DETROYR





\R’holc No.





4804





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





I Vol. CLXX No. 11

l

l

l

.1





 





fl





... .. ...~‘





 





\‘JP'





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





_ _ . .“':U 7-“7-m'71

. . . “*¢'»’-’.. ,





A





. r, r ‘7 fig ‘1‘

\ ,__ ‘ ', vyifll

' .5” I.) z ‘ ,

,e ' A /f7-’r





f/l‘ ‘





 





 





 





 





 





 





 





 





 





 





QngC,





Effie: '—





 





HE upper picture is a



View of Torch Lake,



one of the picturesque

lakes of the state, being

eighteen miles long and

two miles wide. It is

known for its well wooded

shore line, its good fishing

bathing, and hunting. It

is accessible principally by

U. S. 31 which runs be-

tween it and Grand Tra-

verse Bay, in Antrim

County.



Indian Head Point,

shown at the left, is a

promontory of the Pie-

tured Rocks on the Lake

Superior shores, northeast

of Munising in Alger

County. It is of red sand

stone which adds to its at

tractiveness. M. 25 is the

state tour road to Munis-

ing from where the Pic-

tured Rocks and Indian

Head can be viewed from

boat or by road to the

Rocks themselves.





 





 





 





 





 





 





 





 





 





 





,. H I ' // // '

. M .





///',
368- 2





 





 





A CHICK





NEED A

SPECIAL





STARTER





 





 





 





 





 





 





 





SPECIAL chick start-

er is an expense and a

bother that thousands of

successful poultrymen

have thrown into the dis-





card.





It is one of the nonessen-

tials that cut

As competition





into your

profit.

among poultrymen grows



‘ keener and keener, you can-

not afford to run up your

feed costs needlessly.





Several years ago the most

soundly progressive feeding

experts at the colleges of

agriculture found that one

mash would start chicks

and raise them with entire

satisfaction and greater





economy.





FEED MIXING SERVICE





AMERICAN MILLING COMPANY

EXECUTIVE OFFICES: PEORIA, ILL





\ Plantsar: PEORIA, ILL; OMAHA, NEE; OWENSBORO. KY.

\Alfalfa Plant: at: POWELL. GARLAND, and WORLAND. WYO.

\





I





Poultry





 





 





FACTORS IN HATCHABILITY





 





ROF. H. C. KNANDELL from



Pennsylyania State College brought

hen but the males should be from

out many useful points concerning

hatchability in his talk during Farm-

ers’ Week. He said that they do not

get ninety to ninety-five to one hun-

dred per cent hatches and have pro-

duced no 300 egg hens at the Penn-

sylvania Station. They did find a hen

that laid 296 eggs but could not get

the other four eggs.



The poultry business has reached a

stage where quality rather than quan-

tity hatching is the most important.

A male from a 225 egg hen might be

just as good as one from a 300 egg

200 egg hens or better. The males

should be selected from hens whose

daughters have also been good layers.



The factor of hatchability is an in-

herited trait. The size, weight, color,

and hatchability of eggs are important

as well as the number of eggs pro-

duced. In discussing the relation of

the age of hens to fertility and hatch-

ability, the following results were ob-





according to





college feeding

specialists





tained:

1927 Hatching Season

Age Eggs Fer— Hatch-

tility ability

AMCO STARTING AND 4 yrs. 1.746 73.2% 32.8%

3 yrs. 2,3? 83.5 34.3

i ' L ' ° yrs. 8 . 8.

GROWING MASH is mixed 1 yr. 3,004 93.2 57.7





They found that the old hens gave

the lowest per cent of fertility and

hatchability. Some of their commer-





is fed to

. . . ,cial hatcherymen found that the old

the Chmks at the” f‘rSt 3 hens gave twenty per cent less chicks.





feeding at 36 to 48 hours of lThe- New England poultrymen are

(hatching: a great deal from pullets.





fGeIting rid of the 01d hens is found

ito reduce the danger of losses from

‘ tuberculosis.



' The effect of age on the hatchability

of eggs was brought out in an experi-





on these college specialists’





own formula. It





 





age, and in gradually in-





creasing amounts, with





Amco Chick Grains, until





they are ready for Amco ment illustrated by the following

. figures.

