our oldest girl, who lives in California, came home and she was so mad Maria took it down and put it upstairs. One night when a rain was coming up and I was shutting windows, I finished it by sticking a foot through it. No one cared for it by that time. We was all convinc- ed that the picture was a bit too good—no human ever looked like that. It was shipping day last, spring and a lot of the boys had been bring- ing in their hogs so as to get rid of them before the spring work began. Gus Bruhm had several loads of ho:.s and some of the neighbors had been hauling for him. Gus was sticking around watching the weighing. Be- tween times he and me talked things over. “Sway,” ays Gus, “did you hear how Andya ' er— got stuck?” Andy Miller was running the Jack- son House and was a smart young fellow who knew all about the hotel business, if you believed what he told. When I heard he was stuck, it was good news. “No,” says I, “who has had the honor of putting one over on our prominent young citizen?" “Well,” says Gus, after he had lit up the General Pershing cigar I had given him, “that salesman for the Happy—Hen Coop Co. who has been pestering us for the past year was the bright young fellow. You see, thh fellow, I think his name is Ho— bart, has been coming out here regu- lar like once or twice a week from 0.3113. and he was pretty chummy with Andy. Hobart got in the habit of having his laundry and other par- cola sent here and Andy would pay the charges and collect oil“ of Hobart when he rolled in. You know Ho- bart, he’s the guy who come down to the post office one day and bought a! the two for a quarter cigars in the store and then passed them out to us fellows who happened to be in there, just to make a splash. “Well, to speed things up a hit." goes on Gus after he had lit the Gen— ml Pershing again. “week lw’r' no, last Andy gets a telegram from Ho- ‘ hart saying a valuable pac 11,48 was rolling to him in care of the hotel and he Wished Miller would take it up. There was about $47 charges on the package, acording to what I heard at the post office. Well, Andy just sat up that night waiting for a notice from the post office that the package was there and when it did come. shelled out the money for that handle even though it was a small one. It was like he was buying a gold brick." “leanwhfle no other word comes from Hobart and yesterday I heard that Fred Kelly was reading a story in it Sunday paper and m onto a m about a-~»fellow by the name of Hobart who was pinched for pulling I cooked deal. That noon - Kelly 3* Andy about helm-stand than Show: him Mil A Farmer’s Experience and" By WILLIAM EDWARDS ILL EDWARDS, retired farmer, friend of the folks in his community, has been telling his experiences with the various xrafters that thrive by para- mnnities. Bill siting on the rural was, a few times because hehappenedtogstfie‘baltottolh wrotehlaltaryvfldalnlm running serially in “o m farmer, ‘x stern. But one time he , revenge is sweet and um had me om M mwhficmmnnufim- W when Mabitonupiutnmdonl Then along came a travelling Bdflsavedolototmlorhflu. :fionhmwbgutflnbut a. m . Volunt- ~Mhinuodiorit not monum- pathy deal. A few passes and the hat was amused filer fie your fellow. the boys who had been so generous found out an M1: the ~ Bill also described what happened to a My in r everything, and the trouble they all had keeping her out 9! We. ha that afternoon. Anyway Kelly stuck around last night and was there when Andy opened the pack- age. All he got from Hobart was a few old newspapers wrapped around a brick, only it wasn’t gold. Andy found out that Hobart’s in jail, but was out of luck when it came to get- ting back his $47. Believe me, he’s a mad hotel man, so if you happen in, don’t mention it to him." Just then another load of Gus' hogs comes up and that was all I heard about it. But I made a point to keep it in mind for the next meet- ing of the Agricultural Society. But before we had the meeting we other than the Hon. Chas. Stanton had a better one to talk about. None had been hooked and on a good one, too. Say, Charley left for Chicago the next day and about all we heard from him since is that he plans to go to one of them hog springs for his health, but the boys says it's because he wants things to cool off here be— fore he comes back. The deal didn’t cost the boys more’n a dollar each and it was worth that much they say, to put one over on the judge. Just below the first bridge over the creek is quite a sand bar. When- tar mixin’ we go down there and ever any of us wants to do any mor- load up what sand we want and it’s cheap building material. Last week one of the men was there and come onto a fellow dressed in ragged clothes and busy working in the sand. Soon the fact is evident that this fellow is making a figure out of the cold sand. Well, the driv- er wasn’t long in spreading the news up towu and soon several of the boys was down there watching him work. The stranger never Said a word un- til he was done. By that time he had completed the prettiest bit of sculp- ture I seen since he World’s Fair. It was a pretty woman lying there with a babe in her arms and it was . done right pathetic, specially when the fellow knelt down and begin to sob. Well, he finally gets up and begins to tell us how this was the way he kept in mind his great loss. at. he just couldn’t do it. Tim picture was a reminder of his and babe, he. said, who were drowned in the Ohio flood two years ago. They were all he had. They- were swept away so quick he never got over it, and although he had tried to continue his work as an art— Then he sobbed- some more. . . Well, Judge Stanton happened to be there just then and it touched him deeply, so deep that he took off his hat and puts a $5 bill in it and' then passed it among the fellows. I even tried to get the fellow to come up town with me and have a bite to eat, but he says, “No, just leave me with my mved ones." But he took the 313 we raised and the rest- of us. feeling like a funeral in action, quiet- ly left. 80 did our stranger.“ The next day, to make matters exciting, a deputy sherifl.’ came along with a story about this fellow. It was pa- thetic tee, and we listened to it with interest. So did the judge and that’s ’why he left town that night. The story the deputy told about how sad it was and then ended up by telling us this fellow made pic- tures in five towns and taken collec- tions in all of them, or rather, dona- tions had been made. Then he end- ed up by telling the number of floods his wife and babe had been drowned in and how the chief of police had pinched him for a faker. He was. Say, when they searched that fellow he had two bank books showing deposits of nearly $10,000.00. They found hewas an escaped convict and never was married. There’ hasn't been much said about the collection, and yesterday when I was down to the sand bar the picture had been shoveled away. And as I said, the Judge is away too. Well, we had our regular meet- ing last night on schedule and while we did talk a little politics, we got away from that subject just when things were warming up. Hank wasn‘t a regular member but he came last night because he had a mission. It wasn't long till Hank was talking. He had a letter from -o. g.- g—w---—ovwwmu . v a. .... ~wrv~dM t Momma a t chat ._ s , 89 .B‘ ‘ lira. “T “- an”, take and capacity you to beware of such letters." " ' Well, we thanked Hank and he stayed till was served to show his appreciation of the thanks, I guess, 'cause he ' slept through not Em mm. .Just More the m; armour one of the Smith has! our to “Hank: my. Han-k, where that plane in Spain where that letter came from?” _ "Barcelony." replies flank, im- portant ulna. where these Spanish hang out. You see it's this way. They make believe one of them is in {tall and if a few debts would be paid, the fellow could get out. “Wendie who was in jail has a lot of property and if a fellow will send enough money to pay the debt,’rwhen the fellow out he will whack up a third of the estate.” “Sounds shellfish.” Hank further, “but it's a the.“ \ “Well. m M boy kinda laughs and then just as Hank was takin’ another cup of, coffee and-a dough- nut, Smith winks at me'and begins. “By the way, Hank, wasn’t it your father who went to New York to, collect an estate right after the Spanish warf”, , “What’s that?” says “Hank, setting 3;“ the coffee and looking wild e. - “I said, wasn’t it your father who almost had an estate in Barcelona some thirty years ago?" Hank says he never heard any- thing of it. Then he thanked us for the food and left soon afterwards. “You see," remarks Smith, “the reason Hank knows all about this Spanish deal is that his father gave them same Spaniards several thou- sand berries on a similar deal. One thing we can thank Hank for is that he remembered why he didn’t re- ceive any property when his .pa died." So the meeting wasn't a regular 'failure. -We learned something. _ As I recall to mind, I think the prize sucker in our town is Bedeliah Stokes. She’s an old maid, no telling how old, although at the last election she was of legal age, and then said she has lived in'the county 42 years and someone remarked they had nev- er_ known her to "live any place else. Well,» sir, Bedoliah was always try- , ing out some kind of a scheme. She had a little property left her by an uncle and she got the money every month from the bank, so she could have lived it she had wanted to and attended the Missionary Society meetings and done a lot of useful work. But Miss Stokes had an idea she was cut outta be famous. She painted China for a few winters and sold it to us folks till we was all stocked up with punch bowls, fancy plates and the like, till the cupboards wouldn’t hold no more. Then she decorated boxes with one of them burning outfits and they was the rage in Jackson City one Christmas. Everybody gave-someone else some- thing burnt.,_ But Bedeliah wasn’t satisfied with her work. She got the mail order habit. First she got a lot of catalogs and solicited orders for perfumes and soap. Then it Was pos- tal cards she was peddling and as far back as I can remember she had _ some fad. A But the .nnttiest thing she did was to open up a sock factory. She saw a lot of ads in a paper about how to become independent, and Bedeliah wanted to move to California, whu'e I got a hunch she planned to go into the movies, and she would have been a knockout too with her build, so she started out to be lndependat. , She borrowed fifty bucks from Tim Harper at the bank. dim knew he'd get it back so loaned ltto her with— out asking into her am. Well. the machine that was to snake socks thatwastokeop usheyssmrm when we shocked m, arrived an accord- ua,m " as .7 V _ . seems you boysmlght m .‘ similar letters, I’m here in official ¢ II J.“ -mm Wot. While the Crop is Still in Your Hands Nature takes care of the crop after the seed is planted. But What good rain and sunshine can makeof your Wheat crop depends upon the thorough seed bed preparation and proper planting which you have done. Any Ford dealer Will show you how these often hurried spring tasks are well done and easily done With Fordson power. m ot‘or‘éonm Detroit. Michigan - The Fordaon is always may when there’s hauling to be done I ‘ I Phat}! of time to go over the corn .8 often as necessary F. O. B- Fenders s\ 5.35 Extra ( X \ PAY TUITION I moved from school district A into district B on December 1, _1924. I wish my children to finish the year -.in District A, can district A compel me to pay tuition for balance of year? Children are enrolled and drew their ~ public money in district A. I was assessed on both real and personal property in district A. I disposed of my real estate last fall and the buyer paid the taxes. District A refuses to credit me with these taxes because I did not actually pay them. I claim credit for the payment of these taxes as the shifting of this responsibility was a private agreement.—-E. R. D., Garland, Michigan. F a person moves out of one dis- I trict into another district he cannot send his children to the district in which he lived without be- ing subject to the payment of tuition if the school board demands it even V though he may have had property assessed there and. may have had his children on the census list of that district. It appears from your letter that you had real and personal property, sold it and the buyer paid the taxes, and you are claiming the right to have these taxes applied on your tuition. You are not entitled to have the tax so applied because you did not pay it, nor was it paid on your property since you had already dis- posed of the property—W. L. Coffey, Deputy Superintendent of Public In- struction. MUST HE PAY FOR PLOVVING? A bought a farm and rented it to B for one year with the priv- ilege of keeping it five years if satisfactory. But A let the farm go back. B had done some plowing and wants A to pay for it. The people that took the farm back wants 3 to stay on the farm. Is A to pay for plowing when B can stay on the place if he wants to.—J. B. M., Mar- iette, Michigan. B has the privilege of staying on the farm, I doubt if he could hold A for pay for the plowing he has done—Legal Editor. NOT. ENTITLED TO PAY I have been teaching school for several years and this winter a mem- ber of my family contracted a con- tagious disease. I notified the dis- trict board and they closed the school three weeks. I was not sick myself but was quarantined. There were no other cases in the district at the time. Is there a law governing this? Should I make this time up or is it a matter to be settled between the teacher and b~oard?—C. D., Decker- ville, Mich. INCE school was not maintained because of the inability of the teacher she is not entitled to pay for the time school was closed. The district should maintain the number of months voted. The board and the teacher must mutually agree on how the time should be made up.— G. N. Otwell, Supt. of Rural Educa- tion, Dept. of Public Instruction. EGGS AND TURKEYS BELONG T0 NEIGHBOR A neighbor has turkeys and one has a nest of eggs over on our land. Now I would like to know if we had any right to eggs or any of turkeys after they hatched? Thanking you in advance for information, I remain. ——P. C., Northport, Mich. F the turkeys belong to your neigh- bor, you would not have a right to any of the eggs or turkeys—— Legal Editor. PUTTING UP ICE We have ice packed in our base- ment 11 cakes long and 5 cakes wide with an air chamber 8 to 10 inches between the cakes. keep packed with sawdust during the hot summer months or not? The cakes\are all shapes, large and smaiL—C.‘ 8., Chippewa Station, Mich. HE common method of packing ice is to fit the cakes closely to- gether to form one compact mass. Even under this method of packing ice, the loss under favor- able storage conditions, is often as ' h as '60, per cent. 1.0 has apart you will . un- « pores » Assistant Will the ice - With the cakes. A Clearing Department for farmers' ev all complaints or requests for information a d div troubles. rooted to thisfiepartment. Prompt, careful attention {Lyon to We are here serve you. All Inquiries mu’st'be accompanied by full name and address. Name not used If so requested.) Packed arc/und the ice it would be . wise to put cracked ice in the open- ings between the cakes; even going to the trouble to pour in water and allowing it to freeze—F. E. Fogle, Professor, Agricultural Engineering Department, Michigan Agricultural College. OWNER FURNISHES ALL ‘AND RENTER DOES WORK I would like a copy of a contract between us and another party on a farm where the first party furnishes everything and the second party does the work—C. S., Bronson, Mich. 0 go into the details of a com- plete contract would take con- siderable space and I do not think it necessary in order to give you the desired information. Under your proposal “where the first party furnishes everything and second party does the work", the first party should receive two-thirds of income and second one-third of in- come from farm. Such expenses as threshing, silo filling if hired, twine, fuel for thresh— ing, fertilizer, should be borne by both parties in the same proportion as income. The tenant to furnish all labor for farm purpose. The landlord will pay all taxes and in- surance and furnish material for up— keep of fences and buildings. Labor for min-or repairs to be furnished by tenant. The system of farming to be car- ried out should be taken into con- sideration in the lease as well as many minor affairs such as; time of hauling manure and amount of seed left; keeping weeds down, etc. ——-F. T. Riddell, Research Assistant in Farm Management, Michigan Ag- ricultural College. Contributions Invited STRONGER MAKE WEED LAW 0 the Editor:———Enclosed find T check of $1.00 for renewal. I would like it very much if you Would use" your influence in getting the teeth put in the weed law. As the highway commission here claims you can’t do very much the way the law is now, I would suggest that upon the first notice from the high- way commission one dollar be charg— ed up in the taxes, and if not cut within twenty-four hours the com- missioner shall have them cut at the prevailing wages. We all have quite a time as we cut ours and these would—be farmers, here this year and gone the next, do not make any effort to cut the weeds and do not care, so all our work does not amount to anything. Maybe you can get something bet- ter than what I have suggested—N. H. G., Jasper, Mich. THAT GASOLINE TAX O the Editor: It is interesting to note the arguments for and against the tax on gasoline. One can at best, merely consider both sides of the matter and then decide as conscience dictates. It is to be tried out now anyway and we shall see how it works. The tax will, no doubt, soon be universal among the states. In the first place there must be money to maintain and build roads if we are to continue them as we have been doing. The amount of money required has been almost more than the people could well af- ord, yet the demand for road build- ing is great. It seems the big ques- tion is whether we can raise the money without too great a burden of taxation. Everyone knows that farmers and other property owners have been paying high taxes; of course it is not all road tax, there are other taxes also but the total is large. If roads are to be built and maintained, and it seems they are, it is no more than fair that those who drive most should pay most and the joy-rider should stand his share as well as the busi— ness people. We have inheritance tax and income tax for the well-to-do which the low-salaried people and those of little means escape, and as a general thing that is just. The man who only pays dog tax can solve his problem by keeping fewer dogs. The joy-rider can use less gas and solve his problem the same way. Perhaps all will consider pleasure less and business more and meet this tax with little additional expense. I am not for cutting out pleasure altogether mind you, neither am I in favor of a few getting all the benefits while the others “pay the freight." Not all laws are quite just. for instance the widow or someone who happens to own a mortgage, a tax must be paid, while whoever owns the mortgaged property must also pay a tax upon it. an; no deduc- Take ' a mortgaged property, really do not own it all. The amount of the mort- gage is always considered in any bus- iness transaction. Why not also in the assessment for taxes? Then, too, the public school tax and right here let me say that I am opposed to any move to increase the public school funds, until what we al- ready have is more justly spent. Railroads have not built fast enough to keep up with the needs of the people. This brought the motor trucks into activity to furnish trans- portation for various commodities. Roads were not intended for such heavy traffic at first, but the situation is to be met some way and we must consider future needs as well. Roads must be honestly built too, by fair minded contractors \who will give honest construction at decent figures. Not all roads have been well made as much defective work now testifies. Just a word in regard to speeding. Much danger and disaster could be avoided if all drivers were careful, but all are not careful so they need to be controlled. A writer to a na— tional publication recently suggested the manufacture of cars that could not exceed the speed limit and that writer was a woman too, bless her. Why go to the expense and trouble to make high speed possible and then "call on Tom, Dick and Harry to make ~them go slower? If we could have the Golden Rule worked out in all public affairs, how much better off humanity would be. But evil has been gnawing at the vi- tals of good. So, to preserve pro- gressive civilization, we need to be ever on the alert to discourage wrong and see that right prospers. We may not always be successful in our ef- forts but the fact that we did our best goes far to clear us of respons- ibility.——Mrs. Florence Howard, Mon- roe County. SUGGEST NAME FOR COLLEGE EAR EDITOR: I have lived on a farm sixty years in Michigan and am in favor of changing the name of the Michigan Agricultural College. Call it “The Tax Grabbers’ Haven of Rest.” Why tax the farm- ers and drive them off the farm to support an unnecessary institution? It has been a burden to the farmers ever since it was started.—— L. B., Manton, Michigan. FAVORS WIDE SLEIGHS the Editor:-—-In your issue of January 17th under the heading of “What the Neighbors Say", I read an article by F. W. Newton, Saginaw County, regarding the stan- dard width of sleighs. I have widened my sleixghs and can not see where they are going to be less serviceable as Mr. Newton stat- ed. They will run just as easy and are not'nearly so apt to tip over un- der a top-heavy load as before. Some of my neighbors have. 1' built . . smothers count). '7 WIL, *7" “I am" a brother of“\flinei‘ in a family. six girls and three” bOys all married. My younger brother was working my father’s and mother's farm but could not get along so my ' folks want to sign over and will the farm to me, I to pay the girls 01!. The boys, my folks say, their share already. Could this will if signed right, be broken if the sis- ters or brothers are not satified?—O. H. P., Pinconning, Mich. If the will is properly executed and signed it could not be broken.— Legal Editor. KILLING HEDGE I have an osage range hedge that I wish to kill. I sawed it off close to the ground in November. Stumps run from 3 to 8 inches in diameter. I have been told to bore a hole in the heart of the stumps and fill them with kerosene oil. Would this kill them? Michigan. ONSIDERABLE work has been done in an attempt to discover a cheap but effective means of destroying undesirable, rootfi, stock. The work has been confined thus far mainly to quantitative experiments in an effort to determine just what poisons are most eflective. "Quanti- tative experiments unfortunately have never been definitely worked out as to just how much of each poison is necessary to kill the trees. The amount of poison necessary de- pends on a numbé’i‘ of unrelated fac- tors, such as the species of trees, the size of the individual tree and the general vitality of the tree. Kero- sene will kill trees but I cannot say just hows—much would be necessary. Boring holes in the stump is rather laborious work and I would suggest that more certain results could be ob- tained with much less work and at approximately the same cost by using a stronger poison such as arsenic. The arsenic can be prepared per the following directions or can be pur- chased in solution in the form of various weed killers. If prepared at home extreme care must be taken to secure a true solution of arsenic or else no results will be obtained. - WHO CAN ANSWER THIS? WOULD like to ask a ques- tion. Why is it with using a peach twig to locate a vein of water that it will work with some people and not with others?—R. V., Kent County. If the following directions are care- fully followed boring holes in the stumps should not be necessary to sec cure desired results. The solution is poisonous and care must be taken to see that people and animals are kept away from it. Use one pound of arsenic and three pounds of soda to make one gallon of this poison. Arsenic is not solu- ble in water to any great. extent so that soda, either ordinary washing soda or caustic soda, has to be used to dissolve it. When large amounts of the solution are required, wash- ing soda will be cheaper, but for small quantities of solution, caustic soda will possibly be found handiest. In preparing the solution, whether caustic soda or washing soda is used, first dissolve the soda in a conven— ient amount of water, using heat, if desirable, to assist and hasten it: then slowly add the arsenic, previ- ously made into a thin paste, stir— ring all the time: place on a,strong fire, and allow it to boil for at least half an hour: stir from time to time. being careful to stand on the side away from the fumes, as being poi- sonous, they are apt to cause sick- ness. When the arsenic is thoroughly dissolved, the solution may be made up to the required bulk by adding suflicient water, either hot or cold. The best time to carry out the , work of poisoning trees is when the tree is dormant, that is in the fall or winter months. ‘Small trees may be cut of! low down and the solution may be daub-. ed 'on with a swab-stick 'to kill and prevent suckering. ’ ' shes It. the I _ r If not, how would you ad- 5 vise killing them?-——J. W. B., Doster, ; Care should ,be taken to see that " people have got , \ ,. 1 times TE OF SODA IN 50041523551 FER TILIZA TION - .A Synopsis of Results Obtained from Investigations l Conducted in Michigan in 1922 and 1923 (Reprinted from FACTS ABOUT SUGAR, March 22, 1924) r The investigation, the results of which are summarized in the following article, was com- menced in the spring of 1922. Its object. primarily. was to ascertain whether in the culture of sugar beets in Michigan nitrate of soda. applied liberally, would prove as potent a factor as experience has shown it to be in European practi . - In some parts 0 Michigan the use of com- mercial fertilizers is little known and their properties less understood. Where used. the fertilizer is too often one almost devoid of nitrogen and consisting. chiefly of acid phos- phate— typical of many low—grade brands on the market which ceived no fertilizer treatment, being reserved as a check. Results of First Yield The results obtained from the sugar beet crop of 1922, grown on the O’Toole and Gavit farms, appear in Table 1: 1922. A glance at the data presented in Table 1 shows that in both experiments aremarkable increase in the yield from every fertilized plot was recorded. In this they agree, but differ somewhat in the degree of response shown to the various methods of treatment. On the O'Toole farm the yield from Plot 4 was rather commend themselves to the purchaser be- cause, being largely phosphatic. they can TABLE I: 1922 Yields and Increases per Acre (in lbs.) be sold at a compara- Fertilizer O’Toole Farm Gavit Farm tively low price per Plot treatment Method at Yield Increase Yield Increase ton. _ (lbs. per ace) application over check ever check I Nitrate—300 Drilled in 31.282 6.426 s .005 8.195 Plan Of Acid phos.—3oo pdor to 5 the Liar. p0 seeding Expetimentl a Nitrate—135 Drilled in amass 2.502 20.330 3.520 In order to pro- fifigfi‘f “f “go '“h'w' vide conditions which would permit of ow 3 Check 24,856 . . . . 16,810 . . . . aliens being conduct- 4 Nitrate—300 Drilled In ed on a scale con- Add Dh“-—3°° Prior to 32.340 7.484 «.590 3.780 i I twith o n Sul.p0tash——so seeding farm practice two _ s Nitrate—300 Top dressed 31.xoo 6.244 17,530 720 ' Acid phos.—-300 when fields. each 20 m Mar. potash—so blocking inareaandgiving evidence of lmiform- ity in soil conditions. were selected for the two principal experi— ments. In these it was intended to obsa've the influence of the fa'tilizer during the course of a three-year rotation consisting of (1) sugar beets. (2) grain, (3) hay—a rotation conform- ing to practice approved in the locality. These experimental fields were situated twenty miles apart. one on the farm of W. P. Gavit, at Saginaw, and the other on the farm of Ben O’Toole, at Merrill. The soil on both farm! was a clay loam. larger than that from Plot 1, indicating a slight advantage for sulphate over muriate of potash, whereas on the Gavit farm the posi- tion was reversed. It should be stated. how- ever. that a measured acre (fertilized as Plot 1) adjoining Plot 4 on the Gavit farm yielded y the same as the latter plot. On ndther experimental field was a pronounced response to potash fertilizing anticipated, both soils having shown, by analysis, a high potash content. Another contrast is seen in the results following the application of the fertilizer as a top drowng at the time the beets were ‘ ‘ blocked." This plot on the Gavit farm ’ Fawkes ‘ no. mm. Method 0, “.14, De, mm... om prodymmuced a uirtery ingengrt’ Obs. w an!) sublimation smegma. v' check. 1138- "—3 PPS I10 011 x Nitrate xso Drilled in with as m 5.364 par“? atlrlbutable ‘0 “wk M wed ' . of soil mmsture adequate for Illu- notalh 45 the quick solutionof the famil- . mu“: mo Drilled in with m 3,594 izers. The corresponding Add place. no first. sending plot on the O’Toole farm at m”- "m “am” Merrill produced ayicld prac- 3 Check £9.07. tically identical with that 4 Nitrate 180 Drilled in with from Plot 1. and in this con- Add ohm- 180 fiat 86.614 W nection it is noteworthy that W’ acopiousrainfall followed al- most immediately the top dressing of the fertilizers on Theplanprovkiedfortheapplicaflontothe greatu'portionoftheexpaimentalfieidof soomundseachofmu'ateofsodaandacld phosphate. together with 50 pounds of muti- ateofpohshpamThiswastobeappllal priortoseedlng. The balance of thefleld. divided into four plots of approximately one were each. sawed todemonstrate the influence ofcertainmodifl- cationsof the general treatment. Procedure of Experiments Preliminary trials having indicated that me fertilizers might be most efficiently and con- veniently applied by means of the fertilizer- sowing attachment of a modern grain drill, this method was adopted and found satis- factory, it being possible to distribute the full amount. representing 650 pounds per acre, at one opaation. On the plot to which the fertilizer was ap- pliedinthsrowwiththeseedfromthebeet dnnonlvmmimdsperacreofthemixture were used. this amount Plot 5. Respecting Plot 2. on which the fertilizers were drilled in with the seed—a method which cannot be generally commended — owing to failure of the seed to germinate within a reasonable time period this plot on the O 'Toole farm was harrowed up and reseeded, whereas no perceptible delay—as compared with the other plots—was noticeable in the germina- tion of the seed in Plot 2 on the Gavit farm. Supplemental Experiment Further light on this point was furnished in a supplansntary lo-acre test on the O’Toole farm at Marin. In a ten-acre field of a heavy loam soil the fertilizers were applied in the row with the beet seed. Four acres received the same fertilizer as was applied to Plot 1 in the 20-acre field. and on four acres potash was omitted, the balance of the field serving as a check. While germination proceeded rapidly and vigorously on the check plot. it was so seriously retarded on the fertilized areas that these—with the excqrtion of four rows ad- joining the check—were hat-rowed up and re- seeded ten days after the date of the first representing the limit of the beet-drill's fen- tiliscr-sowing capacity. Another acre—plot re- ceived fertilizer treat- ment similar to that of the 'main area. except , that “mme 0‘ WM 3 Nitrate 300 replaced the muriate. 1+4 goo while still another 4 Unf'u’tilized received the fertilizer as 5 2-1ng 3.0 a top dressing when the 0 beets were'ready for blocking." One we re: .Nlmxso . 300' 'Im'wmof Wmmnhupercentof TABLE 1: m3 Yield-and Imps-Acre (inlst Saunas-inc. Fau- Heinroth Fan-n Method of Yield Increase Yield , Increase application over check ever check 26.104 4:931 30.075 5.556 Drilled 23.01 2 1,189 27,057 2,533 , in 29.729 7.906 32.504 7.985 pnor to 21.823 24.519 needing 25.745 3.922 28.897 4.378 26,075 4.252 28.720 4,201 nitrates of potash and soda, was found on nitrogen and 9.65 per cent of potash. seeding. The results are seen in Table 2: 1922. The results recorded here show, on com- paring the yields from Plots 1 (with potash) and 4 (without potash) that no advantage was gained by the use of potash in this instance, though the lower yield on Plot 1 does not necessarily imply that the potash had been detrimental. Further it should be re- marked withreferenceto the behavior of Plot2 - represented by the four rows A gratifying feature of the results 111*‘ marked degree of consistency exhibited in comparing the behavior of corresponding plots in both experiments. The data in Table 1 indicate clearly the influence of the various fertilizers. as measured by the increase over the yield of the check} plot. In both instances the highest yield followed the application of nitrate of soda with the 1-8-4 mixture, and of the fertilized area not re- seeded—that though retard- IABLE 3: 1022 ed by the fertilizer in prox’ RESULTS FROM ACRE OR HALF-ACRE PLOT DEMONSTRATIONS imity to the seed, germina- tion ultimately took place and a full stand of beets re- sulted. However, though overcoming substantially the lead of the check plot. the yield from Plot 2 fell far 1 short of that from Plot 1. thus furnishing irresistible a evidence in favor of apply- ing active fertilizers apart Fertilizer Plot treatment be. per acre) Check Nitrate 200 Acid Phos. 200 Tom Mayer, Merrill. Medium loam Method of Yields per Increase ov application acre. lbs. c . lbs. Drilled in 30,390 7.250 with seed but reseeded 23,110 E. K. Kennedy, Swan Cree . andy loam . . x Nitrate 300 Bmadcasted 18.520 n. s from the seed. or msumns Acid Phos. 300 after beets ‘7 that they do not come in too were up direct contact in the soil. I Check H W M 5 C7.0 8 Geo. . , wan rec . . Sandy loam Demonstrations on x Nitrate 300 Drilled in 29,510 6,890 Smaller e28 Add Phos. 300 pnor to A! . seeding Besides the experiments ’ Check c - “'6” . H. Wlltse, Swa Creek. already described. a number Medium 1021?): of smaller 2-plot demonstrar- 1 Nitrate 37o Drilled in 24.230 11,175 tions were introduced in Add Phos- 370 5:33;“? ammo“ whee?