Egg Mash. ge of eggs Hatchability

1 day 53.4%



3 days 22.3

AMCO STARTING AND 3 ;; £319

.1

GROWING MASH supplies ‘75 :1 :3}

all the chick needs to grow 3 1: E533;

_ 10 " .

quickly and sturdily, and Its 11 ” 35.





It is best to store hatching eggs at

a temperature about fifty-five to sixty

degrees. They can be stored in thirty

dozen egg crates and the crates

turned each day.



In telling of their method of hand-

ling breeding stock, Prof. Knandell

states that they take away the feed

for two or three days between the

first and fifteenth of October and give

only water. This method tends to

make the hens all moult at the same

time. Then about January first they

use lights in the morning on the birds

that are to produce hatching eggs.

They believe that when the hens are

in good production that they are in

condition to produce hatchable eggs.



Deep yellow yolks make good

chicks. When the hens are carrying

plenty of yellow pigment, it is good

for the hatchability of the eggs. Al-

falfa leaf meal in the mash and alfalfa

to pick at in the house, will improve

hatchability. Cabbage also seems to

help hens to produce eggs that will

hatch.





energy requirements are

furnished, economically, by

the scratch grains. See





your Amco Agent today.





MCO





 





 





l





 





DROPPING BOARD HOE





 





   

 





\isim.oi' Mich. State Poultry Imp. A5511.





“min. The 5 records range from 259 to 271.





in I'ionu-r Leahorns.





PIONEER POULTRY FARM





We been bred for high egg production for many generations. The,

no Mcuhrly well adapted to Commercial egg farms. Their largo

. size and rugged constitution enable them to stand up under arm-ans

conditions: Every male and female Inspector) by authorized inspectors under super-

‘ The free catalog Dells all about them.

RICHIGAN ACCREDITED—PURE BARRON STRAIN

Our "3,310.; shows pedigrees and gives a full description of the pen we imports!

direct trom Tum Barron. England. The males in this poll were out of a 298 all

in." mm mm] eggs weighing 30 ounccs to the dozen and we aim! by a 301 on

This is the foundation you get.

Many males dirt-ct from this pen now head our mating.

We are Breeder! and have spent many years with this one strain.

Write for Special Dincount New

B. No. l0, Box I.





 





F you use dropping boards in your



poultry houses, and if you don’t

you should, the labor of cleaning

will be reduced if you use a curved

hoe.



Take a piece of one-sixteenth inch

thick sheet iron, twenty inches long

and five and one-half inches high and

bend it into a slight curve so that the



(Continued on page 393)





 





Holland, Ilium





.. ‘ » MARCH 17, 1928-





us

from Michigan





Accredited Flock:

FREE: frigispr‘asmm





l I

ou better. Largengvy. casein ufl‘; JCgfirI/Jimrd:

Winter layer-u.





mum .. w... m-

era-Heme



rown. e2 om



Barred Rock Chicks. 1%? Live (1 li .'

anteed. Strong.nealt.hy chigks thatlicvevafxlid 281:3.





BIG CASE irsgygudggfi'tthis mangl—

mscotm'r are; arm 33‘:

Pay balance on arrival. erto today. Get ready

now for bigger profits next moon.





Knoll's Hatche and P I F

R. F. D. :2, 3.51m, nongxdfru’l'lcn‘Irm





 





 





 





 





 





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





 





MICHIGAN

ACCREDITED





Try some Silver Ward Select

Chicks this year and sea the

difference. They are chicks

that will develop into high

record money makers. Of

couse. they are Michigan

Accredited. Such strains as Barron and Tan-

cred Leghorns. Sheppards Anconas. etc.. have

been blended in their making.





‘GET THEM C. O. D.

You can now pay for your chicks when you

get. them. Absolute confidence. in our chicks

and faith in your honesty makes it possible

for us to ship you your chicks C. O. D. Our

free (fuming tells all about the details. Get

it to ay.





Silver Ward Hatchery, Box 29, Zeehnd, Mich.





 





BE SURE





To get our free Catalogue

and prices on DEAN QUAL-

ITY CHICKS. White Lez-





Wyandottes. All Michigan

Accredited. Some Certified.

Established Hill—Better this

year than ever._ DEAN ECG

FARM &. HATCHERY. Box 8. Birmingham. ”Och.