“ t° 8351‘ 2 Check (which had received 13,055 naw and Merrill. The re- “5155, 1-3-3 bmd) sults from these are given Clifford E: Wiltse, Freeland. briefly in Table 3: 1922. x Nlmt 300 D ,u d PW 103‘“ 6° 66 . . (3 fl 8 ln 2 .5 The results, lthll be seen, Add phat 300 prior to 4 4‘ 5 were consistently favorable seeding and need no further expla- 2 Check nation. The greatest propor- 19.895 tional increase gained from the fertilizing was noted in the experiment on the farm of E. K. Kennedy, Swan Creek, where the soil is a light sandy 10am, and the fertilizers were broadcasted as a top dressing after the beet plants had reached the rough-leaf stage. The response to the fertilizing was immediate, and, by reason of the vigorous growth of the beets thereon, the fertilizer plot furnished a striking object lesson throughout the season. As a. factor contributing to the success of the first year’s experiments one must recognize the favorable weather conditions in the moder- ately warm, moist summer of 1922. Another factor, which cannot be overlooked, was the helpful. active interest in the work shown by representatives of the Michigan Sugar Co. EXPERIMENTS IN 1923 Unfavorable weather conditions—a cold May followed by an exceptionally dry J une— experienced in the Saginaw district during the season of 1923 influenced yields adversely, so that the tonnage per acre was considerably lower on the average than that of the previous year. Yet, despite these untoward conditions, the returns from the use of nitrate of soda, alone or in conjunction with other fertilizers. have been no less marked, and profitable, than those of the initial year of the investigation. The scheme of experiment in 1922 was com- paratively simple in its nature. ba'ng designed rather to demonstrate the proper method of applying the fertilizers and the increase in yield which might be expected from their ra- tional use than to compare the influence of diflerent fertilizers. In 1923 the scope of the investigation was broadened to include comparisons of single ingredients—also commercial mixtures—and certain combinations thereof. having in view primarily the determination of the individual influence of each. The choice of materials for this purpose was indicated both by local usage and the recommendation of the agricultural college, the former involving the use of the customary 1-8-4 mixture and the latter one of a 2—12—2 formula. In the two large experiments—on the Som- erville and Heinroth farms—nitrate of soda was employed (1) alone. and (3) in conjunc- tion with the 1-8—4 mixture, the 1—8—4 mixture also being applied alone (2). Two other plots were treated with 2-122 alone (5) and nitrate of potash and soda (“ Nitrapo") alone (6). Plot 4 (check) was unfertilized. The results are shown on Table 1: 1923 The previous cropping of these area was as follows: Somerville, pasture in 1921. com in 1922; Heinroth. hay in 1921, beans in 1922. The Somervflle' field was lightly mama-eq— nitrate alone was much more effective than 1—8—4. That the 2-12-2 mixture proved superior to the 1-8-4 may indicate a greater need for phosphoric acid than for potash, a surmise supported by the results from Plot 6 (“Nitrapo”), which showed no increase over those from plot 1 with nitrate alone. As a basis for the calculation of profits from the fertilizer treatment, the value of the crop may be taken as $9 per ton, and the cost of the principal fertilizers as follows: nitrate of soda, $3.50 a hundred pounds; 1-8-4 mixture $2.15 a hundred. Other Demonstrations in 1923 The results of other, small-plot demonstra- tions conducted in 1923 were as follows: On the Clay Loam farm of M. Winterstein. Swan Creek, 300 lbs. of Nitrate showed an increase of 4,363 lbs. On the Heavy Clay Loam farm of M. E. Barkman, Swan Creek, 150 lbs. of Nitrate- showed an increase of 2,544 lbs. 0n the Medium Loam farm of Murphy Brothers. Freeland. 300 lbs. of Nitrate 0n Plot 1 showed an increase of 1,720 lbs: 3004 lbs. of Nitrate on Plot 3 showed an increase of 3.520 lbs. On the Clay Loam farm of Robert Caldwell, Saginaw, 300 lbs. of Nitrate showed an in- crease of 4.994 lbs. With the exception of one experiment from which a record of the yields was not obtained. the foregoing shows the results of the in- vestigation carried out in 1923. Certainly there is enough evidence in this article to convince any grower of Sugar Beets that IT PAYS TO USE NlTRATE OF SODA There is no easier way to add to the profit. Our Bulletins on the Use of Nitrate of Soda, and List of Dealers will be sent on request. Chilean Nitrate of Soda EDUCATIONAL BUREAU Dr. William S. Myers, Director 25 Madison Ave. New York Mail the Como on Today abouteighttonspel‘acre r_________ _ _ _ _ _ _ _ .._.._.._.- -—ln the fall of 1922; othm'wise no manurial I or fertihzer’ treatment was given in either in- stance during the two Name SEND ME YOUR SUGAR BEET AND OTHER BULLETINS years preceding that of the experiment. The soils of both areas are de- scribed as medium loam. The Heinroth beet crop Street or R. F. D | l | I was declared by common I I I I 0 Post Office consent the best in the Sagln' aw district; the rec- ords presented in Table 1 County show the yields to have been considerably in ex- 1710 case of the average. State + . +. Is Outsell’ ,. WMelkwwrdhmmeWk;fi ‘ ‘77: a Izou thengrl t Ihwaunnkk‘ T is better because of its unbreakable double-ribbed sillimanite core, its special alloy electrodes, and its two-piece construction which, is gas-tight and allows the plug to be taken apart for cleaning. A full set of Champions at least once a year means more power and speed, better acceleration and a real saving in oil and gas. More than 95, 000 dealers sell Champions. Champion X for Fords is 60 cents. Blue Box for all other cars, 75 cents. (Canadian prices 80 and 90 cents.) Insist on Champions. Champion Spark Plug Co. Toledo, Ohio Champion Spark Plug Co. of Canada, Ltd. Windsor, Ont. Champion Xie the etenderd eper’k plat for Ford Care on d Truoke end Fordeon Trenton. ._ ‘3 CHAMPION M ‘ri’w, 3., : older ike dG onD'iiesns r Dependable for Every Engine BIG SALE! hot “I 14 yards ofBeeuti- ew Remnant: only $1.59. They re ,. et FREE '1 A Reel Double Purpose Hemw. Gauge can be closed to other ff . extended for ore and en tiygtlon. G‘ng. ere revereibe in either position. Ular B etter Cultivation in Field and Orchard r field work or Reversible Extension S. A. Harrow USE HOOSI§JR B ILDI G TILE for all per- manent buildings for_ I farm or city, the best material obtainable for dwelllngs, store— rooms. garages, foundations, basement walla. hog burns, _barns. poultry houses. etc. special tile for_ every urpose combining beauty, durability an econ— omy. Tile furnished in Smooth Glazeior Met flmsh. .Send plans and let us give or} .an estimate before starting your uildmg program. We also manufacture Glazed tile and wood silos. I'looslelI Bldg. Tlle & Sllo 00., Dept. MB11‘ Albany. lndlsna. My prices are much lower this ear on Fence, Gates. I Stee Poets Barb Wire, | Roofing and hunt. My new catalog is 3 money sever. 850,000 Farmers Save Money on my “‘3: 'tluncuon Send New (gt Price on Till BROWN MRI 6°. Momma. Ohio 3 ’ RINKADEGARDEN TRACTOR - and Power Lawnmower ' A" Man, Proven Power cinema: tor G a: cpuburbenit Truckers. / Made in six belle sizes which can be fur- nished with regular heede or with verious - extensions up to 14 ft. cut. Disks are of cutlery gteel with edges forsed Ilium. CLARK CUTAWAY" Implements are the only ones having forged edge disks. Send for our complete catalog of horse and tractor drawn disk implements for orchard, farm and garden; also name of nearest distributor and valuable free book. "The Soil end he Till-ye." The Cutaway Harrow Co., 532 Main St., Higgenum, Conn ‘BOLElssmca Does Seeding, Cultivating and Lawn How- 6 “ ing with greater saving ot time . and eflort. Attachments for dlt- ' ferent jobsfire ingtgintly in?» changeable. my a p, exclusive features such as the patented arched axle. tool con- trol, instant bitches, etc. A bog or girl will run it with deligh Cat-log man an; all-mm. t ,. - r ' xiv-’3 1 w Broadscope F How Deep Shall .We Plow? ,LL authorities seem to advocate deep plowing as the proper thing for gardens and all root crops. Some advocate deep plowing for corn. The finest garden in this vicinity last year 'was not plowed at all. It was 0 n l y ‘worked up with a one— h-orse fine tooth cultivator, a n d altogether it was about the best garden the writ— er even saw. W e e d s ? Sure there were a mul— titude of - them, but they were . . killed ere they had fairly started. The subsoil was very firm but about three inches of surface. soil was very loose, mellow and easily worked. While, no doubt, some Soils need deep plowing, i believe more times we plow too deep than too shallow. A few years ago I tested the plowing depth on several different fields and for different crops. Some of these experiments may be interesting, and as plowing time will not be far away when my farmer friends read this, it seems an opportune time to tell of some of these plowing tests. One field of nine acres was a clover meadow for one year, and during the’ next winter it was covered with ma— nure, about seven loads per acre being used. The clover killed out quite badly that winter. as the fall and early winter were real dry. The field was plowed with a working plow, and after plowing about one; half acre at a depth of seven inches, the plow was set to plow more shal— low—in fact, the lead wheel was lowered as far as it. would go. The plow was then turning a furrow only five inches deep. This depth was plowed until noon. During the noon hour I took a piece of oak, two by four, and bolted it to the wheel standard, and then to the plow beam, in order to be able to lower the wheel another two inches or so. The ground was in ideal condi- tion for plowing, and the plow did fine work with a furrow about four- teen inches wide, and only three L. W . NIEEKS and one—half to four inches deep. In‘ fact, the spring tooth drag tore out considerable manure and sod as in some places it cut down nearly as deep as the plow had gone. The field was planted with a. check row planter about May 10, and planted as shallow as possible, and cover good. About that time we had a. good rain, and it was the last rain we had for a long time. This corn sprouted and came up fine, and soon all the roots were in soil deeper than it had been plowed. The weather continued very warm and dry, which caused the top layer of soil to dry out as deep as it had been plowed. However, this shal- arm 4722! Edited by L. w. Meeks, Hillsd’ale count? land) low plowed soil-y full of manure and old clover growth, acted as a mulch and the soil beneath did not dry’ out to any considerable extent, and the corn grew fast and never rolled, wilted or showed signs of needing moisture. ' Neighboring fields that were plow- ed deep, dried out as deep as they were plowed and as the corn had . not rooted into the soil below this deep :plowing, it was badly affected. It wilted and rolled and did not seem to grow normally in size or color. Our field was plowed so shal- low the cultivator tore out the ma-_f nure and sod almost all over the field, and how dry it all seemed to be! The dry weather continued until- the fore part of July, and by this time the- corn on the deep plowed land ‘Wasso badly affected by the dry hot weather, it never regained what it had lost, and made a very poor ‘crop. Our shallow plowed field continued to grow fine and prov- ed to be the best crop of corn we ever had. ' The corn was cut by hand and shocked up wide and rye was sown with a disk drill without fitting the land in the least. The rye grew fine. In the spring mammoth clover was sown. At this time the old, nearly decomposed manure and clover were clearly seen all throughpthe upper soil, and what an ideal seed bed it made for the clover. The following spring this mam- moth clover was sure enough mam- moth, and about June 10th it was plowed under, and what a. fine crop of those good old Carmen potatoes it produced! It i t A Test for Oats We have been commercial growers of potatoes for nineteen years, and oats follow potatoes in our rota- tion. The potato ground is never plowed for oats, however, the same 'year we plowed so shallow for corn we tested out the oat field also. A portion was plowed through the cen— ter of the field and rolled. This plowed portion was fitted just as the rest of the field. Clover was seeded with the cats. The dry spring was very much more detrimental to the plowed portion, and showed plainly in the oats while the clover was even more seriously affected. It seemed the soil would dry out as deep as it had been worked in the spring-— whether it was three inches or seven or eight. ’ i I O t Another Corn Test The first year we owned this farm we had an old sod field which we put into potatoes. Very early the follow- ing spring this field was limed, one bushel of cats per acre were sown. _’ and the field seeded to‘ alfalfa. It was a good growing season. We had intended to cut the cats for hay, but as the weather continued real wet we let them mature and harvest— ed them with a yield of forty-five WHERE OUR READERS LIVE Haven’t You a picture of 'our home or farm buildings that we can print under thiskheading? . o a icturee send us the negatives. just e 20 print. Show the other members 0 Th 15 ‘ ’ ' are all right if the details shgw agnf‘vgesumriijfrxioiame tawny Where you live —L .fltflé $822 $9599}! :bn-l-‘DJ: E 93:11?! EQ'SS’SQS’USDQ‘UN y x :fis o _, " . in “filter " alfalfa and: by it was all dead - the result would be a failure, but I , the oats if they are sown late. ' phfiéphorus. in the ‘ i rt‘it and nearly all onto» of the ground.‘ Here was’a field we had not expected to spend any precious spring work on. and now it was demanding con- siderable attention, as it lay there, the alfalfa a perfect failure. Our first thought was to sow it to alfalfa again, but that spring the alfalfa seed was so high in price We decided to plant the field to corn. As neighbor was-induced to helpplow it, and -it was plowed “round and reund’” toward the fence. Whom about two acres in the center of the field yet remained to be plowed, I decided to stop plowing and disk up the two acres and see what- the re- sult would be. The neighbor knew was not so sure. /The two acres were simply double disked, and then fitted with the rest of the field. This disked portion had not been plowed since it was plowed for potatoes the second year before. Corn was plant- ed about June first. The season was normal, and there was no difference in the corn crop. One could not tell where'the land had been plowed.or disked. I am firm in my conviction that as a general proposition we use the plows too much. I am more and more certain that if we could have a four year rotation with only one plowing, more satisfactory results, with less labor, would be accomplish- ed. No doubt some heavy soils would show some difference in their treatment of one plowing in a. four year rotation. My experience is mainly gained on a. medium loam soil. r The fields we use in our rotation, which includes the potato crop, have only one plowing in the four years. The rotation consists of—Afirst year, potatoes; second year, oats (disked in) seeded to clover and alfalfa mix- ture; third year, hay; fourth year, pasture, until about half of the growth is consumed, when stock is removed and the rest of the growth is plowed under for potatoes again. We plan to top dress-the potato ground after“ it is plowed, and sev— eral weeks before the potato crop is planted. For the past three years we have grown certified seed pota- toes, and our aim is to growa good crop of medium sized potatoes rath- er than a large crop of large pota-l toes. l The medium sized potato seems to be far better for seed than the larg- er ones. In fact they are also better table potatoes. We believe we could very easily increase our yield if we would sacrifice the quality a little, however the M. A. C. inspection re— ports for the past three years show our crop to be very good. The ma— nure, if plowed under instead of being used as top dressing, might grow larger potatoes, but these larg- er ones would not be as desirable. Several years before we began grow- i—ng certified seed, we learned that the returns from a potato crop were as much dependent on quality as on— quantity. The quantity of a pota- to crop is of little interest to the con- sumer, while the quality is a matter of great concern. The above four year rotation has only one plowing. Top dressing after that plowing seems to leave considerable humus near the surface and this is ideal for the oat crop as well as the clover. all It * ()ne Sure Thing If corn stubble or potato ground is to be fitted foroats without plow- ing, this work sHould be done early, and the oats sown at once.- This is imperative on account of the weeds which will be quite sure to come in Potatoes play such an important role in the afiairs\we stage on Broad- scope Farm, you will no doubt find them mentioned quite often in these News and Views talks. The best way to meet the dairy cows 7 unneral needs is to apply limestone and form of aroma lime- Use s ’ near" a a s ‘AHQOOD- FARM-an BETTER"? M ’ and like one machine. h :rdcfi. Quality. . These machines are the result of 94 years of experience and betterment. They areasnearperfectashuman skill can make them. They are the standard of the world, famous for dependability and long life. Service. Thevalue of McCormickaeering equipment is always greater because of the service that stands ready behind every McCormickrDeering machine. No matter how old your machine, this Company assures a helping hand in case of need. We are fur! nishing repairs today for McCormick and Deerin binders and mowers that have worke through forty seasons. Unit Operation. In these days of big op! crations and of power farming, be sure that your farm machines work together as a unit McCormick/Deming tractors and the many drawbar and belt ma! chines are designed and built to work to, gather. Matters offlcapacity, equipment, ad! justment, hitches, etc., are all worked out for handy, fast, unit operation. Each new method and machine you adopt fits in without delays V I Standardize on Good Equipment HERE is a dealer in your town who has in his store many modern farm machines called by the name “McCormick’Deering.” When investments in farm equipment it will pay you to stick to this ealer and with these machines—to standardize on the McCormickrDeering line. of the benefits that will be clear to you during many coming seasons: or extra expense when you use McCormickr Deering machines. Interchangeable Units and Parts. Standardization in McCormickDeering mam ufacture enables you to make emergency repairs and so save valuable time. A great many of the parts in McCormick’Deering machines are being made so that they will be interchangeable between one machine and another. This advantage may sometime mean hundreds of dollars to you in the midst of the heavy summer season. Standing with the Dealer. The McCorr mick’Deering dealer is in position to give you the best of cooperation. It will pay you to confine your purchases to the one dealer and make of yourself a favored customer. Scat' tgred purchases cannot make you an impor1 tant customer with any dealer. Re-sale Value. McCormick’Deering equipment always stands high in resale and trade~in values. Notice how the bidding goes at auctions when a McCormick'Deering machine is put up. Remember that it is “good equipment” that “makes a good farmer better,” and that McCormick’Deering is the old reliable line. Standardize on farm equipment as the wise manufacturer does when he buys materials and factory equipment, and when he builds oduct he sells. Standardize as big companies do when they buy fleets of motor Standardize on equipment as the good farmer does on breeds of livestock. They all standardize and so simplify their operations. It is good business all around. INTERNATIONAL HARVESTER COMPANY 606 So. Michigan Ave. of America (Incorporated) Chicago, Ill. 93 Branch Houses in the U. 8.; the following in Michigan BllSlllt‘HS Ii‘urmm‘ tm'ritmgvn~ Detrmt. Grand Rapids. Green Bay. Jackson, Saginaw. M‘CORMICK-DEERING FARM MACHINES on make new Here are some ur : - 4 absolutely a at and 8 It puts. sixes“ todo,980plus mugrmeué:a that could not lgpnmglnu- our 9MB] 06. media“. 81.99 :plus postage, or for £3.89 wheels to ning gear. fo'fi’fi‘u EELECTRICEE It is your guarantee of quality. Write « today for free catalog in colors describing Farm Trucks and Wagons, also steel or wood fitany run- , \ of oval-[Teena in In! ion at lowest prleel line. Northern r n rm bimb- etc.w Electric Wheel 00. $3“; - '33:}: ' “wit” ' NoMone l PAY 0N ARRIVAL A maths: e An Auto-Oiled established the Iliad _ by the-company which ‘ Time Tested Windmill The Auto-Oiled Aermotor has behind it a record of 10 years of successful operation. In all climatesand under the severest con- .- ditions it has proven itself to be a real self-oiling Windmill and a most reliable pumping machine. Aermotor, when once properly erected, needs no further attention except the annual oiling. There are no bolts or nuts to work loose andno ' parts to get out of order. There are no untried features in the Auto-Oiled ' Aermotor. The gears run in oil in the oil-tighnstorm ~ proof gear case just astheydid 10 years ago. Some mentshavebeenmade,asexperiencehasshown the possibil- ity of improvement, but the original simplicity of design has been retained Mentor perfection of Operationhas been achieved. 'l‘heA r is wonderfully efficient in the light winds. which are the prevailing ones. The self-oiled motor works . , With practically no friction, and the wind-wheel of the Amber ' is made torun in the lightest breeze. It is also amply strong to run safely in the strongest winds. In any condition of wind or weather youn-ylie‘ th Mum‘s-Wilmeme bestofservice. Rina-dc windmill business 38 years ago. 1 ¥ / i/ , I Goodyear-HEAVY DUTY Cord " ' 6’ ‘ l' V \ _ Tires are available from Good- ,. ' ’ - I ..-: year Dealers in the following sizes: 30 x 3% (CL) 34 x 4;»; (5.5.) 32 x 4 (5.5.) so 1: 5 -- 33 x 4 " 33 x s u 32 x 4% u 34 x 5 n 35 x s (5.5.) For those who desire balloon tires Goodyear makes a com- plete line,including the HEAVY! DUTY type in certain sizes. ERE’S the tire for the hard driver, the heavy car, or the rough road. The new Good‘ year HEAVY DUTY Cord Tire. Super—stout all through. Thick . sidewalls reinforced against rut—wear. The powerful body made of SUPERTWIST. A tough tire, this HEAVY DUTY Good- year, a saving tire, for the man who wants extra stamina. Are you that man? Goodyear Means Good Wear a e as garages Copyright 1925, by The Goodyear Tire & Rubber Co., Inc. ’ l Trees From Kalamazoo : _ Direct to You at Reduced Prices Also shrubs, berries and roses. Beautiful 1925 catalog sent free upon request. Full of big bargains and tells about stock to be given away. Everybody should plant this spring.‘ It is a pairlotlc as well as a profit— . able duty. Therefore you cannot afford to be Without this catalog. It will “‘ cut your tree bill in two. Ask for it to-day—Now—rlgnt away. 1?? CELERY CITY NURSERIES Growers of Good Trees for Many Years. Box 210 Kalamazoo Mich N -BUCKLI . I ugliness I , "sausages .r. senta we in every community to sell our paints, stains, enamels, etc. Big Commissions. . . . . Get territory now. Grand Rapids Varnish Corporation, ,1. . 567 Godfrey Ave, S.W., ‘3 Grand Rapids, Michigan. Send for my big new free harness book. Tells how I send Walsh No—Buckle Harness on 30 days free trial. Use it—provef or yourself that it is stronger. easier to handle. Outwears buckle harness because it has no buckles to t rstraps. no rings to wear them. no buckle holes to weaken them. Amazing Get Low Prices on mower—thousands in use in every state. d Costs Less—Wears Longer an Saves repairs. Walsh special 900ltrel testleather, which Baskets is explained in big free book. Easily adjusted to fit any size horse. Made in nilstyles: back pad. side backer. breechinzless. etc. $5 shot 30 days trill—balance is paid monthly. Return to me if not satisfac- tory. Write today for my big free book. prices, ' easy terms. Sold direct to you by mail only 1’. - I. M. WALSH, Pr“. " WALSH HARNESS CO. .24 Kent. Ass. Miivsukoo, W' Write for our free (inc-log! Shows you how you an save money b buying (urea; a You‘ve heard your ’3; neighbor praise this r»? / ./ wonderful weekly magazine t h a t 3 million people read. Unbiased di- gest of national and world sfiairs. Chock full of the kind of - reading you Want. Science. poli— tics. travel. fun. question box. books. “ health. home. radio—entertainment and in— . .mction for all. Send 15c (colnorstamps) today for this big porno trial 1-3 weeks. or $1 for 1 year (52 issues). Address: ATIII‘INDER. 74] Landon Station. Washington. D. c. 3““"0' ‘. amonthforafewmonths —easy to own thefamous standard WITTE En— _, “unmiifih’iifim’ s I or A G3? Eednipped with celebrated Tronblsproof WIGO Magneto. Simplest and cheap t to on- Ii tsrtl one . 05m ins rate. New dsvloo me can ntlozsd¥l_nu'ty . e wet. Sizes 2 id direct from (aortic!)ng £11 on uninsbook-ssntngsogifielg'wflo tom 21:: wm'ownuding, - - - uses: or", no. 2133 Empire Building, . ,. - Pimsqpflflufi" TEXT: “I am \a. debtor bot to Greeks and to Barbarians, both to t‘ e wise and I am ready to preach the gospel to you also that are in Rome.” Romans 1:45, 15. E/ had a splendid wife, and two farm, and a. church and school across the way. He should have been happy. But he was sad and brooding. “And what is your trouble, Mr. Jones?” “0, I am in debt and I would just as soon be in prison.” This is what my friend said to me on occasion. It was hard for this man to carry an obligation. He didn’t want any personal credi- tors around. But how different the Christian debtor! Paradoxical as it seems, the debt of the Christian is meant to bring joy and character into life. It delivers him from the prison of sin and selfishness over into the liberty of Grace and unself- ishness. “Owe no man anything, save to love one another”, another Pauline declaration, constitutes the perpetual indebtedness of the dis- ciple of Christ to all men. Paul takes the three first chapters of Romans to declare with great pos- itiveness the universality of the sin and moral guilt of all men. The human race had fallen into evil tend- encies. But he had reasons that the remedy is as wide in its reach as the disease. “A righteousness of God hath been manifested through faith in Jesus Christ unto all then that believe.” The principle of sin 'is the same in all races, but so the remedy. The realm of sin is not wider than the realm of Grace. There is something beautifully inclusive about the gospel of Christ. Here, at least, all men stand on the same plat- form of opportunity and hope. Let us notice first, the Christian’s personal reaction to this debt of service. Paul sets the mark for us. In him it became a homesickness. “I long to see you that I may pay off this debt”, wrote he to the.Romans. We can well believe this, for how many of us have heai‘d the mission- aries say as much about their foreign charges. But all of. mankind 'was on ’ IA slams 800K asses-:13... m mm; 0 the heart of Paul. All men were his creditors. He owed them the Gospel 1 that had been trusted to him for them. “Necessity is laid upon ‘me” said he; and “woe is me if I don’t pay off this debt.” You see the apos- tle was one of those men who could not wrap this obligation up in a nap— kin and forget about it. But this spiritual obligation to men attaches to every believer in the Gospel. We all are trustees of this truth. Are 'we worthy of it? Are we selfish with it? Are we trying to save it? Then we shall lose it. What is the matter with that pond of water. Whence the green scum and foul odor? It refuses to give re— freshingly to a thirsty soil. It lies there in a land pocket all by itself. Then do you wonder at so many sickly, foul—smelling Christians? And must we keep on giving? Is there not a limit somewhere? Yes, and here is the limit: “As much as in me is.” Our debt remains to bless us. We can’t get rid of it. We have no other honorable choice than to pay to the limit. But as to how much of it we shall be able to get done depends uponour years, oppor— tunities, and capacities. The one talent man is net expected to do as much as the five talent man, but he must do what he can. Every be— liever has his own debt to pay and God and mankind will hold him for it. But does every Christian take [his obligation so seriously? You answer. But why should anyone want to repudiate his debts? get on a house-top and herald the fact when someone pays his debt? Why not? Because it is but common honesty and self-respect. Now ap- ply this to religion and then see how different-the church and the world would be. How about apply— ing it to your owng‘community? If every Christian citizen were in dead ’cit'y‘or communi ‘ 18 tr Nov hr! .9 we might hB-Ye' he s, ~ ‘ ' to the foolish. So, as much as in me is, ‘ _not all one father? nice boys, and a pretty little, Do we. earnest about paying off his religi-i "ens-and social debt to the society in ; which he’lives, how like a. heavenly; its ciety because of the fact of human brotherhood implied in Creation. This creative idea throbbed in the hearts of the prophets. “Have we Hath not one God created us? Why do we deal treacherously every man with his brother?” Malachi 2:10. Jesus came to' earth to establish this ideal in the lives of men. This is the divine solvent for the racial frictions and the religious antagonisms of our or any other day. H. G. Wells, the Eng— lish author, says that the clashing of the races is the greatest present men— ace to the peace of the world. How, then, this emphasizes the debt that every believer owes to a world under- standing in Christ. ’ Paui,-a Jew. says he is in debt to the Romans, 8. Latin race, and he tells them about it in a manuscript written iniGreek. Verily, this was some new thing, and it all came about in a generation after Jesus proclaimed, “The Kingdom of Hea- ven is at hand.” ‘Faith can now see that this spirit is'destined to become world—wide in its work of breaking down racial and culture barriers. “Greeks and Barbarians” and “the wise” and “the foolish” yet exist; that is, the racial and culture chasms represented by this classification. I May I say a. few words in regard to the sermons. I think they are wonderful. The paper would not be complete without them. God be praised that Mr. W'arner is well and able to write again. Long may he live to send out the good news. His sermons does good and lots of it.— Mrs. C. A. J., Tuscola. County. I suppose we shall have to admit the educational snobbishness and the caste of learning among us that tend to socialstratification. But, it is also true that the tendency to one- ness through Christian education is growing;' Over‘I all the surface di- visions of mankind created by race, geography, education, or wealth, there is forming’a connecting arch, the keystone of which is understand ing and fraternity in Christ. For the Jew Paul, to have had such a faith was every whit a miracle; for that he is peculiarly the chosen race, still dominates the thought and faith ‘ of the orthodox Jew. But all this notion is to decay under the pressure of a religion that is persistently working toward the goal of a com- mon Father and a Common Savior. 'So then, we all eat and drink out of the hands of one God; we breathe the air, see the beauties, and hear the harmonies of a common Creator. We have the same heart yearnings for goodness and the same heart guilt for sin; and bless God, the same Savior. We are one in Christ Jesus. So, every Christian is set to radiate this fellowship atmosphere in the earth. He. is a debtor. We are debtors to society because of the social heritages that have been and are being passed on to us. My friend purchased property in a rapidly growing American city. In a few years he was wealthy. Why? Because of his personal earnings or efforts? Not that. Then why? Be- cause of his lucky (as he says) loca- tion, he became a happy, Sharer in the economic growth of that section of the city; a Sharer in the successes of his neighbors. In a few years he was luxuriating in an unearned sur— plus. And I said to him one day. “Friend, you owe a great deal to this community because of What the com- munity has done for you.” So do We all owe this community debt. Who would want to do without the social order brought by law enforcement.’ Without schools for our children, and without churches for our souls? Then We owe a generous support to these community agencies for right- eousness. - a ' ' - *Does America owe anything to, the world because of. imported benefits? EWhence the language through which, gw.e.,,cominunioate .One, with another? iWhence the origin of our-political» andmliglo ill , r " ' ' -. them anything? 9 What should be the: shining glory of America today? Car- rying to othern’lands bur literature; our school f, system; our industrial methodsjv-or rather our hearts of good-will and our debt of Christian- ity? And who knows but that Amer— ica has come into the community of nations for just such an obligation as this? Even so. But if we have, we must shift our living standards and revise our mo- tive. The recent Foreign Missions Conference at Washington charged our Western civilization with carry- ing great evils to distant lands. No wonder the high note of the conven- tion was to first Christianize Amer- ica. Paul said to his own people, “The name of God is blasphemed among the, Gentiles through you.” Can that be applied to AmeriCa to— day? Therefore, the debt Of Ameri— ca to the world is to lift mankind to the high levels of Christian broth— erhood. v Thus, we are bound to all men. There are other religions, but they are bounded by race and geography, and they are powerless because they are not full of grace and. truth. They are fading out in their contact with a religion that is destined to rule over all tongues. We have this re- ligion. Others do not. That, then, constitutes our solemn call and sum- mon. We are obligated to others in terms of Christian love and fra- ternity. BIBLE THOUGHTS MASTER, THIS WOMAN was tak- en in adultery. Moses commanded us that such should be stoned: but what sayest thou? . . He said unto them, 'He that is without sin among you, let him first cast a stone at her. -—John 8:4, 5, 7. BOA‘ST NOT thyself of tomorrow; for thou knowest not what a day may bring forth.——Proverbs‘27:1. PEACE I LEAVE WITH YOU, my peace I give unto you: not as the world giveth, give I unto you. Let not your heart be troubled, neither let it be afraid—John 14:27. RADIO DEPARTMENT By JAhIES “C H. WEIR, R. E. GETTING READY FOR LIGHTNING will not be very long before we will have spring weather "and with the coming of warm weather we must expect more or less thunder— Our~~v surplus “Do We owe ‘ A postal brings official “ Proof of Tests" that show "Galvannealed " uare Deal outtests any at er farm ence. The Indiana State University ; . . Hunt Laboratories. Chicago; (I. F Burgess Laboratories, Madison. V_Vis., and other authori‘ tree have tested “ Galvan— nealed." The official proof tells you all about it. We will also send a copy of Ropp’s Calculator that is the handiest helper around the farm. Answers 75,000 everyday questions. Square Deal Fence Cata- log tells all about: stiff picket-like stay wires that require fewer posts. hold fence tight and trim—no sagging; famous Square Deal Knot that cannot slip: full gauge wires; well cnmped ine_wires firme gripped to stiff stay wires with a_ knot that never slips, give good live ten- sion, secure against strains or sudden weather changes. All 3 free to land owners. Write today. WHEN WRITING TO ADVERTISERS, PLEASE MENTION “Sonny, this fence should still w r ‘ r as" «n? n be good when the farm he- comes yours” MI . \ . ‘ \~_._~ ._ .\ n r . I f ‘V ' ethod welds the thick bearing steel wire. ~— \g \'\\_ zinc coating We now mark “Square Deal” with a Red Strand. If the fence you buy does not have the Red Strand, then you are not getting the greatest value for your money. The “Galvannealed” process is owned and controlled by Keystone. On ordinary Galvanized Wire only a comparatively thin zmc coating can be applied. On “Gal- vannealed ” Square Deal 2 to 3 times more Zinc is used than on ordinary Galvanized w1re._ Everyone knows that the heavier the Zinc coating is, the longer the fence will last. But we have gone even further; KEYSTONE STEEL 8: WIRE 00., 4844 Industrial St., Peoria, Ill. Outlasts any other Farm Fence !. _ newly patented “Galvannealed” process applies 2 to. 3 times more zinc than the ordinary of galvanizing w1re. This new process actually This gives such an extra that you do not have to think of making another fence investment for many, many years. The long extra wear “Galvannealed’.’ Square Deal gives you does not mean extra price. Ga/deh’fifeé’firled Square Deal Fence (No Extra Price) iI ' i/‘r':}" V upon the amount of zinc coating. The right into the open hearth, copper— protection against rust It costs no more than ordinary kinds. than only protecting the “outside.” We have actually also protected the “inside” of the Wire by usmg copper with the steel. Official tests show that steel with 15 to 30 points of copper in it resists rust at least twice as long as steel without copper. It costs more to use copper—it costs more to manufacture “Galvannealed” Fence but this new Square Deal which outlasts any other farm fence costs YOU not one ten! more. You can buy this far longer lasting fence at no extra price. Mite for “Official Proof. of Tests ” THE BUSINESS FARMER storms. This raises the question as to whether or not your house and ' set is properly protected against fire from lightning. We would suggest that you write to the company in which you are in- sured asking ":hem what you must do in the way of lightning protection. Undoubtedl‘y they will tell you that you 'must use a properly grounded lightning arrester always connected to your set. The National Board of Fire Underwriters has 'ruled that this is a necessary precaution and to collect insurance for fire caused by lightning such arresters must be in— stalled. V If you do not want to have a fire in your house, or have your set spoil- ed by lightning we advise that you install a lightning arrester as soon as possible. They only cost from $1 to $3.50 each, and should be of a kind approved by fire underwriters. You know that your telephone wires are protected by lightning ar- resters and so should your aerial be. Indoor aerials and loops do not need ‘ this protection. ' A properly protected aerial has never been known to cause a fire by lightning. - m...— RADIO. PROGRAMS M. A. c. RADIO STATION, WEAR, East Lansing, 7:15 to 7:30 P. M. March 30—0. J. Weisner, “Feeding for Egg Production.” March 31—0. G. Card. Poultry Industry.” April 1 and 2—0. M. Ferguson, “Mar- keting Eggs and Poultry Products." - . April 3—H. J. Stafseth, “Poultry Diseases.” . April 6—J. 'A. Hannah. “Poultry Ex- tension Pro " "Michigan's , April 7—J. A. Hannah. “Poultry House . ' . Constru r- ctlon.” " , ~ , h" .. (1 .9—0 — ' E 5‘-.OOO H P POWER PLANT bATTLE CREEK —-> "AI-mm . “Ask ELECTRIC HORSES ' Back Your Investment 42 POWER PLANTS 32 of them water power, deliver 335,000 horse power to 164 Michigan cities and towns. You can become apartner in this business by invest- ' WW mg 1n—— * CONSUMERS P O'W E R PREFERRED SHARES TAX FREE .IN MICHIGAN V g .1). obligatign to buy! You try the famous lm° ‘ not thoroughly satisfied. to- turn at my expense. The Standard In Europe For More Than 22 Year: You get the closest skimming, easiest-turning, uickest to clean separator ever wilt. Has re- placed hundreds of thousands of machines all over Europe. Qual- Ity at bargain prices! From $33.80 up. Easy Monthly Pay- ments. Write today for free folder. W. C. MULLER. Pres. THE HARP SEPARATOR C0. not. 39A.1155.Dearborn 88. » Chicago ’ eon R HARP ysvsmr DAIRY A neuau.s“snrct£ut III-37‘ WILLLASTMONTHS SENT POST PAID Trial Box G and M CHEMICAL co. [3 luvs-n- Ave. W." BURNT. m ’ Have SHAPE” FEET Unmarred mm PEDOD YNE "Solvent." New way. Pain im- mediately vanishes. Acts like magical: worst Bunions. Hump gradually disappears. SENT ON TRIALfi-‘W arrange to send you I box of “Solvent” , try . , ‘ for your own bunion. Thousands are 3‘ Simply write. “I want to try PEDODYNI‘ , m momma. nomination-.5; no can. Standard Garden Tractor: AP ortulfl torCultlvuor orIA no a Ragnar-m: A "flu-se- _.t 0mm ’ 9 fr,gv‘,:;.¥'e.‘~y4,1»..;.—.~yw.tcn;.m% a: ' ~2‘ , s —. u . BUSINESSF MER SATURDAY, MARCH 28, 1926 Edited end Published by THE RURAL PUDLIMIIRG OOMPANV. lne. GEORGE AI. SLOOIII, President Alt. Clemens. women DETROIT OFFICE——1308 Kresge Buildine ‘ MW in New York. Chicago. St. Look and Minneapolis l7! ._ The Stockmandiusiness Farmer T110. Member of Agricultural Publishers Association Member of Audit Bureau of Circulation: Milan Grir'mell. ..... Jan ing Editor Kn. Annie Taylor._....._,.,...,___._._,.._.._. .__._._,.,__,.,_Fz-rm ome Editor L. W. Meets.......,.._....................Broedscope Farm News and Views 0- J Wright .............................................. ,.Soils and (‘rops “film? June's W. H. Weir ..... ._Radio Editor Charles A. Swingle .............................................. _.Le a1 Editor W F t . . . . . . . . . . . . . . . . . . . . . . ..Msr et Editor . . 00 Rev. David l". Warner .,...,Reli ous Editor Robert J. Mc nlgan.... flirculation Manager Henry F'- Hlukins .......................................... “Plant Superintendent Published Bl-Weekly ONE YEAR 600. TWO YEARS $1. FIVE YEARS 32. The date following your name on the address label shows when your subscription expires. In renewing kindly send this label to evoul mistakes. Remit by check. draft, money-order or registered letter; stamps and currency are at your ris. We acknowledge by first-class mail every dollar received. — Ad'mmfljl Rates: 45c per agate line. 14 lines to the column inch 772 lines to the page. Flat rates. Live stock and Auotlon Sale Advertlslng: We offer special low rates to reputable breeders of live stock and poultry; write us. RELIABLE ADVERTISERS We will not knowingly accept the advertising of any rson or firm who we do not believe to be thoroughly honest an reliable. Should any reader have any cause for complaint against any ad- vertiser in these columns, the goblisher would appreciate an im- mediate letter bringing all far to light. In every case when Kitins say: "I saw your advortisement The Hichisan Business. met!” It will guarantee honest (lea g. "The Farm Paper of Service " “THEY SHALL NOT PASS"—-—UNGUARDED! OR the past six months, as you who have fol- lowed this page, will remember, we haVe been calling the attention of railway, auto- mobile and farm organization executives to the alarming growth of accidents at railway cross- ings. This was driven home in the untimely death of Prof. Frank Spragg and family of East Lan- sing, a man who had done as much or more to improve the seed crop of Michigan than any other individual ever accomplished in a lifetime. Yet this valuable life was snufied out in a railway crossing accident almost in sight of his own home. Most of you, therefor, will appreciate the fact, that on Tuesday, March 17th, the House of Rep- resentatives passed a so-called stop law bill, which requires a. motorist to stop his automobile, before crossing a dangerous railroad intersection. This, we realize, is only one step, but it is in the right direction, and because it is sponsored by the railroads and the railway trainmen, we can now look for their support in securing suit- able automatic signals at every “blind” crossing in the state. The bill, as passed by the house, authorizes the State Public Utilities Commission to designate the crossings at which all traffic shall stop and requires the railroad to establish and maintain large stop signs at these crossings, so that the highway travellers shall have plenty of warning and opportunity to comply with the law. Among the most earnest advocates of the bill are representatives of the men who operate the railroad trains of this state. They urged that the strain of running trains over thousands of highway crossings in the state, is becoming al- most unbearable because so many drivers fail to cross the track with due regard to their own safety and the safety of those riding in the rail- road trains. If drivers of vehicles can stop at through streets in the cities as a. means of mak- ing travel safer, the trainmen argued. there cer- tainly can be no reason for not stopping at rail- road crossings where the danger is much greater. It is obvious that some further regulation should be put in the hands of the State Public Utilities Cdmmission which would make it easier to require railroads to properly protect the dan- gerous crossings. The automobile brought with it problems of safety to the public, and of particular interest to the rural community, because of the increase of these accidents among farmers and their families. We are proud of the part THE BUSINESS Fromm: I has played in insuring the enactment of this leg- islation and can assure readers that we will leave no stone unturned until every dangerous cross- ing in Michigan is suitably protected. If you know of a “blind” or dangerous crossing in your vicinity which is not protected, we would appreciate your communicating the facts to the editor. and we would especially appreciate a photograph of the crossing. WHERE THE FIFTY MILLION WENT! are not unconscious of the fact that some W readers of this page have criticised our Mouse of the administration and partic- ularly of the whichsweyhave siren to '1;919.‘i'v«. We that these critics of 7' would take'th‘e trouble Lto write Mr. for e copy of the book, mRoads Built-With the Fifty Million Dollar Bond Issue", which was issued un- der date of February 2nd. 1925. We do not contend for one minute that no mistakes were made in the spending of this vast amount of money. -We do contend that the work was so gigantic that no human or group of hu- mans could have accomplished what has , been accomplished without approximately the same ratio of errors. - . So far no reader has pointed out a specific instance of .mis-appropriation of highway funds— which has not been logically and cheerfully ex- plained and proven by definite figures from the State Highway Department. The report shows that as of January lst, 1925, 1711 miles of gravel road had been built, and a total of 1581 miles of macadam, concrete, as- phalt and brick pavement laid; a grand total of 3398 miles of road, including 244 bridges of greater than 30 feet span. For the construction of these highways, the department has spent the $50,000,000 raised by the sale of bonds and in addition, $14,000,000 of federal aid, 3. total of $64,000,000. Every farm which lies in proximity of an im- proved highway, open to motor traffic through- out the year, has been enhanced in Value and the total of this increase in farm property value, would, if available, we believe, make this amount spent, great as it is, look pigmy. The social, educational and religious advan- tages of good roads cannot be measured in dol- lars, and if we have helped to make farm life in Michigan more attractive, and helped to maintain a sound agriculture, with farm boys and girls remaining on the farms, then it has been worth while, no matter what the cost. ’ We feel that Michigan today can be justly proud of her road system. We believe that from this point on a more conservative program can be carried forward, based largely on the return from the gasoline and other privilege taxes, from those who use the roads. . -, We do not lose sight of tlfia fact that our good roads will bring millions of dollars of tourists’ money, which will be spread to Michigan farms and industry. In other words, we feel that the $64,000,000 has been one of the best investments the state of Michigan has ever made and we again commend those men who helped to make it a reality. - Some day a monument will probably be erected to the men who built the first paved roads in Michigan so we can not feel that it is unbecom- ing to pin a posey in their lapels while they can still enjoy its fragrance! SHALL OUR RIVERS BE SEVVERS? RACTICAL Christianity and good citizenship both demand of us that we jealously guard the rights of our fellowmen and conserve and develop the natural resources with which Providence has so abundantly blessed us. Nature has spread her gifts with such a lavish hand in America that we are just beginning to appreciate the solemn obligation which is ours to protect this heritage for future generations. We may talk ourselves black in the face about fish and game laws, closed seasons, fish hatch- eries, bag limits and other similar more or less ineffectual methods of conserving fish and other forms of wild life, but there is one thing that is fundamental and of primal importance. We re— fer to the prevention of wholesale pollution of Michigan streams and rivers through making them open sewers into which industrial wastes, acid, alkalies, oils and municipal sewage is dumped promiscously regardless of the serious consequences to fish and wild life, public health and the tourist attractions of our fair state. Space does not permit a lengthy portrayal of the vicious and disgraceful conditions which now exist along such rivers as the Flint, the Grand, the Saginaw, the Huron and the Kalamazoo. As Michigan becomes more and more of an industrial state and as our great centers of population grow and multiply by leaps and bounds, the prob. lem becomes more and more perplexing .and the menace ever more ominous. The only bright feature of the whole situation is that conditions I have ‘bec'ome so serious that they are attracting attention from those whom we trustfimay aid in their solution. For instance, Govérnor Gross- beck in his message to the legislature when that body convened for its present session, declared: “Little headway has been or is now being made to stop the unnecessary pollution of our water supp_ly—-—rivere, streams and lakes. Your com-_ mittees having charge of; this subject should, if possible.pW' schemes! roc aura as; , cost of inhibiting ' " somerte-1...g...x-,.,,.,,fiam_, u Smedley AhtiaPollutibnbllI (House Bill 385, Mg 105). "The purpose and him. of the mm is cor-n telnly commendable. Its provisions seem fair, reasonable and statesinanllke.‘ Its enforcement would be placed in the Department of Conserva- .' tion, doing away with the present overlapping of jurisdiction of the Department of Conserva- tion, the Department of Public Helath and the Attorney General’s Department. We shall watch developments on this legisla- tion with interest, and earnestly commend the Smedley bill to the careful consideration of the kmembers of the Legislature and of our readers. STICKING TOGETHER OR BEING STUCK‘ “ HE mills of the Gods grind slowly, but they grind exceedingly small." Farmers are the most conservative class ‘of people on earth, but certainly it cannot be said that they are un- progressive. They are not only adopting better methods of individual production, but they are learning to work together for the solution of their common problems in a measure totally'un- dreamed of by the farmers of yesterday. A casein point is the way in which the steer feeders and dairymen got together when the so- called Espie bill was attracting so much consider- ation and discussion before the Senate Committee on Agriculture recently. This measure, intro- duced by Rep. John Espie of Eagle, would have prevented the importation of any untested cattle. including feeding steers, into any county where bovine tuberculosis eradication work was being carried on. ' The bill had the strong backing of the' dairy interests of the state, which desired protection of their herds from possible infection. which might be brought in through untested feeding stock. With this support it passed the House by a strong majority and went to the Senate, but the steer feeders saw practical difficulties in car- rying out the provisions of this bill on a com- mercial scale, so they arranged for a big hearing to be held before the Senate committee and plan- ned to bring in a large delegation of steer feeders and register vigorous protest. However, it appeared to some farm leaders that such plans could only lead to a jam and a. wrangle which would confuse the Senate com- mittee and make it appear to the city members that the farmers were divided and did not know what they wanted. With this thought in mind, a conference Was held on the night preceding the public hearing, and after both sides had ex— plained their position, a committee was appointed which reached a satisfactory compromise and submitted it at the public hearing the next morn- ing. By so doing the feeders and dairymen have set a splendid precedent in real agricultural co- operation. When farmers learn to think individually and yet act collectively through their organizations and abide by the decision of the majority it will be the dawn of a new day in rural life. Agricul- ture can never be placed on a plane of equality with other industries until farmers are effec- tively organized so that they may have a united voice in halls of legislation and whenever their interests are at stake. FARMERS’ LEGISLATIVE PROGRAM FARM organizations in California, including * the State Grange, Farm Bureau Federation, Farmers’ Union, Farm Legislative Commit~ tee and marketing organizations are united in a statement that public utilities owned by cities shall be taxed, and that issuance of all tax-free securities shall be. prohibited. These two propositions are perfectly logical when it is considered that cities operating public '1rtilities issue tax-free securities with which to construct the some. thus exempting large proper— ties from taxation. and fit the same time enabling large financial interests to escape their federal in- come taxes. Tax-free, city—owned utilities built with issues of tax-free securities create a privileged condition for dwellers in cities and cast a double burden upon the owners of the farms that is arbitrgry, unjust and absolutely unfair in its op'eratlSns, 'The Petaluma Argus, chempionlng sgrlculture’s major legislative program. says, editorially: “Those who evade this state tax live almost (entirely in our cities. The amount of this tax. now being shifted upon the backs of those who live outside the larger cities, especially upon the farming class, amounts to millions of dollars an- nually. ' ' publicly own ed should c' to. an s " ' e Governor, regiments» new hei before it the -HHA 1m- ! 99.nfl00flfififlflfimubumr’dduuhn «There are good juvhy HOSPITAL HEN we originally received the advertisement from the above » institution, from our advertis- ing'representative in Ohio, we se- cured his endorsement of the pro- position before the advertising was inserted in our columns. Then for over a year, we carried this adver- tising continuously and never hav- ing a complaint, we did not further qhestion it. ' Two months ago, however, a reader questioned the advertising, and we withdrew it from our col- umns, pending an investigation, which we are just bringing to a close, and which we are pleased to state not only gives this institution a clean bill in our minds but shows, in fact, that they are doing worthy work in curtailing, at least, the ravages of one of humanity’s most gruesome scourges. We make this statement based on letters from more than a dozen patients in the state of Michigan, who have written us regarding their experiences with the Indianapolis Cancer Hospital, and who have With- out exception, volunteered their testi- monials of the service rendered by this institution. ’ , Apparently all that the American Medical Association has against this institution is the fact that—they ad- vertise their services, which We be- lieve, if practised by all physicians, would have a salutary effect on the efliclency of their methods. We have always held the idea that if doctors were forced to advertise the number of cures or kills they made, in competition with others ‘in their same profession, who were bid- ding for work, it would have a tend- ency to improve the quality of their service and be of genuine benefit to the public. We don't mean for one moment that we believe in all advertising doctors, but we do believe that a good doctor ought to advertise that fact, and because he does will not make him a poor doctor. SPANISH PRISONER IN JAIL AT LAST famous ‘Spanish Prisoner" I ' who for years has solicited the sympathy, assistance and funds , of people all over America, has at I last landed in jail according to re- ‘ ports from Spain. And his name is ‘ "General" Ramon de Santa Clara. Our readers will remember the ex- ! pose of this world wide fraud we . published in the November 8th, ' 1924, issue of Tun Busnvsss Fm. ' You will remember how his scheme 1 was to write a letter to the intended victim telling that he was imprisone in Spain by bankruptcy and “ I be- seech you to help me to obtain the sum of 360,000 dollars I have in America, being necessary to come here to raise the seizure of my bag- : gage, paying to the Registrar of the . Court the expenses of my trial and : recover my portmanteau containing ‘ a secret pocket where I have hidden ' two checks payable to bearer for i that sum. As a reward I will give up to you the third part, viz: 120,- 3 000 dollars.” He then stated he ‘ could not receive the letter in prison 'andaskthatitbedirectedto friend whose name he gave, and con- . eluded with “First of all answer by cable, not by letter.” ' The reader who sent us the letter we published with our expose did not The pal-nose of thls department I. he: ou- ubecriben from fraudulent Harmful!- human: a mo. lnovflyosuwewllluouI-b-tu are» Mll- by "Honest-comet a satisfactory t or force won. for which no charge for our services will ever be made, providing: ‘ - "in the U. 8. Patent Office. the merits of the product to, which - t , m N fall for the bait .but enough people have been-victimized during the last . fifty years, it is declared, that he has accumulated a comfortable fortune. We heard of a man in Brook- lyn, N. Y., who received one of these letters and replied by cable. He had considerable correspondence with the “Pr‘snner” and finally went to Spain. After spending most of his money he received a check and the instructions not to attempt to cash the check un- til he heard further from them. Shortly after landing he received the following letter from the “Prisoner”: “Dear Sir: The object of this letter to you is to reveal the whole affair which you came here about. Being without friends, to make our living we thought of this method to save us from the crisis we are in. “The check we gave you is without doubt a wet paper, like- wise all the operation we made has all been comedy, and so we notify you so you won’t be fool- ish and present the check to cash it, for you are liable to ar- rest‘for presenting a fflse docu- ment. ,, “In case our businessvpros- pers we would return the money you have given us with much pleasure. We hope you may prosper in business and make your fortune. Just because the world calls us Gentlemen of In- dustry, don’t think for a minute that we have no noble blood. So permit us to mention again that we hope you may gain your fortune, and so, wishing you goer‘speed in life, I am, sir, yours truly, R.” BALD FAOI‘S ABOUT BALDNESS “Enclosed please find circulars about hair restorer, etc. Is this a fake or are they reliable people and responsible and will they return the money as agreed it you receive no benefit from use of same?" HAVE never heard of the Kos- kott Laboratory of New York City and have had no occasion to investigate them, but after reading their literature I would say that I am skeptical of their proposition. N You know 'and I know that for ages scientists and medical men have been searching the world over for a treatment that would produce hair on a bald head and the only way they have found successful so far is to purchase a wig. , Some publications are full of ad— vertisements of this nature while all the time baldness is on the gain. Not long ago I read an article by a well known scientist and he de- clared that the day was coming when the human race would not have hair at any time during their life. I have‘ heard many arguments on this mat- ter and it seems that nearly every scientist has his own solution as to why people are becoming bald more and more. I put the question to a doctor who is rather bald himself and he laughineg replied "Because man is not a fur bearing animal”. I think his answer is as good as any. If the treatment offered by this company is such a sure cure they should be able to furnish you with complete names and addresses of any number of people throuth the United States, many of them in Mich- igan or in near states who had used their treat I t and tell you in glowing terms \. at they thought of the wonderful treament. “TIP SIN" WILL NOT CUBE TUBERCULOSIS National Vigilance Committee has issued a bulletin regarding John Hamberg at Coeur d’ . Alene, Idaho, who is advertising “th Sin" at $3 a buttle with the sta ment. “Tuberculosis bacilli de- stroyed in six days.” The bulletin states that some periodicals have ac- cepted this advertising » because the word “Tip Sin" has been registered Atten- tion is directed to-the fact that regis- tration of a trademark carries with it» no endorsement whatever as to 1‘ » atio Visib- The safety and generous interest yield of the first mortgage bonds We offer have earned them a sound preference among the more successful farmers. Write for Booklet AG1372 Tax Free in Michigan Normal Income Tax Up to 4% Paid by Borrower 61/2% Federal Bond €99 Mortgage Company (1372) FEDERAL BOND & MORTGAGE BUILDING, DETROIT It’s the Planting that Makes the Home APPLES, 5-6 fL, All the varieties 55‘ no per 100 FEARS, 5-0 ft... All the Ieadlng varieties ...... .. 75. per 100 CHERRIES, 5-6 n... All the leading varieties 70.00 per 100 PLUMS, 5-6 ft.. All the leading varieties................. 70 00 per 100 PEACHES, 3-4 ft... All the leadan vametues................ ._..-._.. .-I--.-_-.- 82.50 per 100 GRAPE VINES. 2 yr. No. 1. .. .. 15.00 per 100 MPLETE ABSOBTMENT mamas?"dfisi‘irts?rXis""m"""s“‘;.;a“‘s6§ss:“7;mwms FOR CO scary YEARS—ORDER WITH CONFIDENCE. FINGER LAKES NURSERIES 450 Washington St. Y. emu. KILL RATS QUICK nus NEW sum: wnv ~ NOT A POISON Why suflcr hundreds of dollars’ loam fromtheravageeofratsand micewhenyoucan nowsoeaalygetridofeveryoneof in less than a week? Rat-Flu. the wonderful French discovery. re- cently increased to tripleby 1. FamAccozmtBoak and Catalo of —- SuPeZinc-ed bactefiologist, is sure. tuck to rats. mice and all rodents, but abgolntely to human beings. It is not a cess the zinc is so closely bonded to special-formula steelwieihstitwillnotu‘ack or peel. You now get Super-Zinccd rust ' inboth Col- um ia Hinge-Joint and Pittsburgh edect Stif- Stay Fences,made in stand- ard farm and poultry styles, and in oursupcrb anddistinc- tivelawn fmml'hsyarcsold by a dealer near you. Mae.‘rk~.t g:— .- v .-. at? “foy‘fihggy ‘10, Q CEMENT combined with water will bind together several cubic feet of sand and twice as much stone or gravel. Result: handsome, permanent improvements that you will never have to replace because of rot, rust or fire. ALPHA CEMENT improvements requre no paint. They save you money year by year. Alpha Portland Cement Company CHICAGO, ILL. EASTON. PA. Battle Creek, Mich. Ironton, Ohio St. Louis Pittsburgh Philadelphia Boston New York Baltimore . -'-. . ’.'-' ‘ '. I. '. - . ' “ . ~I' ’ -. . ' i -.. . . .- -- - c, . .. ...s._ ‘-... _- I. 2.. ‘ . ' -‘ . . ' . , . ,.. ._. _. ._ .‘,-“~..\'., ,. _ s. ---'.- r - .-n. a. - l' r . .. . flfi.?,..._< la.“ 3* hols ,1 4‘ .’ t ~ ,‘ o. I” < I? kiss a- ‘ I. . . / '6 be. -. s...” - ‘ '9. I on -- .. u ' l ..,... o .. —.... .i. e ft .93 $3? n a ‘ 'v. 6615'?»- m «rd gvfiafihawm an???“ ' é. a , mutant that make a horse Wheeze, ' Roar, have Thick Wind or Choke-down. can be reduced with ~ also other Bunches or Swellings. No blister. no hair gone, and horse kept at work. Eco- nomical—only afew drops required at an appli- cation. $2. 50 per bottle delivered. Book 3 ll me. IBSOBBIIIE, ill. the antiseptic liniment for man- kind, reduces Cysts, Wens, Painful, Swollen Veins and Ulcers. $1. 25 a bottle at dealers or delivered. Book “Evidence” free. w, F. YOUNG, Inc., 369 Lyman St.,Springfield. Mass. Tlllcll, SWOLLEll turns \ Qualify in Eight Weeks toEarnReal Money lathe Auto and Tractor Businss Come to the great shops of McSweqny where thousandsofdollars have been spent in the latest tool: and equipment. Stay only eight yveeks, then ste ou ias an expert. My train- ing made Louis eimer a Foreman at the age of2fl. Itstarted O. H. Justus in whaii 3 now a big business. it enabled E. Rushfeldt to earn $10a day. it has helped hundreds of others to do as well or better. Big Firms Need Men I get calls every day from Garages, Battery Stations, Auto Repair, Welding Shops, and other successful firms for McSweeny men. . The big fellows need trained men right away and they know where to come for them. ' - ‘ i u of . . \\ VT;— . -..- _. __ o " - Railroad Fare Free " ’ That’s my proposition for a shorttime only to I Ann-0,. mg “a wood mu, m q”... help fillthese vacanCies. But that’s not all. end powerlul. One-third the work- ing part- of any other mill. Only main Putin-n hearing when to wear. This (is oilluc,b nnr‘ii easiljlgle- place even" open e weight without min“ Friu any 4pc“ necliower. Whynouhonen our chore now with a (cod (Windmill) This it your chance—F. O. B. Albion. Erea it yourseli. your 5.; dealer. or inherited to l fyou write atonce I’ll give you the lowest tuition rate ever offered. Get This Big Free Book This largeillustrated book tells how others are succeeding. It tells many things you ought to know abou t Autos and Tractors. Write fori t and shorbtime offer now before it expires. Write to nearest school for it today. -, - -""‘°"s‘°‘-‘M"‘“°“L"" McSWEl-ZNYAUTO A -. « mm. as m crox . won. u. at TRAINING SHOPS \ ; Dept. 142 Mu \\ 9e and Walnut 5a. cams. on. ' cl‘ 1815 But an. Sh. Cleveland. on. DON’T WEAR -' A TRUSS BE COMFORT BLE—-—- \_‘ Add c 4 co, the 3:: thasionnafichhfvenm which Kimmruptur Dewberry a, Plants; 31.113" Czficlmhafi It." ""f’°ti..“"; '."I ,_. 