S. o. W. Leghorn Baby Chicks





Buy Mich. Accredited Baby Chicks from Michigan‘s

largest poultry farm. We buy no eggs to put in

ut produce them on our own farm

from selected 9 mated with 50% 200 to 336 etc

Tancred males. pedigreed. All breeders have been

bloodtcsted for BACILLARY WHITE DIARRHEA

for the past 4 years which insures you chicks prac-

tically free from this dread disease. No better chicks

at any price. Only one grade.



5. HARKEMA SONS. R. l. ‘ Holland, Mich.





 





 





our incubator





 





Quality Breeding Counts

‘ ~, FAIRVIEW Day Old Chicks. 3



‘ Weeks Chicks. Pullets. Hens and

"' } Pedigreed Cockerels have paved the

_ way to bigger Poultry Profits for

g hundreds. Send today for Bid.





 





,r profit. and get our Live and



' Live Prices. Michigan Accredited.

FAIRVIEW HATCHERY AND

FARMS. Box In. Iceland, Mich





HILLSIDE IIII'I'GIIEBY





Chicks. Genuine Tom Barren English White Leg-

homs., large type, overlaying combs. with elm laying

qualities. Non-setters Barred Rocks from M. S. C.

stock, 1928 flocks. bonded with cockerel whose dams

haw omcial tmpnested records 203-233. M. S. C.

egg-laying contest. Free circular explaining our 1928

special, surprising you, low price.





HILLSIDE HATCHEHI. HULLIIIII. HIGH" II. 3

BOS QUALITY CLASS A CHICKS





From healthy heavy layers of large eggs.

S. C. English White Leghorns. Brown

Lezhoma. Anconu. B. 1. Beds. and As-

sorted chicks at reasonable prices. No

money down. Pay full amount 10 days

before chicks are shipped. or C. 0.. D.

Special disgounts. 1,00% live delivery

postpaid. ntalouue rec. _

308 HATCHERY B 2“ Iceland, Mich.





, o

Kreuper 3 Chicks

' roflt. It' not. how much

mtepayfigfii will-at" 15333 1duality. :Ve bread for egg

production. Barred Rocks. Reds. Whine Leghorns.

KRUEPER HA'ICHERY. Wabash St. Mlian. Mich.





WHITE L RNS OIID'



ABY amm°wwm

.. LOW PREPAID PRICES



r- a! Emma winners for years. Guaranteed Ind insured: Also

I coc Is. pullers. hens Cumlocnad special pne- bulletm free.

4 GEORGE B. FERRIS. 934 union. carom nuns. Micn.





 





 





”In NIX c. 0. 3. Fine purebred

“HIcKS chicks and hit! ducks at



prices to In your pocketbook. Pedilrreed

males and selected {males make chick. a! finest qual-

ity. Free poultry book and catalog. Get details of

our liberal C. 0. D. oler. GWPERATIVE

BREEDING l. HATCHING 00.. Dex m. Tire. 0.



' Single Comb White Lez-

MY M $10.00 pm- 100 for March

delivery. Mn! $9.00 per 100. Discomt on orders of

500 or more. Live delivery Ill-ruined. HENRY

WATERWAY. n. 6. Holland. HM.





ICHIGAN FARMER





 





 





suits. Try‘onau ,1





‘. .'.,..;..*_.>

*x 5m, ,1». '.v





Classified Liners get re-
DEVOTED





 





 





2-1 ea





‘ ‘_ .33“.





,‘t





“w”! <3 «





«M3. found in





TO

MICHIGAN





 





VOLUME CLXX





 





 





 





 





 





A Practical Journal for the Ruralflramily





 





MICHIGAN SECTION THE CAPPER FARM PRESS





 





QUALITY

RELIABILITY

SERVICE





NUMBER XI





 





 





 





 





 





Sells Products on Open Market





[VI/[mm Brzstow, Master Farmer, Succeed: Mir/50w l/re Help: of Premium Prices

By Burt Wermuth





W1L1 1AM BRISTOVV s system of





tarming piesents a slightly dif-

ferent angle than has been evi-

dent in the majority of the stories in

the Master Farmer series. Unfor-





tunately for the writer this angle has





no dramatic features which can be

,used in developing an interesting

story.



The average farmer must always





.ask the question “can a farmer suc-





ceed financially by selling his products

at regular market prices?” The 111a-

jority of successful farmers produce

quality products

for which they so-

cure premium

prices. T h e s e

high prices often

enhance their in-

come to a con~

siderable degree.