33'. (Continued from March 14th issUe.) THINK I can be here this afternoon.” Alan said. “Would two—thirty suit you?" "As well as any other time.” “Let’s say two-thirty, then," Spearman turned and noted the hour almost solicit- ously among the scrawled appointments on his desk pad; straightening, after this act of dismissal, he walked with them to the door, his, hand on Sherrill’s shoulder. “Circumstances have put us—Mr. Sher— rill and myself—in a. very difficult posi- tion, Conrad,” he remarked. "We want much to be fair to all concerned—” He did not finish the sentence, but halted at the door. Sherrill went out, and Alan followed him; exasperation— half outrage yet half admiration—at Spearman’s bearing, held Alan speechless. The blood rushed hotly to his skin as the door closed behind them, his hands clenched , and he turned back to the closed door; then he checked himself and followed Sherrill, who, obviously to Alan’s excitement, led the way to the door which bore Corvet’s name. He opened it, dis- closmg an empty room, somewhat larger than Spearman’s and similar to it, except that it lacked the marks of constant use. It was plain that, since Spearman had chosen to put off discussion of Alan’s status, Sherrill did not know what next to do; he stood an instant in thought, then, contenting himself with inviting Alan to lunch, he excused himself to re— turn to his office. When he had gone, closing the door behind him, Alan began to pace swiftly up and down the room. What had just passed had left him still breathless; he felt bewildered. If every movement of Spearman’s great, handsome body had not recalled to him their struggle of the night before—if, as Spearman’s hand rested cordially on Sherrill’s shoulder, Alan had not seemed to feel again that big hand at his throat -—-he would almost have been ready to believe that this was not the man who he had fought. But he could not doubt that; he had recognized Spearman be- yond question. And Spearman had recognized him——he was sure of that; he could not for an instant doubt it; Spear- man had known it was Alan whom he had fought in Corvet’s house even before Sherrill had brought them together. Was there not further proof of that in Spear- man’s subsequent manner toward him? For what was all this cordiality except defiance? Undoubtedly Spearman had acted just as he had to show how undis— turbed he was, how different he might be to any accusation Alan could make. Not having told Sherrill of the encounter in the housw—not having told any one else——Alan could not tell it now, after Sherrill had informed him that Spear- man opposed his accession to Coi‘vct’s estate; or, at least, he could not tell who the man was. In the face of Spearman’s manner toward him to-day, Sherrill would not believe.‘ If Spearman denied it—and his story of his return to town that morning made it perfectly certain that he would deny it—it would be only Alan’s word against Spearman’s—the word of a. stranger unknown to Sherrill except by Alan’s own account of himself and the inferences from Corvet‘s acts. There could be no risk to Spearman in that: he had nothing to fear if Alan blurted an accusation against him. Spearman, perhaps, even wanted him to do that-— hoped he would do it. Nothing could more discredit Alan than such an unsustain— able accusatlon against the partner who was opposing Alan’s taking his father's place. For it had been plain that Spear- man dominated Sherrill, and that Sher- rill felt confidence in and admiration toward him. Alan grew hot with the realization that, in the interview just passed, Spear- man had also dominated him. He had been unable to find anything adequate to do, anything adequate to answer, in 01)- position to this man more than fifteen years older than himself and having a. lifelong experience in dealing with all kinds of men. He would not yield to Spearman like that again; it was the be- wilderment of his recognition of Spear- man that had made him do it. Alan stopped his pacing and flung himself down in the leather desk—chair which had been Corvet’s. He could. hear, at intervals, Speanman’s heavy, genial voice address- ing the ship men in his office :«its‘ tones—— half of comradship, half of command— told only too plainly his dominance over those men also, -.-He heard Spearman‘s office door open and some of the men go out; after a. time it opened again. and the rest went out.. ,He heard Spearman’s voice in the outer office. then he heard it again as Spearman returned alone into his private office. . There was :a telephone upon Corvet's desk which undoubtedly connected with the switchboard-in the general Office- Alan picked up, thereceiver and asked for "Mr. “Spearmint.” . voice answered."ff.YeS-"~ ' . "This is Conrad; ’ ' 7" I At ones, 'the hearty div-ab ndian‘, Dgum 00mm by Edwin Balm-r denly again the harsh voice of the man who had called down curses upon “Ben” and on men “in Hell” in Corvet’s library. Alan sat back in his chair, smiling a little. It had not been for him, then-'— that pretense of an almost mocking cordi— allty; Spearman was not trying to de- ceive or to influence Alan by that. It had been merely for Sherrill’s benefit; or, rather, it had been because, in Sherrill's presence, this had been the most effective weapon against Alan which Spearman could employ. Spearman might, or might . (' not,\ deny to Alan his identity with the man whom Alan had fought; as yet Alan‘ did not know which Spearman would do; but, at least, between themselves there was to be no pretense about the antagon- ism, the opposition they felt toward one another. Little prickling thrills of excitement were leaping through Alan, as he got up and moved about the room again. The room was a corner, and there were two windows, One looking to the east over the white and blue expanse of the harbor and the lake; the other showing the roofs and chimneys, the towers and domes of Chicago, reaching away block after block, mile after mile to the south and west, till they dimmed and blurred in the brown haze of the, sunlit smoke. Power and possessionwboth far exceeding Alan’s most extravagant dream—“were promised him by those papers which Sherrill had show him. When he had read down the list of those properties, he had had no more feeling that such things could be his than he had had at first that Corvet’s house could be his—until he had heard the intruder moving in that house. And now it was the sense that another was going to make him fight for those prop- erties that was bringing him to the real- ization of his new power. He “had” something on that man—on Spearman. He did not know what that thing was; no stretch of his thought, nothing that he knew about himself or others, could tell him; but, at sight of him, in the dark of Corvet’s house, Spearman had cried out in horror, he had screamed at him the name of a. sunken ship, and in terror had hurled his electric torch. It was true. Spearman’s terror had not been at Alan Conrad; it had been because Spearman had mistaken him for some one else—for a ghost. But, after learning that Alan was not a ghost, Spearman’s attitude had not very greatly changed; he had fought. he had been willing to kill rather than to be caught there. Alan thought an instant; he would make sure he still “had” that something on Spearman and would learn how far it went. He took up the receiver and asked for Spearman again. Again the voice answered—“Yes.” “I don’t care whether you’re busy," Alan said evenly. “I think you and I had better have a talk before we meet with Mr. Sherrill this afternoon. I am here in Mr. Corvet’s office now and will be here for half an hour; then I’m going out.” Spearman made no reply but again hung up the receiver. Alan sat waiting, his watch upon the desk before him— tense, expectant, with flushes of hot and cold passing over him.‘ Ten minutes passed; then twenty. The telephone ' under Corvet’s desk buzzed. “Mr. Spearman says he will give you five minutes now,‘ the switchboard girl said. Alan breathed deep with relief; Spear- man had wanted to refuse to see him— but he had not. refused; he had sent for him within the time Alan had appointed and after waiting until just before it ex- pired. Alan put his watch back into his pocket and., crossing to the other office, found Spearman alone. There was no pretense of courtesy now in Spearman’s manner: he sat motionless at his desk, his bold eyes fixed on Alan intently. Alan closed the door behind him and advanced to- ward the desk. “I thought we'd better have some ex- planation,” he said, “about our meeting last night.” ' ,7 “Our meeting?" ‘Spearman repeated; his eyes had narrowed watchfully. “You told Mr. Sherrill that you were in Duluth and that you arrived home in Chicago only this morning. Of course you don’t mean to stick to that story with me?)’ . “What are you 'talking about?" Spear- man demanded. .. r “Of course, I know exactly where you were a part of last evening; and you know that I know. I only want to know what explanation you have, to offer. 'Spearman leaned forward. “Talk sense and talk it quick, if you have anything to say to me!" ' 4 "I haven’t ~told. Mr. Sherrill that 'I found you at Corvet’s house“ last night: but. I don't "Wont .you to doubt for a minute that I know youT-and about your damning ‘of Benjamin Cor-vet and your out " flag the Miwaka!” 1 load cargo to» Swan's " V ‘4 :::« -- Iwmmwtyuw‘uflwwfiw‘e'HW'SHUQ'gfl 0 l anv’JOhDQWUH‘ETI 8°? ' 'r is" OILS AND-CROP 8: Edited by C. J. WRIGHT, Cass County :23 Contributions Invited—Questions .Answered ALFALFA OLKJS are beginning to plan on sowing alfalfa. The idea of this article is not to condemn the methods of others or paint a picture, overdrawn as to the place, of the master legume crop of the farm. Throughout the farming world theory has been raised “raise alfal— fa" and great steps have been taken toward the goal. , A great many failures have taken place among those who tried to grow it, and a fair average at successes has also been noted and every failure or success has had its underlying cause. These causes have been deter— mined and While the crest has not been gained we know enough about the essentials of growing it that any- one anywhere in Michigan can grow it if he has the following things at his command. First, a drained piece of soil (because'alfalfa will not grow in water) the richer the soil the better the growth, with alfalfa as any other crop. Second, a limed soil or a natural sweet soil. Third, a solid, well-worked seed bed. Fourth, plen— ty of inoculation with nodule form- ing bacteria. Fifth, Grimm or hardy northern grown seed. Much has been said about how to sow alfalfa and when you- sum it all up, it does best sowed as a crop, and not as.a catching seed in some other grain as in nearly every case the protecting crop becomes a robber and limits the growth of the alfalfa plant, although some good stands have been obtained that way. . The best ground for alfalfa 1s a rich sandy loam, but it will grow good on a heavy clay loam but as a rule the second cutting is not as rank as on the lighter loam. If your ground is sour you must lime it and there is no way of get- ting around it. Let me say if you have plenty of manure and humus as you will find in an old garden alfalfa will grow there even if it has not been limed and many times people think if they can grow it in the gar- den they can grow it in a field and in every case they are doomed to dls- appointment. But the farmer as a rule is from Missouri and will try a. stunt like this to satisfy himself. How much lime shall I use? is the question of most people. That de— pends [on the section in which you live, but in any case not less than 2 tons of ground limestone per acre and your success will be much better if you use from three to five tons of the ground limestone. If you are not convinced of this sow a strip with tWo tons, one with 4 or 5 tons along side of each other and watch the crop each year and it will tell you the story far better than it can be put on paper. Lime should be sown as long before sowing the seed as conditions will permit. In most cases where land is plowed in the fall lime should be sowed as early as possible the following spring and well harrowed in the soil as a. lime particle must be brought in con— tact with a soil particle in order to neutralize it, so the early application with frequent harrowing until seed— ing time is the best. This frequent harowing retains the moisture and nitrifies the humus in the soil so when the seed is sown it springs up like magic even though it is seeded during a drouth. This frequent harrowing and early plowing and liming is the big augur in raising the crop. From June to the later part of August is the ideal time for seeding although some good stands have been grown by sowing in the early spring and as late as the later part of September, but they are the exception rather than the rule. Eight to twelve pounds of good Grimm or northern grown common seed is enough according to how you sow—with a seed drill or broadcast and sow the seed as shallow as it can . be sowed and yet be covered. -Many a. good prospect has been ruined by? getting the seed, sown too deep. Some times a. dashing rain, such as we get at this time,of the summer. will cover the little plants up with soil aftermthey have sprouted and . have two leaves startedso it is nec- , ‘ ground" as -i “7* " was i... tow: lag 51$ 2. and s crops practically spoiled. This .may not happen'as bad on sandy or grav- - elly soil as on the heavy clay soil of this section as it usually crusts after a hard rain. We have sown alfalfa on Saturday, July 4th and on 'Mon— day, July 6th it would be up. That doesn’t seem possible, but it is a fact. And by all means don't forget to in- oculate the seed with nodule forming bacteria as all of the previous steps are practically worthless unless you do this and the cost is so small that you can not afford not to do it. Twenty—five cents will buy enough to treat one bushel of seed but one can use two, or three bottles for one bush- el. You. can get it of your county agent or the M. A. C. We generally use three to four bottles per bushel as you can not get too many of these little organisms in your soil and if you sow broadcast lots of them are generally killed by'the sunlight be- fore the seed gets covered. The old method of inoculation by taking soil from one field to the other has been done away with, and by using the pure bacteria cultures it is done so much more easily and efficiently. There is one fact about alfalfa that . one does not hear about and few peo- ple have thought of it. Its roots pen— etrate in many cases 20 to 40 feet deep and it derives lots of its chem- ical food from these depths and stores them in the plant tissues of its make-up, thus rooting 10 to 20 times deeper than any other crop on the farm and reaches a food supply that is reached by no other farm crop. It also produces two or three times as much hay as the other mem— bers of the clover family and runs as high as 60 per cent protein, which is 15 per cent more than the clovers or vetch, making it by far the best for— age for dairy cows. It, like its other relatives of the clover family takes when the bacteria is working 66 per cent or two-thirds of the nitrogen it uses from the air. It is a heavy feeder of lime, phosphorus and pot ash, in fact one of the heaviest of the farm crops and where a person can do it, an application of from 300 to 500 pounds of acid phosphate can be used to a big advantage. A top dressing of stable manure or fine rotted manure of any kind ap- plied real early or just before seed- ing is of great benefit. Though one gets extra trouble from weeds by so doing it is one of the factors in get— ting a good seeding. We can sum this article up as fol— lows: - Plow your ground early in the fall before if possible. Lime early with from 3 to 5 tons of ground limestone per acre. Harrow the ground shallow and often. Sow with Grimm without nurse crop from June to September 1st. Be sure to in— oculate seed with plenty of culture. Plant seed shallow. Manure if. pos— sible as top dressing. Use 300 to 500 pounds of acid phophate per acre if possible. You may think that this is too costly and causes too much trouble to get a good stand but this is what happened in our owu experi- ence, we being the first to raise al- falfa in this section. Our soil is a clay loam covered originally with beech, maple, white wood and wal- nut. Folks said that we could not raise alfalfa on the land and I want to tell you what we did on a one and three—quarter acre plot of land. This one and three-quarter acres 'was a neck of a field caused by taking out a building site and orchard. It had been farmed with the rest of the field for years. I plowed this ground right after oat planting having ma- nured it rather heavy throughout the spring. It was a June grass sod. After it was plowed I put on ten tons of fine limestone divided into three strips of three tons, four and a half tons and six tons per acre, running lengthwise of the lot. Then I sowed 1,000 pounds, Of 16 per cent acid «phosphate on the lot and top dressed it again with manure. I kept it har- rowed until July 17th and I sowed it ‘with 22 pounds or Grimm seed inocu- lated with two bottles of culture. using a grass seed drill. The lime cost $40.00,.acid phosphate $18.00, and _,c.ulture cost, $22.60, :1: - aggeun 3 I v! s ~ . .- x W a,» 4 “vs-ps'I-N E ss, '19: A R M E a . MM. 9% “Miami?” ,"f‘flt‘i Strength and Durability Zinc Insulated American Fence with itshcavy uniform zinc insulation against rust is as different from ordinary fence as Banner Posts with their railroad rail con- struction and slit wing anchor plate are different from ordinary T-Steel Posts. Banner Steel Posts with their railroad rail design have the strength to hold the fence securely in line, plus the solidity to " withstand the strain of installation and many years of hard service. ‘ ' Easy to Attach Line Wires Continuous rows of notches close to- gether, running up and down both sides of the post, provide easy attaching of line wires. Wires easily fastened with Zinc Insu- lated “Hump” Fastener, which snaps on ” both sides of the post and holds wires securely. Also note how the notches extend out n... and away from the body of the fence so that snow, moisture, etc., cannot lodge, and start rust. ‘\ "‘ ( ‘u Large Anchor Roots the Post .5. ’ Into the Ground Note the split fine. As the first fin cuts a slot in the soil the second fin crowds dirt over it and the third fin closes the opening cut by the second. Banner Posts hold their anchorage while the fence is being stretched. Design Patented. American Zinc Insulated Fence (insulated against rust) and Banner Posts are sold at no extra charge. yet give you so many more years of service, that they provide the most economical ‘ fence you could own. See them at your dealer's. Practically all of the leading railroads in the United States use our fence and poets. Our fence is selected and used each year to enclose pens at the International Live Stock Exposition held in Chicago. l '\ / j \ é} “ K; J. i e L‘ W ‘ (.\ 5 . 1 r r K v, r: l e a I e e e e . . A- American Steel & Wire Company ' Chicago NervYork Boston Dolled Dem:- » .,,.:..1_oop'.-.. ' - gm pan sul-Wfll-‘l‘.’ 'i * girls and boys: Hurrahfor the contests, and hurrah for the girls and boys who keep me so every time we have one! I am ‘_ happier than when surrounded , caps of letters from the members i the Children's Hour, and I am happy now because the letters re piled so high around me that I fan hardly see over them—and more one in every mail. :3, The judging on our motto, colors nd pin contest has been concluded d the prizes are being forwarded. _ The motto finally chosen is “Do .our Best" and was submitted by thel Fay Sharp, of Akron. The _’" and best motto, acording to the rdges was “Never Say Fail”. Odeal a vassem, of Auburn, wins second prize for sending it in. The popular color combination was blue and gold, and Anna Eliza- beth Smella, of Standish gave the best reasons for using these colors 0 first prize went to her. She said 'lue means loyalty and gold happi- ess. Second prize on colors went o Violet Luepnitz, of Allendale. , First prize for the suggestion as j” the'design to have on our pin was warded to Anna Bliss, of Bancroft, and Lola C. D. Ewald, of Unionville, second. , Let’s stop and consider our motto and colors more fully. They are: Do Your Best Blue and Gold Stop and think what the three words, “Do Your Best" can mean. If you will do your best you are bound to be a success in this world. And the colors, blue and gold, loyal- ty and happiness. Loyal to your parents, your friends, your associ- ates, your club, your country and its explains itself. We hope to nave the pins soon, but do not get impatient because I want all of you to have one and ‘wear it proudly, and I will let you know as soon as I receive them—UNCLE PCs. You have noticed that I did not tell you what is to appear on our pin. That’s to be a surprise—U. N.| H OUR GIRLS AND BOYS "Dear Uncle Nedz—I am a new writer who wants to join your merry band. I on a girl age thirteen and I am in the "eighth grade at Albion Junior High School. My father carries your maga- line to all the farmers on route 4 and has Tbeen doing it for ever thirteen years. 'v My chief pleasure is to go with him on a bright, sunny morning. We have been r ving some fine weather here in Albion every Albion citizen hopes that it stay for a good long visit. f We have had a "Dollar Day” here and sheets were terribly crowded. I am sending what I think will be a. ‘ u ~ motto, name and color or colors for u club. Here they are: The motto— eiry to do our best and our faithful 3.: r does the rest. The name——Wllling T-Vorkers Own Hour. The colors—Our Quntry’s colors, red, white and blue, most -. in every hue. I am also sending -'- a poem I wrote not long ago. Here 1toes! March if and mellow ‘Bring us days that l ' To in are so dear, fBring u birds that , Sing sweet songs, on days that You lusty fellow, Your voice is rough But your heart is mellow. There! Nowlthinklhaveeaiduough. so with love to you and the boys and girls I urn—Dorothy Riggs, R. F. D. No. . Box 11, Albion, Michigan. Dear Uncle Ned :—As I have never written before I decided to do it now. 1' have just finished the question contest. send like it so well that I wish there were ignore questions to answer. I havealwayfl interested in the Children's page, and more read the letters in every issue mt ‘rpibout three years. My father likes the finer-and has taken it for as long as I “I! remember. ' ,, I will describe myself. I am about five» r us brown eyes and Weigh 118 lbs. was fifteen years old last month. My day is between the 15th and 19th of February. The one thatst , = rrect date will receive a letter tram 1 flag, and yourself. While happiness” and four inches high, have brown“ Isl *' «.1‘.‘ . - '..‘~ . . '- "——‘ swimweaan. ..ii€1 ESTABLISHED 1872 winter in the beans and bean straw, 7 let us be a little careful where the next bean field is located and don’t I I grow them on the same field again, i p . also begin to prepare for next year’s by a The Oldest Mail OrderHouse is Today the Most progressive picking and throw out every bean . with 33y sign of discolor on it. Thus Chmago Km” CitY St. Paul Portland, Ore Oakland Calif F t W h 0 y o 01' you see if you eliminate the disease from your seed it is going to be much later before it is attacked, if at all, , and then, the case will not be so sey- __ .. ' MICHIGAN BUSINESS FARMER ere. . ' ’ ' ' u . Should the moisture, rains and . 5 The Farm Paper 0f Seerce" dews, be just right this year With the ' g ' .r TELL disease already present, it will be . .~ YOUR FRIENDS ABOUT IT much worse, so if we take all pre— cautions available we certainly can give it a hard fight. Again if we take all precautions and the weather is againstthe disease we have done a lot to Wipe it out and thus make for a greater prospect bean crop in years to come. Take out your insurance now by giving the seed you will plant a very » severe picking, discarding all dis- 1m . lspfiglAfL eternally OFFEUI: 11/, h ' 1n , . .' , - colored beans thus “9‘0ng out all a use“; regrets nukes. apparent disease. This must be done to mvse logs fweur. _ You could rightfully expect to before spring work begins because Batmn' 93c ‘l’filfsiasé‘al‘gzzl‘TEeZhem' Just my most or us W111 be too busy to do It Our new Harness catalog with Similar bargains is and Will be sent you FREE on rouuost. the... rough. So, let’s take out some insurance 31 '95 "P' 1’“ d‘m’“ 59‘" \ere FOR OUR by picking our seed beans! The ‘ dividends returned will depend in a ,BLEECATALQQ measure upon the severity of pick. 0591: can MINNEAPOLIS, Mwwsson 0 U R B O O K R E W "t///////fl/////////////////////flW/I/I/I/I/I/fl/I/I/l ///// Use American Ships cfor American Prosperity DO you know about your own ships? Are you aware that there are great fleets of both freight and passenger liners carrying American products and Americans like yourself between American ports and the World’s markets? You should know what these ships mean to you, for they are your ships, working for your prosperity. 1/ / I(-Boolxs ung‘tlllr tlhls headlfig .mny seen mu 8 whican unnee- hmer, and wilth pr hipped by u omptly a parcel post on receipt of publisher's price listed. D E T R 0 IT . The Farming Fever.~—-By Wheeler Mc- Millan, Associate Editor of “Farm and Rooms - Baths Fireside”. This book was written for the city man who gets the “farming fever” $2.50 Per Day and up every spring but it is interesting reading for anyone. Published by D. Appleton . - and Company. Price $1.50. Arablan Restaurant Porto and Happy Places.——By Cornelia. ‘ ' A - Stratth Parker. This is a story of the Gathlc 'Cafetena experiences of an American mother and ' R her children in Europe. Both grown-ups Tea om a3! cirfldrenfvgll enjoy this tale of the " C C a m ms 0 rs. Parker, her two sons ‘ , . ['2 (;e and her girluiln European capitals, in H ' ’ n. Mgr' M on 1‘ road trains, and on other //////////////////I////////// x ,r . cog"; “138% from the . Hive wag0n_ / ///////////// /////////////)) ca. lg mower-ed automobiles. Bound in cloth, containing 32 full page illustra- I . tie-g this book sells for 83.00% postpaid. For BBSt Direct Punished by Boni and Livirlght. . . W.—-By Eden -Phnlpotrs. This is Dem“ Beef C0» M011; Mid!- an htoresting tale of 3. Devon village. its ' m " romance and its fueds. It is full or en- teruhlng characters. rustic philosophy. and humor. Published by The MacMil- ' Hogs Ian C'nmnyrsnd the price is 52.50. I ‘ Suckling P‘ “ca—73y Lawrence Langner. This. . - s a lie. “say. 412%er scenes. is a dam. Live PO .3 1;- en nterpretatlon 'of the “In” 01‘ Moment story. and by analogy with ' ~ W century civilization. bites deep m m 'f‘REl sharpens cum: into woman of modern lite. Pub- ‘ ‘ You can learn best by actual experience. A European trip, for instance, need not be expensive: $12.50 per day is sufficient for all expenses of a six weeks’ tour, including round trip steam— ship fare. Such a journey offers a world of pleasure. education and recre— ation, and will provide you with first hand knowledge of the connections between the American Merchant Marine and the farmer’s pocket book. Uncle Sam has made it easy for you to go. If you will send the coupon below, illustrated booklets will be sent you. One tells about the U. S. Government ships of the United States Lines and contains eight suggested low—price tours, the result of actual experience. The other is full of informaa tion on how to travel: passports, visaes, baggage, duties, life at sea etc. Send for this interesting information. All you have to do is mail the coupon. It puts you under no obligation. ll/l/l/Z’l/l/ll7/Iil/l/ l/////////7Ilfl/llll/fll/lllflll0 United States Lines -secaon no. 45 W Ne ' Pl tend the b olden "T ' m ' York City Statgflnes" :23 “(301ng Abroadg'fium on UN“ ‘ Mm!!!” 01167080” for If I go date will be abom There will bemumm..........--...monsoon in my party. Nam I TO u. s. SHIPPING BOARD C469 w - l g l s g l l l l l OUT RIGHT By Anne Campbell H .erything will come out right. 'Things will change. You'll see! {Maybe I'm not happy quite, ~But I’m bound to be! aybe all my childish dreams ‘ Vanished out of ’sight. Troubles always end, it seems. Life turns out all right! Everything will come out right! When the clouds are black Then I’m sure to see a light! Luck is coming back. When I'm bluest, then I know ‘ Next day will be bright. Sorrow always has to go. Life turns out all right! Everything will come out right! Heart of mine, be gay. Though there’s not a star in sight, Soon it will be day! Soon the rosy light of dawn Puts the dark to flight. Let’s be brave and carry on. Life turns out all right! (Copyright, 1924.) FARM IS PLACE TO SEEK HAPPINESS T would seem that the subject of ’ city versus country had been worn threadbare, but when I pick up our local paper and see the long list of auction sale notices and see the headings “having decided to quit farming” etc., I just can’t resist the temptation to tell my experience as a farmer’s wife in town. Most writers put great stress on the fact that we have free mail delivery, autos, radios, etc., etc. To be sure we enjoy those things but I think the things that really count most are the little things that make up our everyday life. We didn’t decide to quit farming, the Doctor decided it for us after John had had a complete nervous break- down caused from overwork. We had worked farms on shares for eight years; we started with absolutely nothing and ended up with every- thing in the line of stock and tools. We had worked hard, too hard, and - altho we always had enough to eat and wear we thought we were “poor - folks” because there never was much money in our pocketbook. When the sale was over we were quite surprised to find we had enough to buy a small farm but as we had been ordered off the farm why we bought a Ford and moved to town. I’ll have to admit that the first six months we were in town we thor— oughly. enjoyed our “vacation”. John was not able to work so we kept that Ford busy, visited everyone we knew for miles around and it didn’t matter when we went or when we got home for there were no cows or pigs, not even a chicken waiting to be fed. Then John got a “stand—up collar” job and we settled down to be “city folks”. Talk about life on the farm being monotonous, there’s nothing ' more deadly monotonous than living ._ in town after the novelty wears off. There’s more noise and excitement to be sure, but it’s the same thing day after day, the year round, and it’s dust and dust and more dust. There’s no milk cans or cream separator to ~ wash but the extra washing, ironing, sweeping and dusting, trying to keep ' the house and children clean, more , than made up for it. Hang a wash- - 'lng out and then see clouds of dust continually rolling off the street, and e in the winter it’s the smoke and soot of a dozen different chimneys that will settle on it. I seldom went any place except a hurried trip to the store and I noticed . the neighbors who had children were tied‘down as much as I. The chil- ‘dren left the house for school at ’ eight fifteen a. m., were home again at eleven, left again at fifteen‘to one p. m. and were home at three. The children are a constant worry in f town. There’s nothing for them to e do but play and no place to play ex- cept in the house, a small yard and . the street. Before we went to town my boy and girl were perfect chums but he _ -soon found plenty of boys his own _ ,age to play with and they didn’t want “that kid” tagging along. She found little girls to play With and they did- n’t want “those horrid boys” around so they drifted. apart. ' . _. 2" We 'lived in theebetter, part of the toWn, our neighbors ‘-.were' neither ‘ ich or" poor, just average well-to—do. it' being? a» college. town. tand - ose-who'didn’t‘have’chil‘d‘ren kept ‘ to all friendlxasrls hump ’ 11131 8 “on, ct step, right there on the farm ——and they moved back, to stay, both happier and wiser. Let us have the experiences of other readers. ‘ The Farm Home ‘\ -A‘Department for the Women Edited by MRS. ANNIE TAYLOR EAR FOLKS: There are few families that have always lived 0n the farm that do not, at some time, yearn to get away from what ' they call drudgery. They want to move to the city where there is “big pay” and little work, where life is somewhat of a vacation. 1 Wish every member of such families could mad the letter by “A Farm: er’s Wife” that appears on our page in this issue. Her family” "got the fever” like many others and they tried the city, much to their regret, because they found the “pot of gold” they thought was at the end of the rainbow that rested in the city was really at their own door- ' W £444., Address letters: Mrs. Annlo Taylor. on" Tho Iuslnm Farmer. Mt. Clemens. Mlonluan. a ' Tit. . " , cults audpastry, every hot; ,n' r, from 450° to 550° 'F:~is>.reqnired.= away from home. The men were at work all day, came home for supper and then went ofl down town. They all thought I had an ideal husband as he never went any where after work unless he took the Ford and we all went. Where did we go'.’ We want out to that “small farm" we Dough. econ after we moved to town and just wandered around and plan- ned what we would do‘ some day". Uur limes move in a circle and I found that city people live in such a small circle while country people live in a muclz larger circle and we get a bigger, broader, cleaner view of life. I’ve noticed since I've come back to the farm that our neighbors out here go more and are more active mentally than Our city neighbors. The clean, wholesome, cheerful feeling shows through in spite of the con— stant grumbling that “there’s no money in farming”. While with peo- ple in town there’s sort of a hopeless longing underneath the smile, good clothes and the general custom of bragging about that “good job and big pay”. A lot of country people seem to feel its their duty to grumble and appear dissatisfied with their life while city people make a constant effort to convince folks that they are happy and satisfied. But to one who understands human nature the truth is, plainly visible underneath the mask. We soon found it is almost impos— sible to save anything in town in spite of that “big pay", with rent, gas and electric light bills, even the daily paper costs nearly three times as much in town, being delivered by a boy instead of the mail carier and you have to buy every mouthful you eat. I think that is what hurt me most of all. When I would come from the store or market and empty my basket on the kitchen table, think how much I paid for it and then think how much I used to go out into the garden on the farm, gather great armsful of vegetables, select the very best for the table and throw the rest over to the pigs—well I didn’t know whether to laugh or cry. I had to plan and skimp in buying and skimp in cooking in spite of John’s “big pay”. I couldn’t afford to buy food and then throw it in the garbage pail. After four years, the house where we lived was sold, we were asked to move and there wasn’t an empty house in town. I guess we were about the happiest family in town for we had to move out to our little farm. We’ve no modern conven- iences of any kind out here and we are not getting rich but there’s no rent, gas or electric bills to pay. John will never come home at night with the terrifying news that he’s “lost his job”. I don’t need to get my pocketbook and count the con- tents forty times a week and skimp, scheme and worry while planning the meals; it don’t matter if there’s mon— ey in the pocketbook or not, I simply run down cellar or out in the garden. No wonder our city friends make life 'a burden for us sometimes, they know it’s true that we always have lots of good things to eat on the farm. I have my chickens and garden to look after, something worthwhile to do. I don’t need to “dress up” and walk around the block to get a little outdoor exercise. When we go 'a'way we must get back at chore time but such a noisy, happy greeting comes 'r‘: besides: "a hand-to. t~ 'ng to ,usjflfrom thegbarnyard, we’ve some: . thing-e; to :-H.,V6 to “me. When the boy comes home from school he goes out to help Dad in— stead of slouching down on the front steps waiting for a neighbor boy to come along and help think of some- thing to do. The girl can practice her music in piece and quiet, there’s not a half dozen youngsters out in front calling to “come on out” and best of all they are chums once more. If they are out of sight I don’t need to worry, I know they are on the farm some place, they won’t get run over by a street car or truck and if the baby’s dress is dirty sometimes there’s no one going along the side'- walk to see and criticize. We have neighbors here who have been to town and moved back. We also have neighbors who are sick and tired of farming and want to go to town. I wish they could all go for at least two years for I know they would come back perfectly happy and satisfied and convinced that the farm is the place to live and be hap- py ever after.—A Farmer’s Wife. ICE CREAM HE subject of ice cream may seem untimely to some but it is more easily made at this season and we enjoy it as well now as in sum- mer. We have served it several times this month. I know a number of housewives who make ice cream simply by freez- ing a raw mixture of eggs, sugar and milk. Here is my way: To 1 gallon of milk use 2 eggs, 1% cups of sugar and 6 heaping tablespoons of flour stirred to a smooth paste in part of the milk. Beat eggs well, add sugar and beat again, pour in the milk and stir until sugar is dissolved. Put in double boiler and when boiling point is reached stir in the flour thicken- ing and boil about 3 minutes. Cool, flavor and freeze. You will find this most creamy and delicious with no taste of flour. I devise a double boiler by placing some old piston rings in the bottom of a large pan containing hot water. In this I set the smaller pan of milk and cover with a common kettle cover.—B. O. R. RE-POTTING HOUSE PLANTS OUSE plants such as geraniums, begonias, and ferns need oc- casional re-potting. The top edge and bottom of the old ball of earth should be removed and fresh soil used in reapotting. 'Always place a piece of broken pot in the bottom to aid in drainage. Do not fill the pot to more than a quarter of an inch from the top. OVEN TEMPERATURE IS VERY IMPORTANT E proper oven temperature is an important consideration in the successful preparation of " food. Many a last minute failure in a carefully prepared recipe is due to too slow or too quick an oven. Oven temperatures for various foods suggested by the home economics department at South Dakota State College are as follows: L V Custards and margarines require a slow_.oven which" ranges in temper- ature from. 250° to 350° F. Sponge cake, angel .cake, bread, ginger bread, plain cake and cookies are .gbaked in a. moderate oven _with Ia; {temperature Iotfrom, 3.50 9.. to 43009., i notifitquick‘cven “400 .tb , M F5? 2,, PLANNING THE PLANTING - EFORE starting the home vegeta- ble garden, make a paper plan of the area to be used and draw it to scale. That is, make a map which will show the size and‘shape, by us— ing a constant unit such as one- fourth of an inch or one-eighth of an inch to a foot. A plan with a 12-inch boundary would thus represent a gar- den either 48 feet long or 96. Then plan the space for each crop, and keep in mind that the general tenden~ cy is to put rows or hills too close together. Prevent this fault by al- lowing plenty of room. If the garden is large enough to warrant the use of a wheel-hoe or horse cultivation, it is particularly necessary to give lots of room. And don’t put the to- matbes where they were last year. Also keep in mind the tendency. to plant too much of a given crop. Rad- ishes, for example, should/be planted in small lots at intervals. 'One 'com- paritively small row of Swiss'chard is enough for any ordinary family, particularly if it is harvested on the principle of "cut and come again”. Personal Column I]. f‘ Keeping Sansago.—In answer to ers. B's inquiry as to how to keep home-made sausage, will say I have had very good success by canning. Have been able to have it the following summer at bar- vest and threshing time. First form into balls or patties, as for table use or so they will slip through the mouth of a two-quart fruit-jar, easily. Put in frying pan and fry ‘until cooked thru, pack in hot sterilized fruit cans, until full, but not crowded, add a cup of the hot drippings, seal tightly, as for fruit, and turn can upside down and let stand until thoroughly cold, so lard will harden over top of meat, then store in cellar. When wanted for use turn can upside down in basin of hot water and sausages will shake out easily. Simply reheat in frying pan and they are ready for table. I find this very easy and suc- cessful and a great lard saver.—-Mrs. E. J. Osborn. , ' ——if you are well bred! Dance Etiquette.—-Formal or informal, the first duty of a man who has taken a girl to a dance is to his hostess; ‘When both have laid aside their wraps in their respective dressing-rooms. the; hostess is greeted. Thereafter things take their natural course. If the girl’s brother has taken her to the dance, he may relinquish her to some other man friend who, comes up, or if she has come witha maid, she finds a girl friend or group of friends whom she joins. Brothers do not as a rule take their duties seriously enough when they bring their sisters to a dance. Sisters, on the other hand, are usually satisfied to have them neglect these duties. if some one else is willing to assume them; and any sister is usually quite willing to have her brother take in an- other girl as a supper—partner—a matter which should be settled early in the even- ing—if she herself has been suitably pro- vided for in this respect. In general the man who takes a girl to a. dance assumes certain responsibilities. He must not only dance with her himself but must intro- duce other partners to her. Nothing: is ruder than for a man who has taken a girl to a dance, to abandon her to her own resources after a few fox-trots. and retire to the smoking-room, unless it be leaving her alone on the floor with an "Excuse me” which does not excuse, to hunt up another girl. . The lener’s Bible ,2; With God Nothing Shall Be Impossible. Luke 1:37. 1 If any trouble seems fixed beyond, your control, put it into God’s hands. ‘If it comes again into your hnind, put itiback affirming, “God will perfect that EWhlch, concerneth me.” Tremendous power lies back of this truth. ‘_ .i . ' RECIPES . A Stomach Tickler.——I have here .‘the ' most economical recipe for molasses cook- ies that I have yet discovered and also the one most suited to my taste. If one follows directions closely the result will-be delightful to the eye and a deep sat-is- falction to the inner man. “ Ingredients are; 1 cup sugar, 2 cups molarSSes._xL"‘.tea- spoon salt, 1 teaspoon vanilla, or. tea- ' sp’oon lemon. lz‘tea'spoon cinnamo soda,1,loyelvqnp,,lard‘ ‘or 1 rounding butter, or). 2% cups your 2.5641: .15.; monumental! and 8M Mimi lusc- snd‘vnnfll ' ' . ....-»ug;~ , :5'1 (lull i v I boiling hot; water“ heaping teaspoons-1 3‘ ;. « «a. I...“ I. .. [w .-.— "n.3, w iii .19. _V that it mixeseas lyint , I mixing well itmaybdneces’sary to add a small amount of flour but keep the dough ail—soft as possible_to_handle_ well. Roll, out, sprinkle with sugar and put a. raisin or a nut “m'efit in the 'centre .of each cookie. , Bakein a moderate oven. Ginger may be used instead of spices and is usually, good with lemon flavor. -—B. O. R. Braised Loin of Mutton.—~3 lbs, loin mutton, 73 tablespoonfuls fat, 1 celery stalk. $9 teaspoonful whole white peppers, 1 bunch sweet herbs, salt, pepper, and red pepper to taste, 1 turnip, 1 carrot, 3 cloves, 2 sprigs parsley, 3 tablespoonfuls ' has); Axioms: 'There’s a lot in the way ,“thank you: is said. An‘oocasional well placed mirror adds space and light to living room or hall. $ t t A pan full of dry warm oats poured into a boy’s wet boots dries them out the best of any known method. II III. A pan'orf ,water on the radiator or reg- ister will give needed moisture in the air of the room during the winter. I t I The soil to; most potted plants should be a good garden loam containing a little flour, 12 button mushrooms, 1 onion. sand, at little well-rotted stable.manure, Remove bone from' mutton, rub in little avery little bone meal, and a little leaf salt, pepper and red pepper mixed to- mold. ‘ gether; roll up and tie in neat roll with ~ * * *. tape: cut up celery, onion, carrot and In preparing macaroni. a hearty cold turnip, and lay them at bottom of sauce- weather < dish, all stickiness should ‘ be pan with herbs and parsley; lay mutton washed away by rinsing after cooking. on top of these. and pour enough boiling Plenty cheese, tomato, or meat sauce adds water to three parts cover it, and. simmer flavor to the diSh- slowly two hours; lift mutton into roast- " .\ _ in: tin with a few tablespoonfuls cf the Wrapping each piece 0f homemade gravy; set in hot oven until brown; candy in oil paper Will help to keep it strain gravy and skim off salt, melt fat from drying out when sent through the in saucepan, add flour, then add gravy mails. gradually, seasoning of salt and pepper, _ . " "' mushrooms, and boil eight minutes. Set When grindlng bread for DOUItrY Stuff- mutton on hot platter with mushrooms ing. a paper bag tled over the grinder round. and gravy strained over. helps Catch the Caumys- * Cottage Plow-rWe With others do enjoy Carrot and orange marmalade is loaded the M. B. F" I always turn to the Farm to the gunwaies with vitamines and Home department. for I like to read the hardly stays in glasses long enough to ideas of others, as I live qn a farm and pay to cover with parafin, know something of what a farmer’s wife * t * has to mntend With- I Will send you my Ink may .be removed from upholstery “301136 for Outage Die. by covering the spot with a paste made Take 2"CuDS’Of mafia-r0111. 000k in salt of baking soda and water. When thor- water until tender." 2 cups of cold ham oughly dry, it should be brushed off. This or beef 'run through the food chopper. may be repeated if necessary. Put in a‘pudding pan a layer of macaroni . * * * then a layer Of meat. COVG!‘ With some A few drops of commercial ammonia EOOd thiCkened gravy. then for the top on a dry cloth will do much to remove layer add a layer of fine mashed potatoes “water spots” from polished floors or furn- with bits of butter on top. Let brown in iture. If the surface is waxed the spots the oven. We think this is very good Should be rubbed with a mixture of equal for supper.-—Mrs. Floyd VanWie. parts of turpentine and linseed oil. AIDS TO GOOD DRESSING IE SURE AND SEND IN YOUR SIZE 5046-4850. A Smart Sports Suit—A Smart Tunic Costume.——Printed voile was used for this design. Collar and vestee are of organdy. Pattern 5046 was used for the Tunic Blouse and 4850 for he §kirt. The Blouse In? be flnisned With the sleeves short, or in wrist length. The Blonse is cut 1 4 Sizes: 34, 3g. 38, 0, _42, 44 and 46 inches bust measure. The Skirt is cut in 7 Sizes: 25, 27, , . 33, 8n and 37 inches Waist measure With corres ending hip measure, 35, 37, 39, .41, 43, 45 and 47 inches. The Width of the skirt at the foot is % yard. To make the Costume With short sleeves for o. 88 inch. bust size will require 596; ards 06 40 inch material, and ‘75 yard for vestee and collar Vof contrasting material. i‘ made with orig sleeves, % yard more will be required. 5048. A Practical “Two In One" undergarment—Cambric. batiste, crepe, satin or crepe de chine may be nsedfor this model. The brassnere may be fastened to the chemise with sun fasteners or buttons, or, it may be finished separatel. This Pattern is cut in 4 Sizes: Small, 3336; Medium, 3 0; Large, 42-44; lxti'a Large, 46- 8 inches bust measure. A Medium size requires 2% yards of 36 in h material. he chemise alone requires 1% yard. For gussets of webbing 1,4, yard 4 inches Wl e or 56, yard inches Wlde is required. t # I 6031. .A Popular St le with New Features.-_—The straight line dress is still a general favorite. .In themodel here shown c eoked. annel is combined with plain flannel. One could use wool bengaline With satin,‘ or, have one material, and decorate the flounce. collar and cuffs with braiding or stitchery. The Pattern is out-in? Sizes: 34. , . , , 44 and 46 inches bust measure. If made as illustrated,, for. a 38-_iiich size'B‘A yards of checked material and 1% yard of plain material 40 inches Inde_ igdrequired.. Width of Skirt at the foot is 1% yard. If made on one material 4% yards is requir . ‘ ‘ 5034. A Comfortable ‘Mornln Frocli for Women of Mature Flavor—Striped gingham or linen will be good for this model. wth facings of contrasting material in a plain color. The sleeve may be in wrist or elbow length. The pattern is cut in 9 Sizes: 40, 42. 44, 46. 48. 50, 5 I , 54 and 56 inches bust measure With correspond- ing waist measure, 33 5 37, 39, 41, 43,_ 45. 7 and 49 inches. 0 make the dress as illus— trated for a 44_inch bust will require 41/2 yards 0 .36 inch .stripped material, and % yard of plaidn for facings. The Width at the foot is 1% yar . ' 6049. .A. Dainty Dress for the “Little Miss" _—VOile, dimity, batiste, crepe de chine and China silk are good materials for this style. The yoke and sleeve portions are made in one piece. The Pattern is cut in 4 Sizes: 2. 4. 6 and 8 years. tA Slyear size requires 21/3 yards of 36 inch ins: one. 5050.. A Simple Comfortable Suit for a Small Boy.-——Linen, chaiiibi'ey, poplin, Jersey cloth and iinniiel inay__be' used for this style. The Pattern is cut in 3 Sizes: 2, 4 giiid 6 years. If made as illustrated a. 4 year Size requires 3 yards of r 36 inch material, With 1/5 yard of contrasting material for collar, cuifs, lap and facings. _5044. A New Skirt Stalls—This is a f011l“ piece model With Circular re. It is good for velvet, silk and for sports materials, also for knslia, cliarmeen and linen. The Pattern is cut in 7 Sizes: 25, 27, 2.9, 31, 38, 3,5 and 37 incth waist xiiieasure With corresponding hip measure, 35; 37. , , , 5 _and 47 inches. The _width_at the lower edge is 2% yards. A 2!) inch 5136 Will require 2 yards of 40 inch material. 5061. A Good “Sport'sfihlrt” Style. This is a good model for a Negligee or Outing Shirt. The sleeve may be in wrist length, or short, to the elbow. Flannel“ broadcloth, caiiibric or silk could be used for this style. Tile Pattern is cut in 7. Sizes: 15. 1.5%. 16. 1 it. . and 18 inches. neck size. To make the shirt for ii. 15 inch Size requires 3% yards 36 inches wide. ALL PATTERNS 12c EACH... r 3 FOR 30c POSTPAID Order irom this or [armor Issues of The Buoineu Farmer, giving number and sign your name and address plainly. ADD 100 FOR SPRING AND SU 1925 FASHION BOOK MMER Address. all orders for patterns to Pattern Department THE BUSINESS FARMER Mt. Clemens, Mich. HAND BEADED Look at this striking Styiei aembie Model. A popular eifect so becoming to ev- ~ cry age and ii are. of all. Wesacriflce profits to gel: new customers, so 1 ORDER QUICK A'I' OUR: RISK! ' Tailored of lovely silk - CANTON CREPE mate- rial richly Hand Beaded = brilliantlustre Bugle Just the dress for partial, ‘ dances, evening or after- your N a m o . Audra... on arrival only $3.98 - ell hted return and get - RS: Navy Blue MONEY our money back. C L0 ram. Black and Gray. E D E R A L MAIL “BDER CO. ' Chicago Easier washday! You save wear— and—tearlClothes c o m e .c l e a n quicker! — when you ll ave the e x tra h e 1 p of Fels—Naptha Soap! I Not only soap—but soap and naptha 1.508 HONI ‘PS 0 RANGES cunt-Into . menu. Bod-13’ home. ' ‘_ hemmed , ‘ ' i ' 3 Direct to o u \“ Got manufacturer's ricer. Save 14 w l 2 o p THE HOUSEWIFE When depressed in vitality nothing so quickly restores tone to the body as . Scott’s Emulsion It is the fo'od—tonic that builds up vitality and helps lighten the daily task. ' soott a Bowne, Bloomfield, N. I. 24-33 DAHLIAS.‘16 FOR $1; 10 IRIS. MIXED s1; 75 Gladioli, blooming size, $1; Hardy plants equally low prices, prepaid. Circular free. " h ‘ .l.. L. MILAROH, Copemlsh, Michigan. the ,iiuSIans- FARMER I. Inn “The Farm - Paper of Service?" ’ YOUR. FRIENDS. l i i ---i". r A .; i .‘l' I" z 3-. Ant Good Record Now Has Assets Over $565,225.96 Increased by years as follows; 1924 The Politico Years Claims Paid in Force Assets 1915‘ 11 s 564.13 1,733 $4,083 1916 176 25,260.42 15,337 7,740 1917 474 59,938.91 27,431 40,446 1913 721 95,120.35 32,908 , ......................69,424 1919 1,337 192,492.27 39,742 ......... ...7 1,201 1 920 2,232 230,901.29 45,067 1 1921 2,646 323,273.36 40,263 .... 1922 3,326 295,147.21 38,263 1 923 5,493 402,4221 1 46,050 5 9,001 Claims Paid, $539,106.38 Total Claims Paid to date, 25,463 Total Amount of Claims Paid, $2,203,226.48 , Assets $565,225.96 The Company settled 9,001 claims in 1924, only 37 cases were disposed of in the Court, as folloWs; 7 verdict for policy holder 16 adjusted before trial 7 verdict against policy holder 7 dismissed you are not carrying automobile insurance, it would pay you to see the local agent, or write Citizens Mutual Automobile Insurance? Company of Howell, Michigan three years. I found 11 Finally, and we completely them seventy to e roved “Home your name and ad to t en i If to mav send the price derstand I do not we“ 3... .. a... y I' an lend mime 5%”; Writs car-y. MARK H. JACKSON :05! Dimtoa 33in" % Mr. Jackson is “$011M Above am has. Rheumatism A Remarkable Home Treatment Given by One Who Had It In the year 1893 I was attacked by Mus- cular and Sub—Acute Rheumatilm. I suffered as only those who are thus afflicted know for over I tried remedy after remedy. but Iuch relief as I obtained was only temporary. treatment that cured me h 92 pitiful condition has never returned. llhave given it to a number who were terribly afilicted, even bedridden, some of izhty years old, results were the some as in my own case. I want every sufferer from any form of _mus« cular and sub—acute (swelling oi: the mints) rheumatism to try the great value of Treatment” . ealing pmver. Don’t send a cent' aim 1y mail dress, and I wil se . After you have used it. and be that ions-look and the my im- for its remarkabl' it free it has prov- for means of getting rid of such forms of rheumatism. you 0! it, Ono Dollar, but an- want: your money nurses 1 you 't that (girl of- send it. M. ll. 1. Iameas. The book have helped over «5,000 SAVE-The-HORSE care: when everything born case. of SPAVIN, Tendon d on ’ fluid with signed want.- outakenorink. Writetoday torumlool f “Mm mm” 32......“- “13... an: TROYCWCOIPANY 3393-? Shoot hhflstheuostunih Rinc‘bone (ex t low), , .Kne‘. , odor ,vlnle bane worh. Huheldtho andbneederstoralmn. noun-mien G Bind-ante!» ILY. Dealers We. mimfi run some 93mm “The M Paper or Service“ , WHEN WRITING to ADVERTISERS. rm memos- .‘Trizsusmessrmu . _ : 2 'l l2 3' i l . 34- l v 33 31 ~ ’ 3r 3‘? “lo i 43 w x M iii?» ‘1‘? - Jl- , '52 L . E 55 l SIJHGImS'l-‘IUNS FUR SQLVINI‘. GROSS—WORD PUZZLES Start, out by filling in the words of which you feel reasonably sure. a clue to other words crossing them, and tilt Imgfled in each. white space, words starting at the or vertically or both. ACROSS 1 Aspect 6 Speed! ‘ 11 iarzous cow which recently died 12 Work-s ' « 14 A color 15 A piece of literature 17 BO": nllchmo 18 Each (abbr.) 19 What the owner of a cow docs twice a day 20 A Southern State (abbr.) 21 Biblical character _ 24 Organ of vision 25 Asz.ert _ 21 One who owes money 29 in second childhood ‘ 31 Consumed 3'2 Western State (china) 33 Arid waste 36 To oppose force 39 Always . 40‘ Sumx meaning “native of" 42 Volcano in Sicily- 43 Parent 44 Plant valuable for its root 46 Like 41 Form of poetry 49 What brightens up the house I 50 Skill in producing beautiful things 51 Torment . Without clinicuity small boulder Liqu.d masure (N) The unsm-r to this puzzle will appear in the next issue. 1 1* no nunaaaa 663$ manoaaaomuouawNA assaagesssar 32 l 36 f .37 at" i l . l _ ‘12 , i 143’ 4‘ l v Ja- , l r 53 ‘55! 56 . —Th.eae will give you in turn to still others. A letter. belo more: a-nd running either horizon“ DOWN Gratlfy accreted combat-13‘ t igl the apple to the branch . e What snow fall: in W good new a Man's name shortened Limitias period of time To visit foreign countries Miserunoss To look at fixedly , ‘ Deceiqu To humhlc A plant with aromatic coeds A Wales A friendly call Over (poet) Female sheep Station our! in_ Pulled up horses Tang 5 Pleasantly edible Prefix meaning three Opposite to shut ieniy body consume Objective . Thus A continent (shim) Also, we “ill have en‘other punk. BEAN ADVERTISING FUND EAN growers are keenly interest- ed in. the advertising fund to be raised jointly by growers and dealers contributing one cent for each hundred pounds of beans sold ; or bought. , contributions forwarded to F. W. Merrick, ‘ amounted to $4,819.62. 011 February 25 the total the funds, The follow— custodian of ing list. made public at the recent meeting of growers in Saginaw, g1ves ' the location, name of firm, and mum-1 ber of months covered by the remit- tances from each contributing com- pany. This list includes all who had sent in remittances previous to the first of February: Albion. F. E. Nowlin & Co., two. Auburn. Auburn Elev. Co., tour. Bach. Seloewaing (lo-op. Ass’n., Bath, S. Cushman & Son, four. Boyne City, Boyne City Mill, two. (lass Ciy. Cass City Grain Co., four. (‘mial‘ Springs, ii). A. Remer & 80113, (on r. lhl‘t‘t‘, a one—half. . ha f0 (‘harlottm Farnivrs‘ 'I‘Ilev. Co., four. l‘lzire. (‘hattertnn & Son, one—half. (.‘m'unna, Farmer-rs’ ("o-up. Elev, one. (‘ruswelh t‘roswel] (‘o-np Elev. two. l‘ruswell, Mil-higan ill-an (10., four. ln-lvin, ("hattrruln & Son. one-half. DeVVilt. Christian Brvisch & Co., tour. Eaton Rapids. Crane & Crane, one. Eden. (‘. A. Davis. four. Elsie. Elsie Elev. Co. Evart. lilvart Milling Co., three. Farwell, Michigan Bean Co., four. Fenton, Michigan Bean Co., four. Fenwick, Fenwick Elev. Co., four. Flushing. Flushing Elev. Co., Fowler, Sturgis Brothers, one and one- lf. \ Fowlerville, E. W. Burkhairt & Sons, ur. . Fowlervll‘c. Fowlerville Farmer-9’ Co-op., tWO., Gerri, Charles Wolohan, one. Giadwln, Charles Wolohan, two. Greenleaf. Cass City Grain, three. Hm Beach. Huron Km. one. Hamlet. Charlies Wolohan‘, rune. Henderson. Henderson 00479;. one and _ Holly, Holly Grain and Prod., four. Imlay City, Lewis Steele, two. ‘ Ithaca, Ithaca. Gleaners’ & Farmera’ Elevator Co., one. Kirby, Albert Todd 8; Co., one. Lansing, Christian Briesch & Co., fur. Lansing, Iabell Brown Co., fou’r. Lennon, Lexmox Elev. Co., four. Mariette, Mariette Farmer-9’ 80-0). Elev, one. Marshall, Farmers’ Elev. Co., two. Midland, Orr Bean & Grain Co., four. Midland, Chatterton & Son, one-half. Mikado, Michigan Bean Co., four. Millington, Sioux City Seed, two. Mt. Pleasant, Chatertton & Son, one- half. Morris, Morris Bean & Grain Co., two. Owendale, Michigan Bean Co., four. Owosso, L. C.--Ha.ll, two. Owosso, Isbell Wholesale Store, one. Perry, H. Starks Co., one. Pompeii, Chatterton & Son, one-hall. Prescott, Prescott Grain Co., one. Richville, Richard Hoerlein, three. Sebewaimg, John C. Liken & Co., four. Shiloh, Shiloh Elev. Co., four. Snover. Snover‘Co—op. Elev Co., one. Traverse City, Traverse City Mill, four. Unionville, Unionville Mill Co., two. Weidman, Holmes Milling.r Co., one, Whittemore, loser) Elev. Co., one. Whittemore. VVhlttemore Elev. Co., two. Williamston. 0. l). Pm‘win, four. ANS‘VER 'I‘O CROSS-WORD rumor: NO. 10 .T RlAM 9': R R or p, o R E. A c T. o R a, R v 5 H o A T- p 5. s. E. T 5 o 5 1' R a 0 N F- P E N A r llflP'LEMLN'r-l. A 3 p o 9.3 r. is P .0 *5 A Anti» o ; 5N; sin-"r m. e a: R" ' exit—«gin fir _ l i a I l - 7.. 4) - shop's ts from over,,,1.ooo -. gidwe’rs testimonyxghat Mich- igan Certified seed does better the yield and quality of the potato crop. Michigan potato grower-z will more quickly raise the standard of potato s production in this state and the qual— rity 01 Michigan potatoes on the mar- ket by planting certified seed on their own farms instead of letting the bulk 01 it go to farms in l’ennsyvania, Ohio and other states. . _ Approximately 50 per mm: of the 1924 crop of Michigan certified seed has already been sold and the early spring demand~ is strong. Michigan farmers are urged to place their or— ders for certified seed early and not, wait until planting time. Certified seed potatoes of the Russet Rural. White Rural, Green Mountain, Irish Cobbler and Early Ohio varieties may be procured from the Michigan Pota- to GrowerS’ Exchange, Cadillac or from individual growers. Sources of certified seed and detailed inform 7 tion concerningdthe seed potato i. speetion and certification work, me be had by writing to the oflice of Seer Inspection Service, Michigan Agricuh tural College, East Lansing. ALFALFA (Continued from Page 17) than $35.00 per acre, which is a rather high cost per acre. The first season after sowing I out two loads of hay, Where I put the three tons there was a large amount of yellow plants, on the four and a half ton strip a few, and on the six t-on strip a rich dark green and fully a third more growth. The next season we cut 6 loads of hay off theone and three— quarters acres and pastured 22 hogs 11 lambs and 4 calves until winter stopped it and it looked as though there was no alfalfa left. The next season it came on and we cut 7 loads of hay and pastured 28 head of hogs until sold in the late fall, also a cow and a calf. The next season we raised 56 head of hogs in the one and three- quarter acre lot and also cut 2 loads of hay and this year we had 65 head of hogs on it until after the second cutting and got two loads of hay off it besides and I'guess there will be some hay there next year also. This was done on land that folks said alfalfa could not be raised upon because it was too heavy. I am going to let the reader figure out the profit, if any, on v the expenditure on this piece of land. I have just scratched the surface ofwhat might be said of alfalfa and might say something more at some other time. I NOCULATION In nitrogen used to inoculate oats and beans or not? I have read so much about it for inoculation of other crops. If it is used how much would you use to the bushel.——H. C., Sword, Mich. OCULATION consists of the addi— tion to either the soil or the seed of a certain bacteria that will en- able the plant to secure or make use of the nitrogen of the air. Commercial cultures may be secur- ed for leguminous crops such as al— falfa, sweet clover, beans, etc. The cereal crops such as oats, wheat and rye are not inoculated. Material for inoculation may be secured from the Department of Bac- teriology. The price is twenty-five cents a bottle and one bottle con— tains sufficient material to inoculate a bushel of seed. Directions for ap- plication accompany material.——C. R. Mogae,‘ Associate Professor of Farm Crops, Michigan Agricultural College. SEEDING ALFALFA I would like to know if you can get a good seeding of alfalfa by sow— ing it in oats or barley in the spring of the year? What would ‘be the best way to get a good alfalfa seed— ing any way? What kind of fertili- zer or lime should. you use? The soil is black loam and gravel mixed. ---1. L., Goldwater, Mich. fairly fertile soils excellent seedings of alfalfa are frequent— ly secured when the sltaltaseed is sown in;er cats or barley. three“ in acid some torm' of build be applied; all fit ’ be . Michigan to n? usually increase production—C. R. Megee, Associate Professor of Farm Crow. Micth Agricultural Col- siege“ 0F BARLEY I would like some advice about black barley. The only black barley that ,Iaam ablevto find for seed had smut in last year and I have been wondering, what the treatment for “smut in barley is.—C. D., Grand Ledge, Michigan. ‘ HE smut of barley may be suc- ‘ cessfully treated by preparing a solution containing one pintof formaldehyde to forty gallons of water. Clean the seed thoroughly with a fanning mill to remove smut kernels then sprinkle the seed, using one gallon of the above mentioned solution to one bushel of grain. Cover _ Oh Nth-t ' phosphorus ~and potash. tater {our hours, and then speeadout to . - The seed should be planted as soon as dry.———C. R. Megee, Associate Professor oil-Farm Crops, Michigan Agricultural College. . RAISING VETCEH I have been thinking about vetcll. How much should be planted per acre and would it do well in cats? How would you prepare the ground? ——J. Y., Traverse City, Mich. ' PRING sown vetch frequently makes a good hay crop and some— times quite a profitable seed crop. However, larger yields of seed have been secured when vetch is sewn during the late summer. If you desire a hay crop, I would suggest sowing two bushels of oats and 20 pounds of vetch seed per acre. The seed bed should be prepared the same as for oats.———C. R. Megee, As— sociate Professor of Farm Crops, Michigan Agricultural College. RED KIDNiii’ mus: - : I‘ have been thinking of raising‘ kidney beans next season and would A ‘ like your opinion as to whether it would be a profitable crop in raise. also how far apart should they be ~ planted and what time of the season should they be planted ?———J. Y., Tra- verse City, Mich. NE would expect Red Kidney beans to give a fair profit this coming season under favorable conditions. This means planting of as clean seed as possible. (Free from disease). \Give the seed a severe handpicking. Would advise planting the beans in rows about 30 inches apart at the I rate of about 80 pounds per acre. The beans should be planted about the first of June; the 25th of May to the 10th of June being within the limits for planting—H. R. Petti— grove, Assitant Professor of Farm- Crops, Michigan Agricultural College. Announcing the Formation of the Michigan Business Farmer Piano Club IN announcmg the Mlchigan Busmess Farm- er P1ano Club, we believe we are offermg something of real benefit to the readers of this publica- tion. This is the first time that individuals have been given the opportunity of dealing direct with this well- known factory—‘the world’s greatest. Saves Members from $90 to $140 This Club, which is limited to one hundred, entitles the member to purchase a high—grade, fully guaranteed Cable-made Piano at rockbottom factory price. The saving ranges from $90 to $140, depending on the mode 1 selected. Either a Baby Grand, Upright or Player-Piano may be had under the Club Plan. This saving is made possible by combining the Club’s entire order, although each member is responsible only for his own instrument. Thirty Days’ FREE Trial Easy Payments The Club requires only a small initia ldeposit. The in- strument selected is immediately shipped to the mem~ ber’s home by prepaid freight for thirty days’ free trial. . If satisfactory, the balance is paid in convenient monthly payments to suit the purchaser. Otherwise the Piano is returned at the expense of the Factory, with no further obligation on the part of the member. The Club guar- antees your absolute satisfaction. Nationally Known Pianos of Highest Quality The instruments offered under the Club Plan are the products of the Cable Piano Company—world’s great- est manufacturers of Quality Pianos and Inner-Players. This$8,=000,000 company, now in its 45th successful year, i stoo well known to need comment. Cable—made instru— mentsare in use in every part of the United States, as well asin many foreign lands. They are highly recommended by professional musicians, artists and piano teachers ere. Hundreds of leading schools, colleges, clubs, and institutions use Cable-made Pianos exclusively. These beautiful Pianos are offered under the Club Plan at Savings oi from $90 to $140 Player Piano Club Plan Saves $135 Anyone can play any and all kinds of music as well as the best mu— sicians, without study or practice. Also plays by hand as any good Piano. Has latest ex- pression controls and improvements. uine mahogany. Will last a lifetime and retain its tonal beauty. A Grand you cannot help but admire. Beautiful tmwnmu Club Plan Saves $90 An honestly-built, high- grade instrument. Won- derful tone quality. Sturdy construction throughout. Will lasta lifetime. Every partthe best. Elegant case in rich mahogany. A Piano you’ll be proud to own. satisfaction. or Player. ' ASlumnaryoithe Club Benefits 1. Factory prices—save $51) to $140. 2. 30 Days’ Free Trial, with absolute guarantee of 3. A special plan of easy time payments. 4. The factory pays all the freight. 5. F me and full cancellation of debt if buyer dies. 6. Exchange privilege within a year with full credit. 7. Choice of very latest models in Grand. Upright 8. Long—time warranty against defects. Write to Club for Full Details Readers who wish to take advantage of the Club saving ‘7 are urged to send immediately for full details of the Club Plan, descriptions of the instruments, special Club . Write or fill in the coupon at the right and mail it direct to the Club Manager. Cable Piano Co. / prices, terms, etc. s‘ a 81' St. Charles Factory / Chicago", at 5...... r4. u.....n.-- m an..." Baby Gran Club Plan Saves $ 140 Strictly a quality Grand. Deep, rich tone. Elegantly finished gen- Clflcago 0’” «is . «aegis ‘W Great Cable Factories Cable Write today or send sum“! the coupon below for details of Club Plan. ~“ ivbwrso 06/ ° 00 9’ o QR? ‘ 6‘6 / 0" seé by K“ ..«/‘ ' 6e " x”, ,_ II", "J," x. v‘ ,x' ,. qbiw- DETROIT lbb'l] It costs just what you pay for 1% tons of feed, because that’sall the average eow eats in a year. Realizing this, can you afiord to feed any but the best dairy ration to your cows, especially when you know that good feed will return in profits many times its slight additional cost as compared with inferior feed? Quality and highly productive and truly economical. . I proven formula that never changes, every sack of Larro is thesame— no matter when or where you buy it. ' - Ask the nearest dealer THE LARROWE MILLING COMPANY uniformity make Larro both Manufactured from a tested, .4— MICHIGAN It Pays Its Way 4614 dalrylflg "El separators to clean and sterilize. cream production. in five sizes United States Representatives by Increasing Cream Profits CREAM SEPARATO * Imported duty free from Finland, one of the world’s most famous one! ‘ H t The vibrationless bowl skims and deliver: better than 99% of butter ” 'v fat. Lacta’e records have-never been beaten in competition. We challenge the world to equal Lacta’e performance in close skimming. Lacta is also the easrest of all 30 Days’ Free Trial Just select the size you need~it will come to you at once. We will prepay the freight. Note the easy starting, easy running, simplicity of construction and your increased If after trial you are dissatisfied, re- turn the Separator at our expense. Made 00 . . . . . . . . UP Write today'for Catalog and Sale: Plan BALTIC SALES COMPANY, Inc. Dept L310, 105 S. LaSalle Street, Chicago ,‘I7g_. Send no Money FREIGHT PREPAID Only a month ifsatisfied An Ironclad writ- ten Guarantee. man and lessens strain. ance is continuous. ensilage cutter construction. 18" Main St. The Cutter for Profit To get themost profit out of your 3110, fill 1tw1th the mmplest stron g- est and most economical _ made. _The Papec's few parts and Correct destgn reduce draft and lengthen life. Its positive Self-Feed saves one The Papec won't clog on any silo; its perform- '_I‘hat one fact has made thousands of Papec boosters. The Papec IS built by people who have long specialized in Write today for new Catalog and U. S. Gov’t Bulletin, “Making and Feeding Silage.” Both tree to silo owners. P APEC MACHINE COMPANY Shorteville, N. Y. {Throws and Blows _ saves One . _, M' * Cutter Your Neighbor to: a : . i. =|| . menu‘s}; a.ng Iié‘gggzil .. lavennemenu rates to encourage the growing of UPI-1‘ or 3410 per inch, lose 2% for of math (allowing date of insertion. SEND Im ""69? "Ill holding 'OI' reputaou is Thirty sent: (800) per agate ine per insertion. oath it sent i ll. llllnfliivoun AD AND ou can see how men Inee w . m, FREBEFiEth’ERs DIRECTORY, intomann BUSINESS FARMER. MT. CLEMENS. MIOH. oreeoon or Live Stool er woolen reds on the terms of our readers. Our advertlslng rate mi Fourteen agate lines to the column inch with order or paid on er before the 10th WE WILL PUT [T m TYPE ' . ' wu Nil-“00‘ Alum mull-mung unsuilvgustoc‘: S?ie :1 It you are considering a we I V at once and we will claim the date lair Address, les Stock Editor. M. 8. F.. t. Clemens . Y unz stock (or sale. Eycerrdigiingy Sixty and Federal Government. " fr pnces and dose ion. wntiau‘ii 'diltwiLaua. BELDINO. Mich. —JERSEV BULL. 8. TORMENTOR 53cm. SALE , 4 yam-39:9. Kind, gentle, an . N.. . me EméerMORnRIS, Farmlncton, Michigan. HEREFORDS REG. JERSEYS. POGIS 99th OF H. F. AID Me Herd GUERNSEYB MAY _ GUERNSEYS —— ROSE STATE AND FEDERAL ACCREDITED Bull calves out of Duns up to 877 pounds fat. Sired b Bulls whose Dams have up to 1011 ounds at. The homes of bulls; Shuttlemck May use Se uel, Jumbo of Briarbank and Holbech' Golden n1 ht of Nordland. From Dams pro- ducinz 10 .18 fat. 772 fat and 610 fat. GEORGE L. BURROW! or GEORGE J. HICKS. Saginaw. W. 8.. Michigan. BEST GUERNSEY HEIFER CALVES $20.00 each. EDGEWOOD FARMS, Whitewater, Wis. PRAGTICALLY PURE GUERNSEY DAIR calves, 7 weeks old, $20.00 each, shipped C. 0. D. L. SHIPWAY, Whitewater, Wisconsin. ‘ AYBSIIIREB FOR SALE—~REGIS‘I’ERED AVRSHIRE BULLS, fit for service. ’ . B. Tested. B in heavy pm- ducing dams. Findlay Bros... Vassar, Michigan. Hereford Steers Aronn ‘ 0 lbs. 66 Wt. Around 740 lbs. 38 Around ago lbs. 46 Wt. Around 525 lbs. to Wt. Around 950 us. as Wt. Around 450 1b.. ' ' i that bum-ha. Deep reds, deborned, :32 Tim e: cows? Begl' mguefgédifi usually that o more . :3 searchqu from any bum VII V. IALDWIN. IMO". Weoello 00.. Iowa. VI to. . ’ ' use alnereeoe mos 156‘. u t I tamarind W . , . at W SHORTHORNS vouua BULLS that will .please t ritical buyers. Write for rnculars. the .mgfi KCING a SONS, Tekonsha. lchlnan. 'town! HAMPSHIRES. 5:.- r'" it“: ore-:- 7 r " or.‘ e JOHN w. Veii’voed. headlamp: ., n5. ‘ .Fli: WASHTENAW COUNTY COW SUPPLIES .BANQUET -FIF.TY-EIGHT banqueters had a pint of milk apiece made for them in sixteen hours by Houwt- je Maid Korndyke Segis No. 548,695. The occasion was. the annual meeting of the Washtenaw County Holstein. Ass’n held March 16th at Saline. And there was enough milk left in the kitchen to feed all the cats in For Houwtje Maid has aver- aged 97 pounds or pints of 3.95 per cent milk' a. day since freshenlng January 27th. Her performance is not exactly a surprise to her owner, Wm. Rundel of Saline, for in Cow Testing Asso— ciation work from December 8th, 1923 to November 11th, 1924, she ga've 21,788 pounds of milk, testing 3.8 per _ cent containing therefore 842.4 pounds of fat, the equivalent of 1010.88 pounds 0 fbutter! She was milked twice a day except for the first three months. ‘ Small wonder the program of the evening was full of pep when the participants were full of “health—— vitality—nutrition"! Pres. Wm. Austin presided over the meeting. Speeches were inter- spersed with vocal music by the “Men’s Quartet” of Saline, pialno renditions by Miss Janis Austin, songs by Harold Miller. Of especial attraction was a duet by Miss Austin and her brother George, piano and comet. ‘ The speakers of the evening in- cluded H. S. Osler, County Agent; A1 Watt, Mgr. of the Washtenaw Fair; State Holstein Assi’n Secretary J. G. Hays, and Carlos Beckington of Ypsi— lanti. - Young Becklngton gave a very in- teresting account of his trip to the 1924 National Dairy Show. His trip was financed by the Washtenaw County Holstein Ass’n as a reward for high class work in Boys’ Calf Club. Hays sketched breifly present day doings in State Holstein circles. He ended his haraugue by a True Type demonstration using famous (?) knock—down portable pastelboard model “Ornery”. Some cow! The business session resulted in re—election of Pres. Wm. Austin, Vice—Pres. Glen Birg, and Sec. Walter Srpalding. Frank Geiger was chosen Treasurer and for new directors W. L. Rundel, and R. B. Watrous were selected. The officers were directed to lay out a plan of activity for the next year—calf club work and show- ing at fair being two projects for special consideration. Movies from the extension service of the National Holstein Association, a two reeler, called “Jonathan Barr’s Converstion”, capped an evening packed with pleasure. WHY CONTINUE TESTING? ANY farmers ask this question after they have tested their herds one year in an associa- tion. L. C. Payne completed his se- cond year in the Macomb County As- sociation No. 1 during September. One cow in the herd, a four year old grade Holstein, produced the first year 7502 pounds of milk and 239.8 pounds of fat. The last six weeks of the year she was well fed and put in- to good condition. After freshening she was fed according to production, and the second year produced 14,184 pounds of milk and 484.3 pounds of fat. The increase in the second year over the first was 6682 pounds of milk and 244.5 pounds of fat. The increased return over feed cost in the case of this one cow more than paid the'testing fees the second year. “Dairy Extension Dept., Michigan Agricultural College. SHJAWASSEE HOISTEIN ASSOCI- v ATION HOLDS ANNUAL BANQUET Thursday evening, A the 12th, at the Hotel Wilder- ; muth, Owosso, ushered in the annual meeting of the Shlawassee County Holstein Association. Some forty banqueters enjoyed the follow-J, ins program: speech of welcome, Mayor Wright; mom;- son‘gs, “Kit . u M h an», . .> ..,e, 4" .(We invite you to contribute your experience m raising ute— stock to this departinent. Questions cheerfully, answered». - ' 1.39; ~94 sociation; “The Holstein Breeder Today”, D. D. Aitken, Flint. The Kline sisters, little girls, scor- ed a» big hit'withatheiriduets, especi‘ . - :‘ ally one song about “The Holstein" Cow”. The talk by, Mr. Aitken, ' Ex—President of the Holstein-Frieslan Association of America, was gobd as usual. The company united in a vote of thanks to Mr. Altken. The business session following the banquet revealed the finances of the Association to be in good shape, over $100 on hand. As a good share of this fund accrued from the Count): Sales Manager system of selling sur- plus stock of the members. it was de- cided to continue the system with the former manager, Fred Martin of Owosso, in charge. Local Holstein matters occupied the attention of the breeders present, special interest being shown ln‘cow testing association work, and show- ing at the Fair. .' Ofllcers elected included C. 8. Baldwin, Bennington, President; Mrs. Burt Nowlin of Laingsburg, re- elected as Sec-Trees; J. Fred Smith of Byron, Vice-Pres. The four direct- ors elected were Chas. Paine, Der- and; Fred Martin, Owosso, Jay Bowl- by, Ovid; and Dan Dutcher, Owosso. FEEDING POTATOES T0 MILK ‘ cows . Is it all right to feed potatoes to a milk cow? If so, how many?—M. 0.. Grand Ledge, Michigan. OTATOES do not contain a very large amount of digestible nut- rients per one hundred pounds but they may be fed as a root crop to dairy cows. They should be" put thru a root cutter to remove the dan— ger of the cows choking. I will ad- vise not feeding over twenty-five to thirty pounds per day as too many potatoes are liable to cause scours and butter made from the milk will be soft and salvy.———J. E. Burnett. Associate Professor of Dairy Hus- bandry, M. A. C. VETERINARY DEPARTMENT REMOVING \VARTS I have a cow that has warts on her teats. Please advise how to get rid of them.——~M. L., Branch, Mich. THINK perhaps the best way to I get rid of warts on the teats is to cut them off. The wart and skin should be properly disinfected. the cow properly restrained and the wart cut off with a pair of sharp scissors. The wound covered with a pair of sharp surgeon’s scissors. The wound covered with sterile sur- geon’s cotton and retained in posi- tion with adhesive tape for a day or two until the wound scabs well over. It is best to remove these warts when the cow is dry. Occasionally, good reports are given from the daily ap— plication of sweet oil to the warts.— John P. Hutton, Associate Professor of Surgery and Medicine, Michigan Agricultural College. SOW EATS PIGS I have a young sow that had a lit- ter of pigs three days ago and now she has commenced to kill them and eat them. What is the cause of this and what can I do to cure the habit? —M. H., Harbor Springs, Michigan. is claimed by some authorities that the sow eats her pigs be- cause she is very short on protein material in her body after having produced a litter of pigs and an udder of milk. To remedy this con~ dition a sow should receive about one quarter pound of high grade tankage once daily in' her feed. To obtain best results, however, the feeding of tankage should begin ear- ly in the period of pregnancy and be continued until the sow has her pigs and are weaned—John P. Hut- ton, Assocla, to Professor of .Medi- cine, »Mlch:lgah' Articulturel Collage. get . , l DITOR:—-—'-‘“We believe you are in- terésted'in some relable infor- ' mation on the bean situation, considering the United States as a 'whole. We are accordingly sending herewith some charts which may be of interest to you. Possibly you will figure this information of sufficient value to your groWers to re—produce one or more of the charts in your good publication. The information thereon can be readily checked, and we assure you it is absolutely relia- ble. Chart No. 1 gives prices on various grades -of beans delivered Chicago Prices Feb. 16-1925 F. O. B. Chicago _ Limas $14.80 _ Blackneys $10.80 _ Pinks $8.80 _ ,Small Whites $8.65 _ “'Mrge‘Whites $7.40 _ Bayos $8.30 _ I I Cranberries $8.80 Icoiomdo Pintos $7.25 ‘; Idaho-Great Northern $7.30 ich. H. P. Pea Beans $6.55 7 Chart No. 1 basis. You will note that although Michigan beans are the most desir— able and the most readily salable of ‘any’ of the varieties raised in the United States, with the possible ex- ception of Limas, it is the cheapest bean on the list. There is no reason in the world if Michigan growers who still own beans will keep them off the market, but what they can ob- tain better than a $6.00 basis for » 2* California Varieties them. Reasons for this will be emphasized as the other charts are studied. It might be men- tioned here, however, that there is no danger of any serious competition from any other bean. The volume of beans back in other States at present is the smallest they have had in years. , They are not worrying in the least as to their ability to early clean up their remaining stocks regardless of price, and as fast as the Michigan market is advanced they will in turn advance their price to keep the dif- ferential approximately the same as indicated on the chart enclosed. The chart No. 2 showing Califor- nia stocks as of February 1st for the past five years is of much interest to us. The chart shows total tonnage of beans held back in California in- cluding all varieties, such as Lima, Pinks, Small Whites, Large Whites, Bayos, Mexican Reds, Red Kidneys, Cranberries, Blackeyes, etc. whereas on the same chart the proportion of Large and Small Whites to all vari- eties is shown. You will notice that the stock of Large and Small Whites on hand February 1st is the smallest they have ever had in California, whereas the stocks of all varieties of beans on hand on February lst, 1925 is just a little more than half as many beans as were on hand Febru- ary 1st, 1924. This is all the more remarkable when you consider that on February lst, 1924 they had the smallest stock of beans in California that they have had since before the war. All of the white beans in Cali- fornia will be readily consumed with- in the borders of the Pacific coast states. The stocks of white beans in California could possibly be better expressed by this statement, which is absolutely true. Namely—that during any two weeks of the crop marketing season so far there have been more Michigan beans shipped sales of Pea Beans, Five Your Average, 1919 to 1924 be! September lst tb' January 1st 3 42.1% a ‘ To January ls! 4!.1 % To ruary o are lst . ‘3 , : Reason Fer Low of ‘Beansw "i o H than the entire crop of white beans left in California at the present time. One of our men is on his way back from Idaho at the present time. He ' advises that there are not to exceed 100 cars of Idaho beans left. In- asmuch as their crop out there was 1200 to 1500 cars they have less than 10 per cent of their crop left and six months to go before new crop is harvested. _ In Colorado and New Mexico there are less than 50 per cent as many Pinto beans on hand at the present time as there were a year ago now. New York state crop of peabeans is virtually cleaned up. New York state bean dealers being unable to get sufficient tonnage in their own state to take care of their trade are new buyers of Michigan beans. Chart No. 3 shows our average percentage business for the past five years. The top line represents 100 per cent. We start our crop year with September lst, as that-is the closest even month date we can ar- rive at for the starting of the move- ment of new beans. You will note that 60.4 per cent of the business for the year is done between September lst and March lst. In other words, there should be left in the state on March lst practically 40 per cent of the total crop raised to take care of the demand from March lst to Sep- tember lst. From September 1st to March 1st this year, according to railroad reports, there have been shipped from Michigan practically 6,000 cars. There should have been left on March lst in order to take care of the demand until new crop can be harvested, 4,000 cars in Mich- igan. The total crop, however, was only approximately 8,000 cars. Ac— cordingly there cannot help but be a big shortage of Michigan beans be- fore new crop is harvested, particu- larly when you consider that this year the other states from which the trade get a certain proportion of their supply of beans, are holding just about half as many beans as California Bean Stocks February lst they did a year ago now. Railroad reports show that between March 1st and September lst last year there were better than 4,000 cars of beans shipped from Michigan. At the out— side, including seed stock and every- thing, there cannot be left in Mich- igan at the present time more than 2,500 cars. Accordingly any way you look at the situation the statis— tics point to a much stronger market later on. There is no reason that we can possibly figure out why Michigan beans should not be selling at least as high as beans raised in other states, this year in particular when Michigan unquestionably controls the stock of beans in the United States, why the farmers chould not get $6.00 or better for their beans—Chatter- ton and Son. Milking machines will save labor if a sufficient number of cows are being milked. The herd should number at least 15 cows before a milker is a time saving investment. A mechanical milker will not injure the udder or the cow or cause her to dry up if reasonable care is observed in its operation. Stripping after the machine is necessary to avoid drying up of the cow. Do not leave the milker on the cow too long after practically all the milk is drawn. This may injure the cow's udder. u b (I) do no "‘ is s s! We! °° g- a a. g». s: 2». 000 Sb <39 b- Hes I in '3 H rted tam tr will gens l‘ for n . 3. C of worms. summer gains. Fit your team for spring work with a‘ course of Dr. Hess Stock Tonic. It gives them strength and endurance. feel it on the lines. Excellent for mares in foal, and ewes at lambing time. Buy it by the pail More ? REMEMBER—When you buy any Dr. Hess product, our responszbzlzty does not end until you are satisfied that your investment is a. profitable one. Otherwise, return the empty container to your dealer and get your money back. DR. HESS 8: CLARK, Inc., Ashland, Ohio Din-iland‘Dis-infeCtant For-Sh p,-Ticks "for Hog Lice -.‘-'for Health \ f, \ I‘h“ _ . . \ M“. i . ~‘ .\ .u - ’ 7. 9““;1 . V .L." » . . I -‘ I 1! Dr. Hess Stock Tonic £7126 Springtime Cbnditloner SPRINGTIME is the time that farm stock are out of fix. A long winter diet on dry feed—woody timothy hay, corn fodder and other roughage—tells in ill condition; blood out of order and worm pestilence. . Give their systems a spring house-clean- mg with a course of Dr. Hess Stock Tonic. It will put your cows in trim for summer milking. Excellent for cows at calving. Feed it before freshing. It will relieve your brood sows of constipation, all hogs It will put your young stock, calves and shoats, in fine ’condition for, 25-"). pa“, $2.25; loo-lb. drum, $8.00 (Except in the for West, South and Canada) . Honest Goods—Honest Price. Why Pay .. ‘\ LI \ "2’ .s l 4" Mir . I ,You can Brings Any Size on New. Low, SEPARATOR built and guaranteed by the oldest American manufacturer making cream separators only. Proved the most pro- fitable by experience of many thousands of enthusiastic owners. Skims thor— ‘, oughly. Unmatched for easy turning. Easily cleaned. Flushes completely—- saves cram. Made in capac- ities from 850 pounds down i to one cow size. ' Allowance Made on Old Separators of Any Make. SOLD DIRECT You buy direct at low, fag-V: bury prices on our new. ro- duced easy payment. Shipped promptly from cnlmo. FREE CATALOG Do not fail to at our fully illus- trated mmlog iii-st. See our ex- tremely low prices and uh» " easy terms. WRITE . IIERIOAN SEPARATOR 00. " Box 20-E. Bolnbrldgo. II. V. HORSES Impo stallion "Juriste". two hundred “- work team. 0. PHI-II nu, :Ilohlsan. Every Day You Need yearns (STANDARDIZED) 'ro AID IN KEEPING All livestock and Poultry Healthy Kills Lice, Mites and Fleas. For Scratches, Wounds and common skin troubles. THE FOLLOWING BOOKLETS ARE FREE: No. lst-FARM SANITATION. Describe: and tells how to prevent diseases common to ll No. 157-000- BOOKLET. Tclla how to rid the In of fleas and to help prevent disease. No. 160-IIOG BOOKLET. Covers the We! common bog diseases. No. HIS—HOG “ALLOWS. Gives comics dlreo dons for the oonsunctionof a concrete hognllo'. No. 163—POIILTRY. How to get no oi lice and mime. and to prevent disease. amusement-mummy- ummsum. MIMI. INDUSTRY nrmmmn U Parke, Davis 8: Co. DETROIT. MIC“. WARNING ! Stallion Purchasers B that the 3111110 ° "’2... mm streams"? h". Purchase subject to a rural for Ifm. registry pagan: by thevBovartmcnt o - IIOHIOAN HORSE BREEDERO' association. n. 3. Hudson. Secretary. East LansingI f A . BABY GlIIGKS .3, ' Tancred Straink” WHITE LEGHORNS fi‘ Park’s BARRED Rocxs Single Comb f.» Rose Comb RHODE ISLAND REDS . SUPERIOR CHICKS “x n. ALA. eazccs (7.6.9., IQ? (“~29 I II ’ D'e‘e; c R. Bell’s-rd and Tom Barron W. Leghornr-Heaoy home—R. . and prices and tree cetalog before you buy. Flock are careful] culled and developed on free range. All chicks inspected, no cripples or Weaklinga. Every one are hand icked an stron'an healthy. 100% Live Delivery—Postage Paid Satisfaction Guaranteed. Write Now. White Leghorn and Barred Rock pullets after May 1, at low prices. Mrs. 150 Rhode Island cslved June 1, 1924 were the finest saw. Knoll’s Hatchery, R. R. l2, Box 3., Holland, Mich. ; ' d Lakeview’s ' m... Snoddon, c1 Fliion. Mich., writes: “The Reds and Barred Rest chick: I re- leoklng chicks I I raised {43 1o tummy. I have ordered ever chlokr from many poultry farms, and never have had Ens satisfaction I have had with the Laknlew Poultry arm. ' That is a comparative test. Tin reasons for the results are manifest. Highest grade fqundatipn stock= methods. Experience in hatching, Whlc gvoéd kil'niirséhakes and be sure of Vigorous as well as egg— re c 1c . I No matter how high the breeding, a. chick Will not grow into a profitable hen unless 11: is proper is strong. ., Our catalog tells many useful things regarding poultry. ' ' It's free. Most careful breeding ' h cables no to l! batched and LAKEVIEW POULTRY FARM. R. 8, Box 8. ' Holland, mu. From World’s Greatest La era LOW PRICES— Catalog .5. c. Rhoda wand sch—REWIL'S" Whites-Sheppard's Almanac—Park's Barred Roch If you want pure bred chick: that are bred right, hatched right, and shipped right, tint grow and will make you a profit, get our new low rec Chick! that are lively and health stock. One-fifth down books or er. flocks are unusually good. Order today. Prices on (prepaid) 25 so 100 Ed. locks, ................. $8.00 315.00 R. I. Reds, ......-.........-. 4.25 8.00 15.00 Wh. Rocks, ................ .. 4.60 8.50 10.00 Wh. Wyandottes, ........ .. 4.50 8.50 18.00 Wh. I. Br. Leghorm. .... .. 3.75 7.00 13.00 “2100 Per Cent Live Delivery from pure-bred carefully selectedr Good poultry JUdEeS Buy our Pure BreduCarefuIIy Selected fit,“ A Last year we were not able to 500 1000 supply the demand. Order early 312.00 0140.00 R : rug. _ at ,M m . ’ 12.00 140.00 9 2 “me” . . ec rues 11.00 150.00 Bank “‘13 “‘W' 11.00 150.00 W‘SHTEMm 0 HATGHERV. 02.00 120.00 Ann Arbor, nimble-n. Pure bred. high qualiltg Barred Rooks, R. Anconas, Mixed Chicks, Bank reference. WINSTROM POULTRY STAR QUALITY CHICKS usiity can’t be beat. hits Leghorn flocks. It pays to bu the best and Star selected caret , bred from S. C. Tuner catalog and price do STAR HATOHERY. L. Tlnholt, Box 1'. Holland. Michigan. Profit Makers—Early Layers Leghorns. Anconas. Rocks. Reds, Wyandottes. Orpingtons. Minorcas. Lowest prices. Cata- 103 free. Adds-es snearest office. D. T. FARROW CHICKERIES ill. Holler ll Hilvnuk Wis indium ll H 8. c. BUeSF tLEkOI-IOIyI CHICKS FROM CARE- 1 ll on rec range. my C}. w? (WEBSTER. 3am, Michigan. THE BUSINESS FARMER “The Farm Paper of Service” TELL YOUR FRIENDS ABOUT IT! FREE TO ASTHMA SUFFERERS Free Trial of a. Method That Anyone Can Use Without Discomfort or Loss of Time. We have a method for the control of i Asthma, and we want you to try it at our expense. No matter whether your ' case is of long standing or recent develop— ' ment, whether it is present as occasional g or chronic Asthma, you should send 1 for a. free trial of our method. No matter ; in what climate you live no matter what » your age or occupation, if on are troubled , with asthma, our metho should relieve : you promptly. . ’ We especially want to send it to those apparently hopeless cases, where all forms of inhalers, douches, opium preparations, fumes, “patent smokes,” etc., have failed. . We want to show ev one at our expens that our method is esigned to end a difficult breathing, all 'wheezmg. and all those terrible paroxysms. This free offer is too immrtant to neg- lect a single day. Write now and begin the method at once. and no money. Simply mail coupon below. Do it Today --YOu do not even pay postage. . 1mm rum]. com! 7 ‘ f FRONTIER ASTHMA CO.. Boom 396C. , Niamm Hudson Stu, Buflalskflf. Send free trial of your—method ,3 ed Males bred from hens with records up 0 29 strong vigorous fowls are, mated to produce our Chicks. ,ogeafy la ng, tested flocks, Great Winter Layers. .ive Pogtpald prices 25 50 100 500‘ 1 S. 0. White a. Brown Leohorns, ...... ..$3.15 $1.25 $14.00 $81.50 $130.00 ds, ......... .. .. 4.50 8.50 16.00 7750 15 ehvery Guaranteed. 000 . 0.00 .75 1 5.00 72.50 5.50 1 0.00 50.00 .............................. ..'.I 2215 Extra Selected Stock, $2.00 per_100 higher.‘ Each order packed personally. There is no risk. Free Circular. FARM, Box 0-5. Zeeland Michigan 8 coin] hi ade. hated to 5' eggs per year. Only Write at once for 1 Profit VA“. Producing \{gi ‘Baby Chicks ln 3 Months From 250 B. F. White Leghorn Pullets That’s what Mr. I Wade of Fen- ville, Mich., made in three months time from pullets raised from chicks he bought of us last spring. You can make big money with 'our profit making chicks. Chicks Chicks Our stock is strong, healthy, free range, Tancred and Tom Barron White Leghorns, 'S. C. Rhode. Island blood lines in the country. 100 per cent live delivery guaranteed, post- paid. Big, fine catalog free. 8 to 10 Weeks Old Pulleta We specialize in 8 to 10 weeks—old pullets. Extra choice ones at prices that please. Write today. BRWBIERAEREDERIICKSON NUMRY FARM Holland , ‘Michigan KTHAT LIVE 'Box26 on: Place your order baton Order now for c 12.3"”- “3% tern-w chick , Reds, Parks’ Barred Rocks, the best. ’: you to , on to the stable at general rout- ine, in a legarthy from sitting late at a neighbor’s 101' a radio con- cert. Breakfast of a pulle-t’s egg, coffee and a. roll. Muddled my brain for a. spell trying to figure a way to clean stables easily. Gave up in despair and used the old form, cussing the while Commanded myself to veal all calves this year and not be pestered with stubborn yearlings running past open doors. In to lunch of steaming hot soup, consuming three deep bowls- Pur- used the daily paper a bit, and saw where some. bad men pistoled a bank- er for his gold. Marveled at the devilishness going on in the world. Sauntered forth across lots for a chat with my in-laws, and we jibber jabbered until thewhour of eight. Returned home to find the chores finished. My wife and oldest daugh- ter in a. surly mood. Attempted to act coltish, doings step dance on the kitchen floor. 'But fell ungrace- fully, nearly wrenching my hip. Arose expecting they would laugh uproaringly, but they only responded with a. smothered cackle. Decided not to try any more antics, so sat in my favorite rocker and listened with great pride while my daughters played a. melody on their violins. Retired early—A. P. Huron COunty. ' Ame; late! .fccdared the fire and Ballard, PRUNING TIME FOR. ORCHARD IS HERE RUNilNG time for the farm or- P chard. is here. Warm days dur- ing early spring can be spent in renovating the fruit trees. Moderate pruning every year en- courages annual fruiting and is much better for the tree than heavy prun- ing every three or four years. The work should not be delayed until growth starts. Trees which have not been pruned regularly and have grown too bushy and dense should receive a. rather heavy thinning of medium sized branches in the outer portions of the tree. If possible, avoid removing large limbs because this leaves the tree thin in places and too dense elsewhere. All dead, diseased, brok- en, injured, crossing and rubbing limbs should be removed as tar as possible. When young trees have been properly pruned until they reach bearing age, only moderate pruning of small branches is required to keep the tree properly thinned. Sunlight will then be admitted to the central portion of the tree. In pruning of young trees special- ists recommend keeping the head low. They also urge a. pruning sys— tem which will avoid having two - branches leave the trunk rat the same 3 point. ’should be saved, and as far as poss- :ible so selected ,evenly distributed around the tree ‘as well as up and down the main » trunk. Four or five main branches that they will be In all your pruning work use sharp efficient pruning tools. Make all cuts clean and close and wax all wounds that are over an inch in di- ameter. WHY NOT A MILKER? No use wondering what a. milker of the proper size to fit your own needs will cost installed in your barns. 0n the back cover of this issue, the Delays]. Separator Company. one. of the oldest and best known manufacturers of dairy equipment in the world, are offering an engineering service absolutely free which you dairy- men who are milking ten or more cows ought to accept. The power milker has come to stay. There are a. great many dairy farms in Michigan equipped with power mllkers now and there will be a. good many more before the end of this very year. It is surprising to notice that those milk pro- ducers who are using power milkers are usually the suns ones who are‘cornplainr ing‘ least about market conditions. The owner .of a. good milking outfit can laugh when the hired hand walks out. He can, milk and strip twenty to twenty-five cows in an hour and then spend the..evenin8 041 his radio. The best; .part of it,18"'tltut'th‘e DeL‘aval people nerve~ . ,just reduced—theirprices on mike” and Offer easy terms . of purchase which are ' adjuswble‘tofany farmers ’W’e 'W 3 ‘ e , C. M. Bradshaw in Prevent- ing White Diarrhea {tn-u The following letter will no doubt be of utmost interest to poultry rate- ers who have had serious lossesfrem White Diarrhea. We will let Mrs. Bradshaw tell of her experience in her own words: “Gentlemen: I see reports of so many losing their little chicks with White Diarrhea, so thought I would tell my experience. I used to lose a great many from this cause, tried many remedies and was about die- couraged. As a. last resort I sent to the Walker Remedy 00., Dept. 68?, Waterloo, Iowa, for their Walko White Diarrhea remedy. I used two 50c packages, raised 300 White Wy- andottes and never lost one or had one sick after giving the medicine and my chickens are larger and healthier than ever before. I have found this company thoroughly reli- able and always get the remedy by return mail.