But the average

farmer must dis-

pose of his crops

and animal pro-

ducts at par. This

is the interesting

point in Mr. Bris-

tow’s farming program.



On his l32—acre farm near Flat Rock,

he produces no specialties for which





 





.to receive premium prices to contri-





bute financial buoyancy to his busi-

ness. He sells raw milk at the same

price level that thousands of other

farmers are doing. Any advantages

that he may have over others lie in

the efficient methods of growing or-

dinary crops and feeding and caring

for his grade cows. In other words

he is a regular dairy farmer operating

under conditions that are common

throughout this section.



His farm program Centers about his

herd of dairy cows. These cows are

not pure-breds, but have been graded

up by careful selection and through

the use of excellent Holstein sires.





.This has given Mr. Bristow a herd of





efficient producers which have made





(possible the paying of all expenses,





the providing of a good living, and





the laying by of a neat sum each year

even during the past period of agri-

cultural depression.



These twenty head of grade cows

are housed in a thirty-four by forty

foot stable provided with cement

floors and mangers, steel stanchions,

and drinking cups, and equipped with

manure carriers. Two large silos add

to the feed storage plant. The herd

has twenty acres of pasture. He feeds

silage, alfalfa hay, grains, and miner-

als. Mr. Bristo-W has made a careful





study of dairy feeding to the end of

getting the maximum results from the

minimum of feed costs.

sold to a nearby market.



The cows on this farm, as on a





Raw milk is





great majority of dairy farms, have

proven an important factor in his soil

program. Over a considerable por-

tion of the season, the manure is

drawn from the stables directly to the

fields. During the winter, the wheat

and alfalfa fields are top-dressed. The

manure which accumulates in the

spring and early summer months is

spread during August on hay fields

which are to be used for corn the fol-

lowing year. Besides the careful utili-

zation of the stable waste, Mr. Bris-

tow applies about two hundred pounds

of commercial fertilizer to supplement

the manure 011 fields being fitted for

small grains. He also plows under

corn stalks and other crop residues





7_.~.~.. uwr,





 





 





 





 





l

'1





 





 





A General View of the Bristow Farmstead Appears Above, While Below Is

a view of the home from the side drive





not utilized in feeding (r htdding the

cows. Since his farm is 1ery letel

and the soil is a clay loam on top of

a clay subsoil, he has iound it nec-

essary to tile drain tiit entire farm



He also grows alfalfa. This crop

not only contributes .0 his soil pro-

gram, but he. has tomzd it, the beast

roughage for his dairy cows on ac-

count of its high protein content and

its palatability. He produces about.

thirty acres each year Grimm and

Ontario Varigated \arieties are sown

on the wheat in the swing. No lime

is required 011 this land. The alfalfa

crop is improved through the applica-

tion of a thin coat of manure during

the winter. Mr. Bristow’s: method of

making alfalfa hay differs somewhat

from the recommendation most com-

monly given. He mows in the morning

when the dew is on. The following

morning this hay is raked when also

damp with dow. The hay is allowed

to cure in the windrow until the third

day when it is drawn to the barn.

By this plan he finds that practically

all of the leaves are retained with the

hay. Mr. Bristow has also been suc-

cessful in producing crops of alfalfa

seed.



While alfalfa supplies the main

source of protein for his dairy herd,

the carbohydrates are furnished large-

ly by the corn plant. About twenty-

four aeres of corn are grown each

year. This crop follows alfalfa. in

the rotation. For grain he uses

Pickett’s Yellow Dent and Leaming’s

Yellow Dent for silage. The corn

ground is plowed in the fall and

worked as many times as the weather

and other duties peimit before plant-

ing. By following altalfa with corn

and applying manure generously, no

fertilizer is used directly on this crop

unless the particular field is in special

need of the additionai plant food. The

seed corn is carefully selected and

tested, and planted with a planter.

Cultivation is done with the tractor

and horses, the field being covered



(Continued to page 399)





Some Advice on Oil Leases





0' many inquiries are coming to the

desk concerning oil leases, how to

draw them and rights and liabili-



ties under them, that we are prompted





. to say a few words on the subject.





How to draw a gas and oil lease.