-——Mrs. C. M. Bradshaw, Beaconsfield, Iowa.” Cause of White,,Diarrhea White Diarrhea is caused by the Bao- illus Bacterium Pullorum. This gem is transmitted to the baby chick through the yolk of the newly hatched egg. Readers are warned to beware of White Diarrhea. Don't wait until it kills half your chicks. Take the “stitch in time that saves nine.” Remember, there is scarcely a. hatch with- out some infected chicks. Don't let these few infect your entire flock. Prevent it. Give Walko in all drinking water for the first. two weeks and you won't lose one chick where you lost hundreds before. These letters prove it: ' Never Lost a Single Chick Mrs. L. L. Tam, Bumetts Creek, Ind, writes: “I have lost my share of chicks from White Diarrhea. Finally I sent for two packages of Walko. I raised over 500 chicks and I never lost a single chick from White Diarrhea. Waiko not. only prevents White Diarrhea. but it gives the chicks strength and vigor; they develop quicker and feather earlier.” Never Lost One After First Dose Mrs. Ethel Rhodes, Shenandoah, Iowa. writes: “My first incubator chicks, when but a few days old, began to die by the dozens with White Diarrhea. I tried dif— ferent remedies and was about discour- aged with the chick business. Finally, I sent to the Walker Remedy 00., Waterloo, Iowa, for a box of their Walko White Diarrhea Remedy. It’s just the only thing for this terrible disease. We raised 700 thrifty, healthy chicks and never lost a. single chick after the first dose.” You Run No Risk We will send WALKO White Diarrhea. paid—so you can see for yourself what a wondebworking remedy it is for White Diarrhea. in baby chicks. So you can, prove—as thousands have proven—that it will stop your Iosses’and double, treble, even quadruple your profits. Send 500 for package of WALKO (or $1.00 for ex- tra. large bold—«give it lrn all drinking water and mtch results. You’ll find you won’t lost one chick where you lost doz- ens before. It's a positive fact You run no risk. - We guarantee to refund your greatest little chick saver you Mr used. The Leavitt 8: Johnson National Bank, 100, Iowa, stand back of our guarantee. WALKER REMEDY 00.. Dept. 087. Waterloo, Iowa. mfing-‘Eofii'mfi‘w . o k . _ 22:3. .. ms; ,1 _ Remarkable Experience of Mrs. Remedy entirely at our risk—postage pre- ‘ money promptly if you don’t find it the. the oldest and strongest bank in Water- 1 Send me the “50c r lat size or A '71. . economical lar el size) pac so of W‘olkol - er'vlzth beet‘lamlgo heavy to heats this year! _ Is there assnr- , am thil: the extremely high extrac- tion a: sugar per ton of beets (301 lbs.) will be repeated next year? ‘Does the farmer get a just return " per acre for his beets when theton- nage runs low and the extraction high on the present 45-515_7contract? Can the acreage planted to sugar beets in the United States he increase ed unless the farmers get contracts which will give them full benefit of a tariif policy? If a 45-55 contract (or others of similar nature) show exhorbitant profits to the beet manu— facturer under the present tariff would it not be a. logical solution to give the farmer a 55-45 contract and see if the tariff commission would re- commend a reduction of tariff on sugar? Would the farmer have re- ceived this year an unreasonable price per acre for his beets had he had 'a. 55-45 contract? Assuming the tonnage to have been 6, which I believe is a fair average per acre planted (Michigan crop reports show 7.1. tons per acre harvested) last year and had'we a 55-45 contract we would have received a gross return of $41.56 'per acre less $10.00 per acre for hauling which would make $31.56 per acre, for land and labor in raising the crop, or a little more than the beet worker received last year per acre on the contract labor. On the present 45—55 contract did the farmer receive as much per acre for his beets for use of land cultivat— ing. pulling andhauling as the beet worker received for about a month’s work this year? ‘ If the extraction should be as low as 223 lbs. which is past history. and should sugar be $6.50 N. Y. or around present prices, making the price of beets $6.50, can the growers of beets assure such chance buying all his labor and ma- chinery on a high tariff market? Is the farmer justified in being in favor of- any tariff policy that does not take into consideration the fact as to whether or not the farmer is receiv— ing his just share of the rewards of a tariff. Of what account is it to have a tariff commission to find that the tariff on sugar should be reduced \ considering the cost of manufactur- ing sugar when they do not take into consideration the cost of growing the beets or what kind of contract the grower is getting? Are the par- ties receiving tarifi benefits to which they are entitled or if the growers were getting a better contract would the present tariff or even more be out of line in building up a policy of making ourselves self-supporting in the sugar we raise in the United States? ' It may be well to mention in call- ing attention to the high cost of farming that a few years ago the sugar factories furnished beet drills to the farmer for twenty-five cents per acre. This-was raised to fifty cents per acre last year and it is un— derstood that next year the farmer is to buy and furnish his oWn drills. if the farmer cannot get as much or more per acre net out of a crop of, beets as he can out of a crop of wheat or other crops which he ~is raising at ooSt and less on account of not being able. to receive tariff bene— fits on account of overproduction in» the U. 8., why should he be requested to ask that the present tariff on su— gar be maintained for the benefit of a' manufacturing element that aims to my the farmer only the bare cost of the raw beets-and do not give con- tracts which glve the farmer at least 50 per cent of the tarifi benefits? Why is it that the Michigan farm 'l‘ Swée' * anemia tarm- a.,;x« ~~ vy- organl-zations pass this important matter” by so indiflerently? Can this condition exist without the 175,090 Michigan acres usually planted to beets being planted to another crop so adapted to heel; ground, which generally is white beans, and there- by undo the benefits of a tarii! on this commodity by creating an over- production? Cannot the farm or- ganizations get farther with farmers' pro'blemsby adopting a policy of reg— ulating production instead ofendeav- , oring to market a surplus at a high price? Last year after the best farmer has deducted his contract labor $23.00 per acre and his extra hauling costs $10.00 from his beet -r\cfieck he‘has approximately $15.00 per acre on the average for his land, plowing, fitting, planting, cultivating and pulling—a sum not very attrac- tive considering the fertility .beets take from the soil. According to the best figures obtainable, it cost last year 2150 per pound to extract a pound of sugar—this being true an average acre of 5 tons of beets would cost $37.60, leaving a net profit of $15.60 on an average acre of beets of 5 tons. Why cannot this profit be divided with the farmer thereby plac- ing farming in Michigan on a more staple basis and also place the Presi- dent and the tariff commission in a better light with the Republican par- t . . At the present time is not the beet farmer of Michigan justified in stick- ing out for at least a 50—50 contract or no beets? If the western factories give 50—50 contracts why, do we not get them here in Michigan? Is not this after all the “High Cost of Ignorance”? Why does not the Michigan Sugar Beet Growers’ Association continue to operate and function? Why do the important offices of this organi- zation pass to the heads of other organizations who never grow beets and according to their statements in the press are as ignorant of the problem as would be «possible for a man to be?—C. E. Ackerman, Dur— and, Mich. » OCEANA COUNTY TO GET DAIRY- ALFALFA CAilLPAIGN LANS are being completed by Mr. Carl Hemstreet, county ag— ricultural agent of Oceans coun- ty, to conduct an intensive five day _Dairy—Alfalfa Campaign, April 13-17. A total of thirty barn meetings will be held thus reaching practically every farmer in the county. There will be two teams used, each consisting of a Dairy Specialists and an Alfalfa Specialist from the Exten- sion Department of the Michigan Ag- ricultural College. Each team will hold three meetings per day and will be able to consider the special prob- lems of every farmer present. The increasing difficulty of making dairy profits without high protein hay and the shortage of alfalfa in this county is the cause of much in- terest in the coming campaign. If you intend to go work, there is no better place to start than right where you are—Abraham Lincoln. c t i an All gobd saw handles are made of apple wood. because it does not break if a saw is dropped. # It 0‘ 8 A clean, disinfected poultry house gives the laying hens a chance to do their share. I O O # Plenty of bedding for the cows does three things—keeps them clearer, provides more warmth, and saves more of the liquid parts of the manure. C/ r, »‘ ‘ _‘ (.34-- V r- p .. ' . ~l 0- _ I. .— . 9 'lSOWer Without Interruption} Popular ,., p " uses include- a.- can” Ignition starting Ford: ringing burglar alarms protecting bani: vaults electric clocks calling PM porters firing blasts 1 ti tents and icct‘utg‘uildingn running toys radio ‘IA" Eveready Colum- bia Hot Shot Bab teries contain 4. S or 6 cells in a neat, waterproof Shot. job gets done in jig time. lumbia Ignitor. uses, Eveready Columbias batteries there are! New York FRO BABY GHIGKS tails, big lupped combs _aud alert e'es._ B that lay those large white eggs the bring high wires on the New lork Market. KMSTEI’S mun YOUR GAS ENGINE Will putt-putt-putt away, with never a skip or miss, if you hitch it to a high-power Eveready Columbia Hot Explosions are quicker and more vig— orous when started by these batteries. Wheels sing with a constant speed, and the FOR YOUR DRY CELL RADIO TUBES, use the powerful, long-lasting Eveready Co- This is the battery that’s as good for long hours of listening as the Hot Shot is for long hours of working. For all» are the greatest Manufactured and guaranteed by NATIONAL CARBON COMPANY, INC. M STOCK—THAT IS BRED WITH THE LAYING HABIT Hollywood and Barton English Single Comb Whlte Leghorns STRAIN MATINGS 250-300 EGG-BRED LINE Careful breeding, Metesflng and trapnesn'ng has produced our world-famous Kangcn’s Quality Laying Hen—A Utility Bird With Standard Requirements Our Leghorns aredong, deep-bodied, wedge— shaped birds. with wide been and low spread irdl the BOX Fly— F a h n e 0 t ock spring clip bind; ing posts on the ignitor at no exr tra cost to you. Ask for them by name at electrical ardware radio automobile marine supply implement and San Francrsco general stores Canadian National Carbon Co.. Limited, Toronto, Ontario _ SEND FOR FREE CATALOG It describes our wonderful breeding establish- ments. it tells what and how to feed your chickens for profit. it will show you how you, too, can double your poultry profits. x ZEELAID. MICHIGAN. before you R. 4—Box 5. _; ~ PmewBoged Baby Chicks A _ We are now boo '11 order; for MA! I. GRADE “'1?”le .FJIIHORNS amt AWJ‘nN Threw \ ...k§ are 2mm ‘ EXTRA SELECTED hens wath 1:: mafia» ’3K‘CR’QE‘ val SHEPPARD. ‘ - We insure OUR CHICKS for use nous. ‘ buy. I".- can new your ministry, er 100 and Up ml m1: omens 5‘”. our men. Wmm 0w: we: (11.1.5.3; and int-es Study. ‘ «w free range. 00 5.2» Live WERE?! Mind. Iceland. lichigan. m M bud. bred-today flocks on We lea so 100 500 Bull and M Lad-ans. AM“..m..-....-:‘...--._.:nca.so $18.00 $80.00 nun-on We mm km -._.. 1.00 14.00 05.00 II"! M 8. m use... ................. .. 3.00 .00 .00 mm can. u- , 5.25 10.00 45.00 R‘nforffioo: 8W Mt Mme (mm this ad in full confidence .x u so u w a you ran Free to r. 2 PlOGBE‘SSIV‘ Pouan ran-s. In: F. mm. Michigan- ' ' 1W m 1 did flocks r the but strains. High Grade Mona-why masses, imam m “ms 100 ,., Live Deliver m.——W m on so «on goo» White and Brown Hiram; Anson-0... . ..... ...... ......41.oo 31am $82M 5 are rm Ea...“ 3-2: is: as . White a sun ommgtons. vi! wnmouu..._.IZIIIITI 9200 11.00 82:90 110. | Mixed Chicks, 100. 812. 28% deposit book your order for future delivery. Befor- ence: First State and Savings Bank. THE HOWELL HATOHERY. Dept. 58, Howell, Mlchlgnn hands. FFMd rr-§ acorn. Brod for Size, Type and Eggs since 1910. Engisli Type White Leghorn-s The Deep Bodied Hens With the LargeComhs That Produce the Large White Eggs. The chicks we offer you this ear are from extra selected hens, sired by males. out.of liens hat laid these males being sired by a male from a 800-eg hen. - e Brice asked for them is very reasonable. They Will bring you rgger profits and absolute satisfaction. You will be benefltted by our 15 years experience hatching and shipping chicks. _ . , has great vitality and brings big returns in our . _ Let us mail you our catalog with prices. liv'e arrival guaranteed. Nine Weeks Old Pulletsfin May WOLVERINE HATCHERY H. P. WIERSMA, Prop., R. R. 2, Box 98, Iceland, MIGh. 270 eggs in 5 Our stock grows up uniform in size, customers 100% HOLLAND HATCHEY CHICKS from heavy winter laying stock produced by MICHIGAN’S OLD RELIABLE Butchers. operating the best Hatchery in the N HITE LEGHORNS Strong, well hatched Chicks from Hoganized, . Prepaid to your door. _ 17 years experience in the busmess and givmg absolue satis- Get valuable Illustrated Catalog free and lowest prices be- AN APPLEDORN BROS. HATCHERY. Pioneer Breeder, and State. Pure bred TOM BARB. N and AMERICA Barred Rocks, Rhode Island Re 5. free range stock. By insured "urcel Post Delivery Guaranteed. faction to thousands. fore placing your order elsewhere. HOLLAND HATCHERY AND POULTRY FARM, my, Anconas, 1 00 ‘a Live R-7-B Holland. Michigan 20 acres, not merely a Hatchery. this Furl" Get it now. W i I Ref. Regal Oak Savings Bank. DE . .d BRrovan léeghogna...é...h.éas_.... Barre cc 5, . an . . . Mixed assorted. 25, $3.00; 50. $5.50: You trike no chances. Free Catalog. H I WANT A JOB on your place this season. I Hill a pure bred chick of known ancestry, and bred to lay. )atalog. Rocks, Reds, Leghorns. MACOMB POULTRY FARM a HATCHERY. Halfway, Michigan. CHIX OF QUALITY Hatched in “'ishbone Incubators. $13 per 100 S. C. W. Leghorns, $62.50 per 500 $120 per 1000 Barred Rocks ...... .. 5 $16 per 100 1 $75 per 500 De ROSTER’S IIA'I‘CHERY, Zeelund, Micli., Box 300. UNDERMA ...Richardson’s... Rocky Ridge Pure Parks Strain Barred Rock Baby Chicks $ 1 6.00 per 1 00 HANOVER, - - MICHIGAN CHICKS —-PU LLETS High quality stock. Delivery 10022 live and strong guaranteed. Chicks every wee . Ei'lit weeks and 3 mo. I’ullcts . Barred and Vhite Rocks, Reds. White and Silver Laced VVyandott/US. \Vhite and Buff Orpingmns ‘ Black Minorcais. Ancomis. _\Vhite, Iirown and B1 Leghorns. Send for (‘liick or l’ullet (mailer with price list. STATE FARMS ASSOCIATION. Kalamazoo, Mic icon. ’ mber International Bab Chick Association Accwe “Member Michigan State Flinn: Bureau Z MA CAN BE CURED V Free Proof To You All I want is our name and address so I can send you a free trial I zvant you just to try this treatment—that's all—just greyaht?ex’llt‘h t' nly or cut. a 8 my 0 _ ’ve been in the Retail the lndiana State Board of Pharmacy and Association. Nearl everyone in Fort treatment. Over i8 offer public. FIRST cLAss oHIcKs $13.23* surest. | i 25 0 000 $8.50 $12.00 $57.50 $115.00 3.50 8 50 12 00 57 50 WUNDEDMA N 5' CHIC/(5' Engicish s. c. White Lechorns, ............. .. " 4.25 . _ 100, s 0.00. Ref. State Commercial Savmgs Bank. Iit‘, l ‘n liliic‘ } ‘ (hm N BROS., Box 31, Iceland, yEnn‘: OF EXPERIENCE) Our 15 years of work and experience in breeding and hatching Chicks qualifies us as DEAN in the Poultry Industry College. We own and o crate a real Poultry Farm of Free Catalog wil give you an excellent idea of We have.specialized in White Leghorns for many years. Chicks at following prices. 100% Live Delivery Guaranteed 0 0 1°00 Postpaid prices on 25 50 10 50 S. 0. White Leghorns. Extra Quality, ................. ..$4.00 $7.50 $14.00 $67.50 $130.00 Barred Rocks, Reds, Anconas, ................. .. 4.25 8.00 15.00 72.00 140.00 his a. Buff Rocks. White Wyandottos. .......... .. 5.00 9.00 17.00 80.00 155.00 Order direct from this ad in full confidence. N FARM AND HATOHERY, Box 22, Birmingham, Michigan From pure bred flocks on free range, 100% Live Delivery Guaranteed. . . . 115.00 8.00 15.00 72.50 140.00 1 Hon Incubators. 10%| down books your order. ichlgan. # CHICKS, EGGS PULLETS Guaranteed to be from high produc— ing stock. EGGS 5 per 15 F l‘ o m Aristocrat ‘— k:- s t r a i n exhibition i 3/ . xhibition B a r r e d I, . so , / M‘WEGHORNS _cks and Fair- gfiwsmomsi View Reds. ‘ ANCONAS CHICKS $15 per 100. Special Star Mating Barron White .Leg'horns and Mottled Anconas. Selected Utility Rocks and S. C. eds. $13 per loo—Selected Grade A Barron White Leghorns and Mot— tled Anconue. Catalog free. FAIRVIEW POULTRY FARM Box 204 Iceland, Michigan. . .-,. Good Chicks FREE CATALOG In Business For 22 Years White and Bull: Leghorns and Hatching Eggs Barred Rocks, R. I. Reds MEADOWBROOK FARM HENRY DE FREE SONS R. R. 1, HOL LAND, MICH. Wayne knows me and him-Five Thousand Men, c H l c K 8. ACCREDITED BY STATE. LEG- liorns, Anconas $13.00; Books andReds $15.00' Wht. Wyandottes, B, Orpingtoiis, Minorcas $16.00 per 10 . 100 % live delivery guaranteed. Cir- cular on request. Joseph Amster. Paw Paw. Mlch. J. C. HUTZELL onuocisr rug Business for 20 years. I served four tyears as a member of five years as PreSident o the Retail Druggists’ knows about my successful Women and Children outside of Fort We e have, according to their, own statements. been cured by this treatment Since! madéth cu have Eczema. [to ment has cured the worst cases ever saw-z Salt Rheum, Tettor—never mind how bad—my treat. Ive me a chance to prove my claim. Send me our name and address on the 'cou _ n below and get the trial treatment I want The wonders accomplish OUT AND MAIL TODAY in your own case will be proof. ‘ I c. IIII'I’ZELL, ' No. 4960 West Main St, Fort Wayne, Ind. ., .. 1 .g‘y Please send without o‘roblization to me your. Free Proof Treatment EGG PRODUCTION bums We have eighty White Leghorns, last year pullets. We shut them up Noyember 6th and began feeding for egg production; in a couple of weeks we began to get eggs and the pro- duction increased up to January 25th —on that day we got 66 eggs, next day 60 and then 50 to 55 per day for some time. Then production be— gan to slump so that at this time we are getting around 20 a day. I did not increase the grain ration any from the time-.we shut the hens in and this is the question at issue with me. I have increased the grain ra- tion lately to. see if I could stop the slump. The hens seem to look nice and healthy but they seem to be Shy of flesh. Do you think a. hen can be too fat to produce if she has the right kind of rations? We have had a. gasoline lantern in the hen house in the morning and all night all winter so hens have had about twelve hours OE and the same on. We have cut out the even- ing light for a couple of weeks but still put it on in the morning.——D. 0., Fremont, Mich. T is seldom that a good hen be— comes too fat to lay, providing she has been fed a well balanced laying ration. It is not an unusual thing to find birds that have pro- duced heavily during the early win- ter months, taking a rest the latter part of January, or during a portion of February. It is doubtful if feed- ing would entirely eliminate this period 'of rest, but egg production may be somewhat governed by the feeding method. I would think that it is a dangerous proposition, as far as egg production is concerned, to remove the evening light, after hav— ing used it during the greater part of the laying year. We usually feel that if lights are once. used, that they should be carried through for the full season, or shut off gradually.— C. G. Card, Acting Head of Depart— ment of Poultry Husbandry, Michi- gan Agricultural College. FREEZE COMB AND WADDLES We have taken your paper for some time and think it is fine. Wish to ask you one question, Does the. freezing of the combs and wattles hurt poultry in any way?——-I. C. DeS., Dundee, Michigan. . E are sure that the freezing o W poultry to such an extent that the comb and wattles injures it would interfere with egg produc- tion. Especially. do we feel this is“ true in the freezing of the wattles. The soreness here, hinders the birds from eating mash. Regarding males, I would think that the freezing would lower the vitality and this would indirectly cause a loss in the flock—C. G. Card, Assistant Professor of Poultry Hus- bandry, Michigan Agricultural Col- lege. FEATHER PICKING My chickens have been picking the feathers from each. others heads. Would you please tell me the cause and the cure? I bought some eggs for hatching where the chicks did the same. Is it a. disease and can it be transmitted thru the eggs? Also please tell me what chickens are con- sidered the best for both laying and meat?—-—Mrs. J. E., Orleans, Mich. T is doubtful if feather picking is I a. disease transmitted through the egg. I would rather think it is due to a lack of exercise, and would suggest that the birds be turned out doors where they can receive plenty of sunlight and exercise. The birds that are usually consid- ered the best for general purposes are the Barred Rock, Rhode Island Red, and the White Wyandotte.——G. G. Card, Assistant Professor in Poul- try Husbandry. THIN SHELL EGGS Why do we get so many thin (not soft) shelled eggs?‘ Our hens are fed buckwheat, oats, corn, also dry mash. Have oyster shells always before. them, also gravel to pick at, water and milk to drink, still we get : eggs with shells you can crush with thumb and finger.—A. 8.,“ Rhodes... I , Michigan? . f 3;;S'afhsuggesti FANCY STOCK, at RIGHT PRICES BARRON WHITE LEGHORNS ANcONAs WHITE WYANDOTTES Order from this list. White Leghorns. ‘ » r - (270-300 ancestry) ............ ..$18.50 per 100 Sheppard Ancones (300—egg strain) ................ ..$18.50 per 100 White Wyandottes " . I ' ' (Evergreen strain) .............. "$18.00 per 100 Odds and Ends (Broilers) .................... ........$10.00 per 100 Shipped by parcel post. Reliable sonny Farm and Hatchery R. 1, Box 48, Iceland, Mich. Ba fe arrival I guaranteed. Tancred, Barron, Hollywood Three in one—this tells in a nut— shell the unusual merits of Town Line White Leghorns. We have have blended the three most famous egg types in the world. The result is a. triumphf Our pen at the International eg’ la in - test of 1924 outlaid the pen front: on:' o tlferir renowned ancestral farms by 95 eggs; laid 201 more than the average of two pens from an- other fainous farm and more than 84 of the 100 pens entered. (Figures on request.) Also made best dis la in rodu t' Zeelund show of 1 p c “m Class at Anconas—Barred Rocks—Brown Le her 3 Our Special Star W. L. Matiiigs are” heartled liy Tancred, Hollywood and liarron ‘males of 25 -‘ 9 egg ancestry. Anconus by Shep rd males. Price only 18c each; 17c in 500 lists. Other matings at 14c and 13c each. 5% Discountpn all prepaid orders placed 30 days before shipment. Live delivery guaranteed. TOWN LINE POULTRY FARM R. R. 1. Box 19 Iceland, Mich. W. LEGHORN-BARRED R BLACK MINORCA-ANcoagK ’ Official International Egg contest Records up-to 254 £998. Few can equal our PRICES. No one can beat our QUALITY. ‘ Before ordering your 1025 chicks send for our CATALOG. Our LOW PRICES will astonish you. Over 20 years ex ierience assures ' your satis action. _, Establish; Sent. by PARCEL POST PREPAID. in 1904 100% Live Delivery Guaranteed. PINE BAY POULTRY FARM, Holland. Michigan. BABY CHICKS 10 FRE 1’ were ‘ 20 varietile'rii “giggled Cock 9C and erels‘ from head laying in; of Michigan guaranteed blood Tested. rap-~ nest 200 eggs “D.- Write for free circular before buying elsewhere. BEOKMAN HATOHERY ' - 28 Lyon St. Grand Rapids, Mich. “05 Mill ,MITES Don't let them check your 388 pro- duction and a read disease, when you can rid your ock so surely and eaeil - With the old. reliable LII'I uc KILLER. New, free64- age book by Geo. H. 1.60%“!!! how to stop worm and means! troubles of poultry _ —information worth many dollars. Million copies fequested. Get Lee's Lice Killer and tree book at the 113 drug or seed store in your town, or write to the ‘ 0E0. H. LEE. Dept. 1 09. Omaha. Neb. Well-Pleased _- _- -W~ith fiffiefisgfiznm arm-21%;? ‘ .d,‘-<0-’ “ ‘EHHBAR w-A A _‘II.. ‘ .dflm.» A ATCHERY£~FARM ZEELANb, MICH. OUT IN FRONT AT CONTEST The Royal White Leghorn pen at the International Egg Laying contest of 1925 led the entire field for the first .two weeks. For the succeeding two months they were a close second In the Leghorn division, then on Jan. 30 went ahead and on March 1 still led all the Leghorns. Such birds speak for themselves. We have thousands like them, mated to pure Tuncred cockerels whose dams laid 225 to 299 eggs in a. year. 16% of Our Sales Are To Old Customers ‘ ' ival and 00d condition guar- entbggga Vlllziatemltor cataloggand prices at once. ROVAI. HATCHERY J: FARMS s. P. Wlersme. R. R. 2, Iceland, Mich. High Grade Stock At Prices \You Can Afford ‘to Pay “red for Eggs. not for show feathers. l Every chick from our fnrin is of proveii egg laying strain. GLISH BARRON LEGHOR EN NS ARISTOCRAT BARRED ROCKS ‘ BROWN LEGHORNS ORDER FROM THESE PRICES Grade AA 50 100 500 1000 White Leghoms Pedigreed males $8.50 $16.00 $15.00 $145.00 Barred Rocks Aristocrats ...... .. 9.50 18.00 85.00 165.00 Grade A . hi 0 Le horns .. 1.00 13.00‘ 62.00 120.00 ‘gal'l‘tsd Rgocks. 8.00 16.00 12.00 140.00 Brown ,Leghorns .. 1.00 13.00 62.00 120.00 Broilers—— Heavy ........................ ..12.00 100 > Live Delivery Guaranteed. latalog ' free. Nowqilooking Orders for I’ullets for May 15 Delivery. Greet Northern Poultry Farm Zeelnnd. Michigan. R. R. 4. Box 57 i ‘ . u ’ I I r .i ii I -// 250m zap Egg Strain pedigreed males head our famous flocks of Tnncrod American nnd'l'om Barron Eng- Illh White Loghorns, ' Sheppard's Famous Mottled Anconns Park's Brod- \ Io-Lay Rocks. Our birds won Ilnl prize. In 9 production class at Hollan nd West Mich- igan State Fairs. All flocks bred through generations for high egg produollon. Prom t. 100‘ live delivery. prop-id. anywhere east 0? the Rockies. Price: low. Order eizrilty to 1: chicks when you want them. Our beau ully lustrated. instructive Free chick booklet will give you much uable information. Write for your copy now. Silver Word Betcha-v.30): 30,2uland.Mich. I Malta INCUBATOR 140-!“ Alliance . . CAPACITY Has all the features that insure big hatches— double walls. copper tank, complete nursery. rfect heat control through automatic trip ' urner. “Tycos” thermometer held so chicks can’t break it when hatching. Detroit Brood- ou. too. Write for low combi- nation price today! Detroit-Alliance Incubator Co DOM-10 . FREIGHT Alliance. Ohio PREPAID CHICK reabsns end" soon MILK FOUNTAINS The “SELF-SERVE” Chick feeder holds 12 pts; of mash. Can’t clog. Chicks cannot . Mats; ie used out of doors. rice £1.50 plus postage. 8 our Iilk Fountain holds one gal- Ask ' ' 3 KB. A R or order direc . Catalog free. IRA A ’3‘}: REYE, Eckford, Mich. HIGANHATCHERY rm Heavy-Eu sun. ‘ ' i he horns heeded by moles - =33 limilcckm; lest you". M.A.O. i'lnboriuliono 2 Es Content «winners. “AW Ien’d' ' ' Animus-.1100“. .... Chicks , . hat the ground lime stone makes a higher percentage of available lime then- 'can be“'obtained by the outing of oyster shell. I would judge that after “yOur hens are turned" out on free range in the spring, that your shell texture will improve. Plenty of green food may improve the shell texture to some extent at this time.—~ C. G. Card, Acting Head of Depart— ment of Poultry Husbandry, Michi— gan Agricultural College. OLD HENS NOT SURE WINTER LAYERS GE is no indication of worth in the feathered kingdom accord— ing to poultry specialists. 01d hens do not make depend— able winter producers, according to many specialists. The good ones are usually occupied with their molt about the time high prices are ruling. These hens may be very desirable for breeding good chicks for the next season but the early hatched pullets are the ones that shell out the wint- er eggs. By early hatched birds they mean those that reach laying age before severe cold weather sets in. The lighter breed, like the Leg- horns, will begin to lay in five to six months but a month or two must be added to this for the American breeds like the Rocks and Reds. Asiatics require from nine to ten months, and hence are not profitable as a rule. TUBERCULOSIS CAUSES BIG LOSS IN POULTRY TUBERCULOSIS in poultry is caus— ed by a germ which has many of the characters of the germs that cause the disease in the human family and in other animals. These germs live for many months in the dark, damp places about poultry yards and in the poultry house but can be killed by thorough cleaning and disinfecting. ‘ Tuberculosis in poultry causes an unthrifty condition, especially in the older birds. They get poor and thin, lose flesh rapidly in most cases, and many of them get lame. External examination of the dead birds will show that very little meat is present on the breast bone. A post-mortem examination shows the liver is usu- ally covered with white spots. If these spots are cut into with a knife they are usually found to be gritty. Similar white specks will be found on the spleen. vanced, small white specks and some- times abcesses will be found among the intestines. Lossés from tuber- culosis in chickens is usually greater in winter than in summer. “The only known means of con— trol is to eradicate the infected birds 'because they distribute the disease to the other birds”, Dr. G. S. VVcavei‘ of the -South Dakota State College de- clares. “If the flock is standard bred it may pay to have them tested with the tuberculin test but the ordinary farm fiock had better be disposed of in some other manner. Before hatch- ing time next spring, an infected flock should be gotten rid of by kil- ling and burning all sick birds and marketing those fit for killing pur— poses. Clean and disinfect the hen house and poultry yards and then start a new flock by the use of an in- cubator. The disease is not inher— ited and any chicks hatched by the use of an incubator are free from this disease until they are exposed in some other manner.” Chickens rickets. need sunlight to Drthllt t it! 1: III Planning the home grounds now should pi‘ocede planting in the spring. 1I‘ 1| 0| 1| Communities that want to’ get the most out of an extension system through the county farm bureaus should have a dotin— ite program to plan. _.__~_____ , GET THIS BOOK FOR YOUR. LIBRARY ‘ —-I'r's FREE! I < PRACTICAL handbook that contains much of use to any farmer is ‘ “Alpha Cement—How To Use It.” Issued by the Alpha, Portland Cement Company. It Vshould be in the library ofpevery farmer. The book is free to anyone who wishes a copy and can be secured from‘ the Alpha dealer in your own town or you can write to the com} St., Chicago. Ill. The company is =3. steady advertiser in THE BUSINESS, ' FARMER (you. will find. their advertise- ", ment [in this issue) and in writing them .We would appreciate it it you would .) FaunnrdAdv. - a . : he], ; If” _, '“i 7.: “stone to your mash deed . It seems If the case is well ad-‘ many at Easton, Pa... or 140 S. Dearborn‘ ; mention that you saw’ theirta'd'ln ' THE». E 3378113111 . ,. You DEFEND on 3 THE TAG 2 BEFORE you buy your seed this spring, write to the State Depart- ment of Agriculture or State Experiment Station for a copy of your state seed law. Study it carefully. Insist that every lot of "seed you buy is accurately labeled in accordance with the law and sold from the original package. don’t think the label tells the whole story. Two .brands of seed labeled alike and sown under the same conditions some— times produce very different crops. Two crops that look alike in the field often measure up different in the barn. The information the tag can’t give is sometimes more important than the information it does give. FREE—This book tells why “7 Lessons in Judging Seed” is a little book written by seed experts. It is worth dollars and cents to every farmer. Not a. catalog but a practical treatiseon seed buying, full of valuable information. Sent free on request. Write for your copy today. THE ALBERT DICKINSON CO. Chicago. Ill. Minneapolis, Minn. BOSTON BINGIIAMTON BUFFALO PITTSBURGH NEW’ YORK Qgrdenflrai' W Lsanoiiu BABY c‘iiicirs. Tancred Males from 298-304 egg ancestry; hens H n _ from 260~289V ancestry. Every chick o y strong and liciilthy, broods making uniform flocks that wood ,uvcragc hiin Ill egg production. 100% safe arrival B Li’uarnutced. t7In short, we sell you prolilv—how much n to you wnn . arro Raul for fun our catalog lllfhl'lllilllnlp fir Brown Leghorns . l n a 1» 19YEARS WH’X-rcfimy .Céggg Barredhkpcks ZEELAND. MICH.. BOX B p 1‘ KEYSTONE HATCHERY loading lwst strains I‘ll-l'ui'll'lll'w‘ IYH‘lIllllllvil lie-low. Quality 2111 zll()lli;’ l'lu‘ line is .i'Hll' Biotin. BLOOD TESTED S'l‘Ol‘K. Arrival (liinrnntced—Postnaid prlces on 100 500 1 Foreman Strain Barred Rocks 0.00 $95.00 $185 00 Selected 'Barred Rocks ..................... .. 17.00 80.00 15 Int. Laying Contest S. C. R. I. Reds 20.00 95.00 186 00 Extra Selected S. and R. c. R. I. Reds 18.00 85.00 16 White Rocks and Wyandottes ........................ .. 18.00 85.00 Tancred White Leghorns, Select S. 6" R. C. Reds 16.00 75.00 145.00 , Utility and Barron White Leghornsst ........... .. . 0 _13.00 60.00 115.00 Mixed. all heanes, $13 per 100 straight. Mixed, all Vill‘li’lll'rl, 100, $12 straight. If it is real EGG LAYING QUALITY that you want in your Chicks, Keys-tone l,‘_lii(‘l{.~\ \will fill the bill for you. They are \Viniiers in Laying ('ontcsts in Michigan Missouri, (‘mmeclir-ut, (lmmdu, _ctc. (let our Literature giving these winnings before buying l‘hicks clscwhm'c or ni'lli-i' llll‘f‘fll’ from this ad. KEYSTONE HATCHERV, Dept. 51, Lansmg, Michigan PIONEER BABY CHICKS have stood the test and assure you of STRENGTH. VIGOR, and RAPID DEVELOPMENT. liy ialll' rigid system (if.('llll_lllg and pedigreed matings our flocks are being impfcved ouch your. Once a customer @Iways a customer. . “Lust year I was more than satisfied Willi )nlli' stock, lilll‘..thls your 1 um Just sui‘pi'iseil.”—-—J. 'l‘., Sicvcnsi‘ille. Michigan. A ,g . » Improved English White Leghorns TYRONE POULTRY FARM Let; us scll you your 19:15 Chicks Ifnfin pure bred, select \Vhite and Brown Leghorns. ‘ Write for full particulars on pedigree. etc: PIONEER POULTRY FARM R. R. 10 Box C. Holland. Michigan 1: , VVl’t nd Buff Rocks, R. . eds, Ai'H'OllilS, Blnck and “Hum l‘Illliil'CilS, White. lillfrfdflolddilieaild Silvery “'ynmlottcs, “him and Buff ()rpingtons, Black Spnnish, Light Brahmas, etc. Of leading strains such as Barron, l'nrks. etc. 3000 CHICKS GIVEN AWAY TO OUR CUSTOMERS DURING 1925. We guarantee 100% Live Delivery. Postpaid. Reference: Commercial .Stute Savings Bank. Before ordering Chicks elsewhere. got our special circular containing our low prices and particulars about the 3000 PRIZE CHICKS. TYRONE POULTRY FARM, Dept. 21, Fenton, Michigan. L _ o - 0 - K ! 292cm PRICES Can ship‘mhlcks of hi h grade quality at once! I . (HICKS Barred Rodks. R. 1. Re 8. White Roclks. 