The point is very simple, and can be

shortly answered. The answer is

don’t. There is not one chance in a

thousand that a gas or oil lease will

be presented to a land owner that

gives him any protection at all and the

giving of it may gethim into very

serious difl‘iculty. To sign a printed

form commonly presented by lease





,solicitors is to give something for





nothing.



A few of the things that should be

provided for in the lease to protect

the lessor, and not one of which will

the common printed

forms, are the following:





”1 That the lease shall be void if.





a producing well alibi-ought in- on ad5

Mainland, unless an offset well on





By John





the leased premises is started within

a stated number of days and prose-

cuted to immediate completion.



2. Requiring development and dril-

ling of a completed well within a

stated time, not more than one year.



3. Provision that all equipment at-

tached to the land shall remain as

security to the lessor for the perform-

ance of the lessee’s covenants until

released by the lessor and in case of

abandonment of the lease shall belong

to the lessor.



4. A substantial and adequate rent-

al until such time as a well shall be

completed, in no case less than $1.00

an acre peryear payable in advance.



5. Provision for entry and forfei-

ture in case of failure of the lessee

to perform any of his covenants, and

that the lease shall terminate as 36011

as active operations cease after a. well

is drilled or it all or (as are taken





 





R. Rood





from adjoining premises without im-

mediate counter development to pro

tect the rights of the lessor, and that

the lessee shall in such case. execute

a written release suitable to record.



6. Provision against assignment by

the lessee without the written consent

of the lessor.



7. Provision to secure the lessor

against waste of petroleum products

and damage to buildings and crops.



8. Suitable regulation of the loca-

tion of wells, storage tanks, pipe lines,

and passageways.



9. Provision for metering gas sold

and supply for the lessor.



10. Provision for payment by the

lessee of all taxes thereafter levied in

excess of the taxes assessed for the

year that the lease is given.



The common rental provision is one-

eighth of an oil and gas produced

delivered to the lessor on the prom!“





and free use of gas for his domestic

purposes while any is produced. This

rental provision is probably fair.



It goes without saying that no one

except an experienced lawyer should

attempt to prepare such a. lease.



The printed form leases usually pre-

sented are entirely one—sided and give

the lessor no security whatever.



Ordinarily land owners are very

much better off by refusing to sign

any lease at all until oil in paying

quantities is found in the immediate

neighborhood. After such a. discov-

ery a very substantial cash bonus can

be obtained for the lease, and until

such discovery is made the lessor es-

capes a lot of risk and annoyance by

having no lease, and loses nothing.



The principal value of the lease to

the lessee is ordinarily as a specula-

tion to grab off some unearned profit





if oil is found in the nelghborhood__ _'





and take no risk and make no investo

1





 





 





 

 

 

 





 





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





1 .
. 1...... My. ac.» ..,- .7...





-3...~._...,...- 9-...“ .... .. a-» -





370-4.





MICHIGAN SECTION THE CAPPER FARM PRESS





 





Published Weekly Established 1843 Copyright. 1928





The Lawrence Publishing Co.





Editors and Proprietors

11332 Lafayette Boulm‘ard Detroit.



Telophone Randolph 15210

NlfiV YORK Olt‘lt‘lt‘l}. 420 lmxinumn Aic.

(‘Hlt‘AGO OFFICE. 203 N. \‘Jzihu‘h

CLEVELAND ()it‘lt‘li‘l'). It'll—lillii (iiozon Aux. N. F





Michigan





 





 





 





PHILADELPHIA ()lt‘lt‘it'ii, Bil—"lift South Third St:

ARTHUR (‘Al’l’l‘llt ........................ President

MARCO MORRIHV .................... Vice—l'rcxident

PAUL liAVVlll'INt‘lC .................... Vivwl’rcuidcnt

F. H. NANCE ............................. Secretary

._ __ _ _ __ ._ Hmn __

I. R. \VATI‘JRBI‘RY .................... ‘ .

BURT “'l'lllMll’l‘ll ...................... Assocmte

FRANK A. “'ILKI‘JN ................... 1‘44““1‘5

ILA A. LEONARD ......................

Dr. (“. II. Lerrigo ...................... ) ‘

John R. Rood ........................... Advisory

Dr. Samuel Burrows ..................... .\ Stuff

Gilbert Guslcr ........................... 3

Frank H. Mct'kcl ........................ ”—-

I. R. “'A'ITI'VIIIEIIIIY ............... Business Manager

TERMS or sidist‘mi-rmx: om- vim. 52 issues.