150 each. Foralimited time on] . Priqu wyundottea, lgufl’ Orpingtons. Bu {Ocki-i, 1655c 100; Selected Quality ‘sncred-Eng‘ each. White, Brown Leghonls, 12(3- ADQOMS: r. lish WhiteLeghornchicka(Pedi eed 13 we. Mixed heaVies, 12c. Mixed light weights, r__-_x Male ultinRS). 315, 3m“ 33.... 9179;. May chix $1 per 100 less. Order rom Gunny CHICKS] .C.Reds,Utilit Matin . 316. this adv. If less than 100 .wanted. add 350 ~~—~— ..__._ Barred Rocks end S. .Bedl peel-l extra. I-Iatching’eggs. Free Circular tells about Hahnn.fl8.,8u30r€inctqm.$l7.EngliIhWh. born. 15 first class varieties. Utility HItlngs.818. 001 live deliver poetpaid “lo. Lawrence Hatchery, R. 7, Grand Rapids, Mlohlggn‘ free. Indln'l Peuiwyhrm. Dex Westphllqluu. UYYOUR BABY CHICKS FROM, M. B. F. ADVERTISERS. Speculators Making Prices in Wheat Market Fair Demand for Cattle—Hogs Prices Expected to Go Higher By W. W. W Market Editor. T cannot be denied truthfully that the times are improving, and the ‘ farmers are sharing in the return of prosperity. Of course, it is not an Sunshine, and the year 1924 saw a short corn crop which gave many farmers a set—back and delayed re- turn to normal conditions. But conditions this year promise well, and so far as corn production is con- cerned, there are many reports com- ing from various farming districts that farmers are exercising more dili- gence than in former years to thor- oughly test their seed corn and dem- enstrate its germinating value. In these times of high wages demanded by helpers, farmers are compelled to devise every way possible to lower the cost of production and to increase the profits to the acre, and this ap- plies to wheat and other grains as Well as corn. A short. time ago John W. Foster, the president of the First National Bank of Guthrie Center, Iowa, said in a business letter farm- ing conditions are better than at any time in 1919 or since. The letter was written prior to the recent enor- mous breaks in grain prices, but most rational people look for a recovery in the near future of much of the de- cline. Mr. Foster noted the fact that farmers have received a sub— stantial recovery in the prices for products they have to sell, while there has been a downward trend in non—agricultural commodities which the farmcr has to buy. He points out that according to recent statis— tics, “the ratio of the farm dollar to the industrial dollar is about bal- anced. Awhile ago, it took two days’ labor on the farm to equal one in the industrial enterpriSes, but by 1923 the farmer‘s income from his crop as compaer to pre-war pur- chasing power had advanced and was $1.40. while the things he needed to buy from the industrial world was $1.75. The year 1924 appeared to have worked a. total readjustment. Farm prices for crops have risen to $1.58, while industrial prices have receded to $1.55. This balancing of income and out—go is vitally import— ant to the farmers and to those who do business with them, and supplies one of the necessary conditions for prosperity. Good crops supply an- other; balancing the ratio price of live stock and grain is a third. All these things are on the way.’ Money for Cattle-men A short time ago R. A. Cooper, commissioner of the Federal Farm Loan Board, returned to Washington from a long tour made at the request of President Coolidge, and stated that it was his conviction that there are ample funds immediately available for live stock and other farm indus— tries for all purposes except for the repopulation of breeding stock on the ranges. Even as to the depleted range herds Mr. Cooper is hopeful and expresses the belief that. this has long passed its crisis. He, with another member of the commission, visited all the states west of the Mis- sissippi River and helped organize six new cattle loan companies in dis- tricts where the range breeding herds are most diminished. He said even conservative banks are now looking upon cattle loans as safe proposi- tions, although they cannot function as well in financing breeding herds as other forms of credit institutions. The cattle loan companies, however, can be of inestimable service in this connection, and it was to this end efforts of the government officials were directed. Mr. Cooper said they tried everywhere to encourage the organization of the local agencies through which the farmers may take advantage of discounting facilities or direct loans available with. govern- ment funds. “The cattle industry, which has recovered slowest 01 all agricultural pursuits.” said Mr. Cooper, “unquestionably has struck bottom, and it is already on the way to betterment." . All regard to the legitimate value). 01: wheat he been disregarded tor " several weeks, and the law of supply and demand has been set aside, the speculators on the Chicago Board of ' Tr'zde being the actual rulers in mak- ing prices. It is not a pleasant thing to say, and ultimately the con— sumers may be expected to take or leave the wheat, buying it if it is not too dear as compared with other food, but of late wheat has been treated like‘ a football, with fluctua- tions that startled honest traders. At first the bulls were in complete control, and everybody was buying, May wheat soaring to around $2.06 a bushel. Wise oWners lost no time in placing their wheat on the mar- ket, while those who believed it would go to $2.50 later held on and saw it sell away lower, the fall in a single week reaching 40 cents. The future is uncertain, but it may be ex- pected to go up again within reason- able limits. Meanwhile, it is worth while to take a view of the actual surroundings and to note the improv— ed export demand for breadstufl’s on the big breaks in prices. Then there is the recent official report made by the Department of Agriculture on the wheat left in this country. It ap- pears that on the first day of March the total wheat supply in all positions amounted to 259,000,000 bushels, comparing with 305,000,000 bushels a year ago, and 310,000,000 bushels two years ago, while in 1922 there were 253,000,000 bushels. There is a small increase in the winter wheat acreage of fifteen countries, the grain being about 4.3 per cent over last year, while the rye acreage of twelve countries is 27,323,000 acres, an in— crease of 5.2 per cent over last year. Rye has closely followed the price fluctuations of wheat, and a short time ago rye for May delivery was selling 60 cents a bushel under the highest prices of the season. It seems evident that there must be a marked improvement in the exports or rye from the United States to ab- sorb the supply now in sight. Oats alone of cereals, have been selling a little lower than a year ago, due to the rapid marketing of. the crop. the visible oats supply far exceeding that of a year ago. Late sales for May delivery were made on the Chi- cago Board of Trade of wheat at $1.48, comparing with $1.05 a year ago; corn at $1.18, comparing with 78 cents a year ago; oats at 45 cents, comparing with 47 cents a year ago; ‘ing with 11,397,000 a year and rye at $1.20, comparing with 67 Cents a year, ago. May barley sells in Minneapolis at 82 cents comparing with 67 cents a year ago: / Fair Demand for Cattle While the Chicago cattle receipts recently could hardly be called par~ ticularly large, there were at times rather more than the local and east— ern packers needed, and seme'sha'rp breaks in prices- took place. A late rally in prices occurred, but prices were still largely 50 to 75 cents low- er than a Week earlier, the bulk of the beef steers oflered during the week finding buyers at $9" to $11. The commoner light weight beef steers sold at $8 to $9 with low grade little steers going for $5.75 to $7.75 and the best lots of yearlings at $11 to $11.80 and no good steers offered below $9.75. There were not a great many choice long fed steers and the best heavy steers offered brought $11 to $11.40. Looking back a year, it is recalled that common to prime steers were selling for $6.85 to $12, while nine years ago prices, stoOd at $7.75 to $10. -Butcher cows and heifers are aétive sellers at $4.25 to $10.75, with canner and cutter cows selling at $2.50 to $4.25, bulls at $3.50 to $6 and calves at $5 to $12 the calf market having declined from $2 to $3 per hundred pounds. The purchases of stockers and feeders were only moderate, at $6 to $8.75, sales being largely at $7 to $8.25 for desirable offerings. The better class of springer cows sold at $75 to $90. per head, medium grade dairy cows going for $50 to $65. v Hogs Good Property No matter how prices maybe go- ing temporarily, hogs are good in- veStments, and their fortunate own- ers need not hesitate about finishing them off in good marketable condi- tion. Because of the great falling off in the receipts in all markets, they are selling at a great advance over the early’year prices, and they will probably advance much higher later on. Of ecurse, the market has reactions at times, but advances fol— low; and within a short time new high levels for the season were reach— ed, the top standing at $14.60. A year ago hogs sold at $6.50 to $7.50. For the year to late date the com- bined receipts in twenty markets amount to 10,079,000 hogs, compar- ago. Late sales were made of hogs on the Chicago market at a range of $12.90 to $14.15. 7 Some Figuring Live Stocks Markets does the fol- lowing figuring: “For those who are fond of figuring the recent live stock THE BUSINESS FARMER’S MARKET SUMMARY and Comparison with Markets Two Weeks ago and. on; Year ago Detroit chicago Detroit Detroit March 28 March 23 March 9 1 yr. ago WHEAT— J ' v No. 2 Red $1.77 $1.81 $1.06 ' No. 2 White 1,76 ’ 1.81 1.07 No. 2 Mixed 1,76 1.81 1.06 CORN— . ’ No. 3 Yellow 1.18 $1.13 1.26 .81 No. 4 Yellow 1.13 1.21 .77 OAT»— No. 2 White .53 . .47 €91 .58 .49 35 No. 3 White .52 .45@ .46 94 .57 .47};I RYE- ‘ Cash No. 2 1.16 1.45 .66 BEANS— C. H. P. th. 5.65@5.75 6.25 » 6.00@6.10 4.70@4.75 POTATOES—— Per th. 1.07 l.00@1.05 1.I4@1.17 ‘11'.50@1.66 nAir— " t . No. 1 Tim. 16 16.50 19621 * 16®17 No. 2 Tim. I4 15 15@ 17 ‘ 14 15 21.00 '22 No. 1 Glover 13@14 F 14@ 15 , 14 15 v20.60@21 1mm 15.50@16 , 17@19 15. 10 V i @5on ' r 1 _ r—iw monthly, March 23.—-Graln unchanged. Butter nudism in Bean market Woes «any. ' 2;. estimate of the Bureau of mm lies: on 1m ‘ ting » bureau: magnate: twelve million lew— . er hogs and two million fewer beet ; cattle on hand January 11, as com- .. pared with the same time a: year ago.» This figures about Euro billion four hundred million pounds. at pork lens and two billion pounds of has! lam ‘lv. L ‘i Taking population into consideration v this resultsivn about 15 pounds per. person less pork will be served than a year ago and a decrease per capita of fully 8 pounds less." WHEAT The bulls continue to be very pro- minent in the wheat market although prices fail to show advances. The fore part of last week prices at D'o-' troit dropped 11 cents but directly after they advanced 8 cents, broke again but recovered leaving the price at the close of the week slightly “Ii-'- der two weeks ago. COR-N Corn: followed the trend of wheat. Trading has been light and receipts are expected to be small for the near future. ‘ ' ‘ OATS I, Demand is fair in the oat market and a. steady tone prevails. Com- mission concerns are taking a large share of the offerings. Receipts con~ tinue small. RYE Rye has taken a serious slump during the past fortnight and prices are much lower than they were at the beginning of that period. The market is easy. BEANS ~ In spite of the many reasonsad- vanced that beans should be bring- ing more money the price continues to work lower. The Detroit market gained 5 cents on Saturday of last week and the day closed With the market Steady. ’ , POTATOES There is a liberal supply of pota- toes on the market and the demand for old stock is slow. The market is easy at lower prices. HAY The hay market IS not active, the main part of the receipts being ofl' grades and they are not wanted. The market is easy in tone with priced somewhat lower. SEEDS \ *DETROIT, March. 21—Clover, primb $17.00; timothy, $2290; alslke, $13.75. CHICAGO, March 21—Timothy, seed. $5.25@6.50; clover seed, $21@31. LIVESTOCK MARKETS EAST BUFFALO—C a t t l a—Receipu. 175; slow and dull. Calves—Receipts; 250; active; choice, $13.50@1'4; fair to good, $12@13; culls, “@1150; heaw, $6@8;grassers. $36115. ! Hogs—Receipts, 3,500; slow; generally 25c lower; heavy and mixed, $14.15;, yorkers, $147014.2'5; light yorkers, $130 13.75; pigs, 8123506918; roughs, $12.50; stags, $6@8. Sheep and Lambs—Receipts, 1,000; slow; lambs, $10@15.50; yearlings, $100 14; wethers, $11@ll.50; eves: $3©10; mixed sheep, $10@10.50. CHICAGO.-Fresh supply of hogs not large but demand lacked action for heavy kinds. Sellers found a fair market for choice light animals, and some of these were up a (lime from the low time of Fri— day of last week. Prime heavy butchers sold at $14@14.10. against $13.85 for top hogs at the close of last week. At the best time, last week top lots went to $14.80, but stopped at $14.15 Saturday. Bulk of good packing hogs sold at 3183 13.40 and sellers had about 5,000 unsold hogs at the close. Present price Show; up somewhat higher than a week ago. Cattle trade was of little account. The run was estimator at only 500 head. Small lots were picked up at unchanged values. The market for steers dropped 50@?5c in many .cases, early last Week. but there was a betterdemand again later and were 15035:: of! from those hated a wool: ago. Cows and bolt are also MWWdEIflO-i utter alqu field. That u!!! him “it. ‘mcanes were,’ L '1" ' . , m. bear commercial Manson's. making amasse- ascents-to care far she beekeepers. Since this is the home of many OIin’s bests beekeepors, is sure to be well nat- -‘ Tmowing the meeting it is V 3W 4.9 conduct a tour through the M8415!” areas in northern Michigan to examine theresults ’by gm Area Clean-up Campaign of the epartment of Agriculture. Please keep the dates in mind and look for further announcements regarding the program. . 2 COUNTY HOLSTEIN BREFJDERS MEET . ‘ HE annual meeting of the Kala- mazo County Holstein Breeders ' .Association was held March 11 at Oshtemo. The main interest of the gathering centered around a dis- cussion of how to improve the usual strong showing of Holsteins at the County Fair. Among the points raised was that the Fair Board be requested to add a division for cows of each breed with Cow Testing As- sociation records—breeds to be judg- ed separately, but purebreds and' grades of each breed to compete in the same class. To be. eligible for entry any animal must have com- Week of March 29 MPERATURES will be warm for this time of year in Michi— gan at beginning of this week. The barometer will be low, winds strong and scattered showers and rains with spring thunder storms are all likely probabilities for this per- iod. By the middle of the week stormi- ness is expected to have passed this state and as a result there will be a change to colder weather with clear— ing skies. Toward the end of the week tem- peratures will again rise to much higher levels followed by increasing cloudiness, showers, thunder storms and wind. This storminess will be in full force in Michigan at end of this and beginning of next week. Week of April 5 Moderate spring temperatures will be the rule at beginning of this week in Michigan but before the middle 3 of the week arrives the bottom will have dropped out sending the mer- cury in the thermometer much lower. Precipitation during the storm area of the first part of this week is not expected to be throughout the state although there may be some heavy falls in local cen- ters together with early electrical storms and strong winds. The average temperature for the next six to eight days following this storm center will range generally be- low normal in this state. April Weather April weather in Michigan is not expected to be about seasonal in tem- perature or possibly a little below normal, yet not sufliciently adverse for spring growing crops usually planted or growing at this time. This means that fruit trees generally should be safe from a too early or rapid growth and will not be in so precarious a position in regard to the extremes of weather 'during next month. - The average precipitation for the most of April is expected to be below 'the seasonal normal in Michigan. This will mean there will be little or no serious delay in farm activity in preparing ground for planting oats, barley and other spring crops. FREE BOOK ABOUT CANCER Thelndianapolis Cancer Hospital, . hospth “a booklet which gives interesting I: t for pain, bleeding, I liable 8111443411.st ‘Write 'for 'Ina‘riold to '40 9.191! £1.63. M to picnic on the State very heavy ~ ~ 3. wind and darned _,X,,th‘ , fiancee-#289 \ U virus a fullaged ' T1,.oprizgsg 9 he, offered in '4!» discussion. The broadens . , to hold a tour next July or August, accepting the invitation‘ of Mr. Inger Hospital Duos in the Association were re- duced to 51.00 per year. R. B. Olds, county agent, and Phil .Sexton,‘ Secretary of the Kalamazoo County Farm Bureau. were present and helped in discussions. J. G. Hays, Secretary of the Michigan Hol- stein-Freisian Association made a short talk pointing out a few things that the breeders could do to help the Holstein breed in their county. A reel showing “1924 Champions at the National Dairy Show" was flashed on the screen. - Meeting adjourned to meet late this month with Mr. Yager to elect officers, the present President W. E. Balch and present Secretary Roy Buckham holding over. HOW BILL RUCKEI) THE, TIGER (Continued from Page 6) hex-{just plain wild. She couldn’t follow direcflons and the socks would not roll out like the picture book said. The wimmin. particularly Maria, claimed Bedeliah would lose her mind and after a meeting of the Mis— sionary Society they decided to ask her to get rid of the machine. So they went to see her and succeeded in convincing‘ her to send it back. I boxed up that contrivance and Bedeliah had Jim Harper write a letter to the company. In a Week Jim got a letter .and the company said they sold that ma— chine outright and they wasn't tak- ing back second hand property. So Jim wrote another lettersaying the lady was hard up and a note had to be paid. “Let her make socks.” wrote back the company, “and she can pay for the machine like our other successful workers have." Well, that darned near caused a riot in our town. Everyone was try- ing to figure out a way to get Bedel— iah’s money for her. Even Judge Stanton investigated and finally he asked a farm paper what they could do for the lady. At any rate, be- fore the matter was settled, the pa- per got Bedeliah two thirds of her money back and we was happy. That paper was a friend of ours from then on. We thought we had Be- deliah cured. Nothing doing though. What does she do but fall into one of these mail order matrimony sharks’ hands. They sent her a long list of things to fill out (Maria got this information) about her accom- plishments and what kind of a well to do. handsome man she wanted. Bedeliah fixed up the record blank and sent it in with a~ch.eck, I don’t recall how much. But instead of getting married she pulled the prize bonehead of her career. You see the old fool put on that list of ac- complishments that she was an opera singer. And to make good she signed up for a correspondence course in grand opera singing, thirty lessons and a career, “pay as you learn"; Well, Miss Stokes only took a few lessons. It was like some one was dying from being carved to pieces slowly, the way she howled. The neighbors were just about ready to have a revolution and then Hallowe'en came and all the boys in town went up about ten thirty and begins to mock Bedeliah. It was enough. She told Maria and the Smith woman afterwards, it just crushed her to think what her towns— men thought of her. I said that was all of that, but it wasn’t all. The notes for paying for the course began to roll in and it took the ef- forts of Charley Stanton, Jim Harper and me to clean up that mess. So Bedeliah has promised me that she won't sign up any more courses with— out consulting Maria about it first and“ Maria has promised .me that she won’t advise her-till I get a chance to look the matter over. , m m , is more work than stacking straw in near as mean a . I won-t m for TB ‘Mdicaflon also some up for}. decided i.- BUSINESS. FARMEBS’ EXCHANGE; " lilo advertisement less than ten words. of figures, , n s. Form close Monday noon proceeding date of issue. 3 A Address: MICHIGAN nusmnss FARMEB. Mt, Clemens. Michigan. on memo ADVERTISING SAT! m wow—0n. issue So. Two Issues 15c, Four Issues 25c. . initial or abbreviation count as one word. . ,~Cash in advance from all advertisers in this department. no exceptions and no .‘ HELP WANTED ADDITIONAL SALESMEN WANTED EOR UN- occupied territories. Our proposition is an un- usual opportunity for high grade men, offering eater earni power and steady work. Must are cur. Fall information on Mamie. Minne- a olis Woolen Mills 00.. Inc., 61 First Ave.. lifinneapolis, Minn. - TED: A BLACKSMITH FOR STOCK W‘g‘grm. Must be expert horse sheer and capable and experienced in every respect. Must also willing ,to work part time at general farm work. Give references, salary expected, experience, and full particulars in firs letter. Address Box 239. .Care of Business Farmer. ANTED llOUSEKEEPER ON ‘ FARM. WAdults. Electrical appliances. E. E. Stark, Manchester, Michigan. \‘(l AV FOR FARM WORK. .MODERN Y9§lclxine¥y.fStltte wages expected. Sclufier Acres. Remus. Michigan. FARM LANDS TOR SALE—1,000 ACRE RANCH. SACRI- flee. ELDOBADO BLACKBERRY PLANTS—THE only real_cmnmercul variety. A Money Malia. I05) poo )sid 3.00. Wholesale prices on quan— tities. ’. L. eeler, Elberta. Michigan. BUY N l' RSERY STOCK DIRECT FROM grower. S'w agent's cmnmisslom Send for catalog. Kankakec Nursery. Kankakee. Illinois. POULTRY WHITE WYANDOTTES’BOOKINC ADVANCE egg orders from 8 quality matings and utility flock. Stock all sold. Fred Berlin. Allen. Mich. VVI’I'I‘E 'WYANDOTTE (‘OI‘KEREI.S, $3.00 AND ’ encli. Egus $1.50 for 15. Seven dol- 100. F‘. \V. Roberts, Salem, Michigan. HATCH'ING ECGS. R. C. R. I. REDS. BRED for color. six” and egg production. $1.25 per 15 postpqxd. Mrs. Albert Iiarwood, R4, Char- levolx, Michigan. CHICKS GUARANTEED:—~\VIIY some? 100 '4.» safe urrivnl. Toluca. Ill. JERSEY BLACK GIANTS EGGS. v d lots for NO'I' TRY ’l‘nlunu Hatchery, o PRIZE W'IN- ' r N) , ,— 1 . Attention sheep. bug or czlttlc rniscrs or M.“””;( SEEK,“ lull” IMF l-v him (,mssman, attention some one who camflzleljl'ordl Spill'lsllilall'ls "m" - “1‘”!- . . ;\ mutinv an sun 0 go. aim-x ‘ V V V ‘ ‘ v W ‘ ‘ lgggelde‘id)rlglotfiteulix1 County, Miclziigan, between Mill, SALI'rrfilluliMul llI.A(.I{r (.IANT PULLIuTS Grand Rapids and Saginaw. Private lakcs. good $3.00 ‘E‘ll'll. Roostcrs $0.00 each. B85819 buildings. soil, railroad facilities and roads. Write Jul-obs. Inmlcn, Michigan, R4. for particulars. Might consider some trade. Rest ‘ ‘ Y F buy I ever inspected. I’ricc right-“terms easy. LARth TYI‘EV'I‘OLIDIISE (IEESE EGGS 500 This is no wild cutovcr laud proposition. Arthur 1-:*(-ll.. Ruff Rm-k eggs $2.00 per )5, Baldwin C. Lueder, 40 N. Deurborn St... Chicago, Illmms. & Nowlm, R. E. I), angsburg, Michlgan. ' FOR SALE—800 ACRES WILD LAND, $8.00 RUFF ORI‘INGTON COCKICRELS. (‘OOK AND an acre. Will break in two tracts. Easily (‘unwuy's strum. A. .l. lrcwbaker, Elsie, Mich, cleared. Small imu'ovements. No cash payment who must harvest mmuully, acres of (lnmms certified Only down to right par y after secohd your, [‘5 _ alfalfa seed for land payment and interest. a sheep man need apply. For alfalfa and swyet clover chaff fits in nicely With a band of brooding Will sell on ll) venrly cash payments also E 'es. . “ John G. Krauth, Millcrsburg, Mich. if preferred. ATTENTION FARMERS IF YOU ARE LOCATED within 60 miles from the city of Detroit and you want to trade your farm for Detrmt. property and want to have a good and honest business also quick results, list your forms uxtli us, with a "c- sponsiblc company. we fipt‘cmllzu m sellmg farms with all stock and machinery. Write to the Home Land & Building Company. 8580 .Ios. (.‘umpuu, Detroit. Michigan. FOR SALE IMIfimVM) LEVEL g‘LAY LOAM 80 farm. Fair buildings. electricity, consoli- dated School, mile north Williumsburg, l3 Tm— verse City. Sarah 'I'imlall, 2277 Irwin, Muskegon,' Michigan. FOR SALE—MICHIGAN FARMS IN JACKSON. ll‘IAMMO’I‘lI “'lll'l‘l‘l HOLLAND TURKEY EGGS 40 cents each. Jersey liar (Hunt eggs, 1:! cents cm-lx. E. II. llawley, Itlmcu. Michigan, R3. TURKEY EH‘DS FRO“ ()llR VARIOUS M. Bronze B. lied, Ncrrnguuscit and Vl'. Holland flocks. \Vrite Walter Bros. I’mvlmtan Point, Ohio. FOR SALFr—MAMMO'I‘II BRONZE ’I‘llRKEYS. Write for prices. Mrs, H, l). Horton, ll‘ilion. Michigan. SWINE O. (3. pigs. culurs. ANI) CHESTER WHITE PEDIGREED $16 per pair no kin. rite for cir- Ruy Iluubush, Srinta, Illinois. PET STOCK \Vashtcnaw, Infilizlln and 1.1vmgston (l‘ountics A 191x14} YOUNG “OUND WELL STARTED 0N fully equ pod. 'ellam‘e Perm Agency, 24 Sun FOX. B. G. Hardy, Boon, Michigan. 131118.. Jac on, Michigan. FOR SALE—I20 ACRE FARM. (IOOI) SOIL, RA‘V FURS timber, lighting system. Will sell machinery with farm. Four miles from Richmond, Mich. Mrs. Alvnh Si‘Ollli‘ll. Richmond, Michigan. SPRING AND \VINTER MITSKRAT FURS wanted at full market valpc; fair treatment; FOR SALE IMPROVED FARMS. RANCIIES. prompt returns; shipments held separate on re- \l ' ta lust fre .. D. Thompson _& quest. We pay transportation charges, Writ. s . e. Company, 3621 S. State Street, Chicago, Illmms. FARMS NEAR DETROIT. MILAND, AND PYSI- hinti. Write for list, stating kind wanted. E. W. Box-dine, Route 5, Miland, Michigan. LARGE ANI) SMALL_FABM. EASY TERMS. C. Wilmer. Crews. Virginia. SEED CHOICE SEED CORN—«1000 BU. 100—DAY ‘1 1 Yellow Dent: 500 bu. Lancaster Conn use Crap: 300 bu. Early White (lap, neatly ll 1928 rep, all_hi¢h germination. Write for sum lo and circular. Order early to we now. hull Farm. Box 20. Tuhytown, finch 00.. Pa. I? D “as... Fan-grove. Michigan 9%? FOR 31; 10 18.18 MIXED 81', ' l.“ ' ' 31. Hardy giants Circular IMPROVED ROBUST BEANS, Ped' rec Barley. Fritz Mantley, 76 G cmme sue flint? priogs. I‘repsid. free. L. CW. Michigan GLADIOLIIS. MICHIGAN DOWN, FI N E selection. for rednc prices. Thos. L Cousins, Nuthville, Michigan. MANCHU SOY BEANS—«CHOICE RECLEANED, from cell‘tifilitll selfnl. 9839 Hewiniétion. m» ; gs ree. uy . tanner cuss. Ohmic-n, Illinois. EARLIEST DENT SEED CORN. 91% GERMIN- a' . Also hardy alfalfa seed. Sam Bober, News . South Dakota. FOR SALE GOOD DENT SEED CORN 84.50 busheL Sam is our, sent for 25c. J. M. Mc— Farren. Rapid ity, Michigan. CERTIFIED WOLVERINE OATS. CERTIFIED Robust Beans. Postal cord brings particulars. A. B. look. Owosso. Mich. for pricm. Dans L. Butcher, Bennington, Mich. TOBACCO IIOMESPI'N TOBACCO—C II E W I N G pounds $1.50, ten $2.50. Smoking five pounds $1.25, ten '$2.0.0. Pipe Free. 1’? when ro- oeived. Satisfr etion Guaranteed. e n t u c k y Farmer's Assucmtion, Paducah, Kentucky. m TOBACCO—jKENTUCKY'S PRIDE; flnc chewmg 10 ounds, $3 nude. 32; 20 noun . $3.50. ‘Iayfleld, Ky. E X T B A ; smoking, 10 Farmer»! Club. IIOMESPUN TOBACCO. CHEWING 6 LBS.. $1.50,- 10—32.75. Smohng. 5 1m, 31,25; Mild 10—8150. Pay when received. F. anton. Bardwell. Ky. HAY AND STRAW HAY, STRAVV. 6; ALFALF'AI—WRITE us FOB prices. Consignments solicited. Prompt returns. Inquiries answered. eadtlual'terfl for Disaster Tankage, Meat sent a. J. A. Benson Co.. 332 So. LaSalle, Chicago. L MISCELLANEO US 100 ASPIRIN TABLETS. 45c PREPAID. GUAR- unteed Sample Free. Other Guaranteed Tab— lets and pills direct ,to you at wholesale pri Agents wanted Write for list. Gonna, 2m Dorp, New York. BARREL LOTS SLIGHTLY DAMAGED CROOK- m-y, hotel chinaware cookingware, glassware etc. Shipbed direct; from factorg to consumer. Write {or particulars. E. Swasey ' 00., Portland, Maine. ASH PAID FOR FALSE TEETH. PLATINU 0 old magneto minin- dlscarded )ewelr and 01 IMPROVED ROBUST BEANS. GENUINE WOL— old. Mail to. lloke Smelting & Re lung 00.. vetine Oats. Brookslde Farms, Wheeler, Mich. tsego. Michigan. REGISTERED WOLVERINE OATS—MICE , UNTS NOTES, CLAIMS COLLECTED man-B best 0‘ D' I‘mkbemer' Llll‘ton‘ Mmh‘ Acacigwherc' in world. No charges unless col- NURSERY STOCK RASPBERRIES. ASPARA- 31.25 pOBtPald. Free table Gar on Luxures. C. D. her new book looted. May’s Collection Agency. Somerset. Ky. FOR SALE—GARAG E AND GASOLINE station with hvmg rooms over head. Inquire of .l. R. Decster. Weidman. Michigan. KN'IITEER OWNERS, MAKE MORE MONEY. . Burns. Salem, IlL --- You like Aime Campbell’s 19067725? Then send for “C:0rnpanio'nshipl ’ which is a collection of her poem of home, family and farm life. Be- cause Mrs, Campbell’s first published oems appeared in The Business Farmer she ‘ will. prhmhoopyothiisstedifion.“Boundincloth, 185 page. "5 $1.25 post ‘ . Order from Rural Publishing Company, Mt. Clemens, Mich. V -..- N. Make a sketch showing the arrangement of your coéw barn and send it along with the in- formation requested below. You will find it convenient to lay a thin sheet of paper over the ruled space below, using the cross lines as guides. h—T—d l square equals 5 Feet , Owing to the rapidly increasing . use and popularity of De Laval Milkers, savings in their manu- facture have been made which make possible reduced prices for 1925. There is now no longer a good reason why any owner of 10 or more milch cows should be without a De Laval Milker. skilled operator; New York . 165 Broadan ——it not only milks better but faster, thus saving more —-eit is easy to wash and keep in a sanitary condition. Therefore, the De Laval is by far the cheapest in the end. The Do Laval Separator Company 29 nfiv’iifa‘ifizn s... You Can’t Get De Lava Results Unless You Use A De Laval Milker It is possible to get mechanical milkers for less than the first cost of a De Laval—but you can’t possibly get the same results. are now more than 25,000 De Laval Milkers in use, and —we have never known of one to injure a cow; -——the action of the De Laval is so pleasing and stimulating that cows almost invariably produce more milk; ———the De Laval is practically fool-proof and does not require a 11 San Francisco 61 Beale St. time; installatiOn ande‘satisfaCtory Work. , OW that you. I are planning your work for the coming season you are looking for ways and means of increasing your profits, by cutting expenses or producing more. If you are milking 10 or more cows a De Laval Milke’r will help you do both. Plan now, to get along with less help by install- ing a De Laval Milker, or plan to keep more cows with the same help you now have. Send us the information requested below and we will gladly send you, without obligating you in any way and free of charge, plans showing just how a De Laval Milker should be installed in your barn, and approxi- ‘ mate prices. Then if you decide it would be cheaper to hire a De Laval Milker than‘to hire extra labor, you will have plans which will insure proper Thousands of users sa their De Laval .Milker is the best investment they ever ma e and that they wouldn’t part with it for twice its cost; many go so r as to sa'y they would selltheir cows if they couldn’t have one. Our only regret after you put a De Laval Milker to work will be that you didn’t get one sooner-— and the longer you use it the better you will like it. Conservativer figured, a De Laval Milker will make at least $20. er cow per year in saving time and increased milk which usual y comes as a result of its use and because of its regular, stimulating and soothing action. A De Laval Milker usually makes much more than this, frequently saving one or more men. In addition, when it is considered that cleaner milk can be pro- duced, that the drudgery and dislike of hand milking are eli- minated, and that dairying is made more pleasant for owner, son or hired man, you have the answer why so many people are in- stalling De Laval Milkers. $0.9M \ICDCJr There €900 10. 12. 13. 14. Free—- De Laval Milker Engineer- ing Service 165 Broadway, New York Gentlemen: Without obligating myself in any way I am sending you the following information, tOgether with a sketch of _my b that I am to receive a drawing showing how a De Laval Milker would be installed in my barn and the apprommate cost. 1. THE DE LAVAL SEPARATOR CO., Dep’t4526 29 E. Madison St... Chicago 61 Beale St., San Francisco arn plan, with the understanding State maximum number of cows to be milked . . . . . . . . . . . . . . . . . . . . . . . How many rows of stanchions to be fitted up? . . . . . . . . . . . . . . . . . . . . . . How many cows or stanchions in each row? . . . . . . . . . . . . . . . . . . . . . . . . . How long is each row of stanchions? . . . . . . . . . . . . . . . . . . . . . . . . . .Feet . How far between the rows of stanchions? . . . . . . . . . . . . . . . . . . . .Feet . ’Is there an alley from side to side? , . . . . . In center? . . . . . . On end?. . . . . . Is there anything to prevent running a pipe line from stanchion row to stanchion row? . . . . . . . . .In center? . . . . . . . . .At end? . . . . . . . . . . . . How high above the stanchion row will it have to be placed? . . . . . . . . . . . Have you steel stanchionsi‘. .‘ . . . . . . . . . . . .What make? . . . . . . . . . . . . . or wooden stanchions? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . How near to the stanchions in feet can the pump be placed? . . . . . . . , , , (Please locate on sketch) . . Have you electric power?. . . .If so, give Voltage. . . .Phase. . .Cycle. . . Have youamotor?. . . .If so, state H. P.. . . .Speed. . . .Size Pulley. . . . Have you a gas engine?. .' . If so, state H. P.. . .Speed. . .Size Pulley. . . How many milker units will you require?: . . . (One man with 2 units can milk and strip 20-25 cows per hour.) Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. P.O.Address . . . . . . . . . . . . . .