60c. sent. p0>tpaid. (‘zinadian subwription 50c a your

extra for postage. .1-.. ”WM... _

(”HANGING ADDRESS -n is nhmlutcly nq-csmry

that you give the name of your Old Post Olin-o. as





well as your New Post Otliv-v. in 341mg for a change

of address.





 





RATES 01“ ADVERTISING



00 cents per line, agate typo mt‘a'Jii‘t‘ine’llt. or $8;40 per

inch (14 agate lines per inch) po'r inwrtion. I\o .ad-

vertisement inserted for less than $2.00 (*fll‘ll insertion.

No objevtionnhiv mirertiwmcnts illst'l'té‘tl at am. nru'o.

Jinan-ed as Se-ond Class Matter at the Post Office at.

Under the Art of Mart-h 3. 1879.

___‘.—.—————-—~—~’—





Detroit. Michigan.





Menfic‘rAiidirfireau of Circulations.





 





 





Free Service to Subscribers





GENERALz—Aid in the adjustment of unsat-

isfactory business transactions.



VETERINARYrr'Prompt adiii-e from expert

veterinarian.



LEGALz-wOpinions on all

prominent lawyer.



HEALTHIA-Prm‘tical personal advice from an

experienced doctor.



FARMz—rAmwors to all kinds of farm ques-

tions. by competi-nt spa-mints.



HOME:#Aid in the solution of all kinds of

home problems.





point ~. from a.





 





 





 





 





 





VOLUME CLXX NUMBER ELEVEN





DETROIT, MARCH 17,1928





S states g0. Mich-





“ ° igan is still in

MIChfgan its childhood growth.

5"" It has unrealized pos-

Young sibilities, as shown by

her economic l a n (1



survey, that a w a i t development.





Though she stands in the front rank

in many of the world’s activities, as

theseother possibilities are developed,

she will grow even greater in her im-

portance as a state.



Modern efficiency in industry is. to

a great extent, a Michigan develop-

ment. It is based on definite knowl-

edge. Therefore, it is fitting that Mich-

igan should undertake this unusual

step to gain definite knowledge regard-

ing her natural resources. This will

be the basis of a sane economic devel-

opment which will assure the future

of the state.





T is tragic business





The to contemplate



that over one-fifth of



Ounce 0f the more than ninety

Prevention thousand fatal acci-

dents in the United





States in 1925 were to children under

fourteen years of age and that about

one-ninth were to children under five

years of age, according to estimates

given out by the National Safety

Council. About two-fifths of the fatali-

ties to the latter group were caused

by burns. In the age group of five to

nine years, automobile accidents and

burns each caused an eighth of the

fatalities, while firearms caused near-

ly a sixth oil the deaths among chil-

dren from ten to fourteen.



We are not enviable of the fact that

this rate was nearly twice that of Eng-

land and Wales. The majority of acci-

dents is the result of carelessness

on the part of someone, either the



'child, parent, or motorist. But the

tragic part of it all is that by the

timely application of the proverbial

ounce of prevention,. approximately

eighteen thousand children’s lives

might be saved annually.





England reports having succeeded in





I





THE MICHIGAN FARMER





reducing its number of accidents by

creating a “child sense” in motorists

and a “traffic sense” in their children.

If we are to make progress in our

safety first programs both in our

homes and in our schools, we might,

for lack of a proven program, adopt

the one of our mother country.





HY not simu-



Why iNot late labor and

A . I set aside one day in

gncu tur' the year when the

al Day minds of the country





may be turned toward

that great basic industry, agriculture?

The United States Senate has been

impressed with the wisdom of such a

move and on March 2 adopted a joint

resolution to that effect, introduced by

Senator Arthur Capper of Kansas.





The first Thursday of October of

each year is designated as “Agricul-

tural Day,” under the provisions of

this resolution. The measure pro-

vides that the President be requested

to communicate this declaration, by

proclamation or otherwise, to the

governors of the various states, re-

questing them to take such action as

they deem advisable in order to bring

about the observation of the day.





The resolution, which should not be

construed as establishing another

legal holiday. is intended to direct the

thought of the nation to the importance

of agriculture and the wise considera-

tion of the problems of that industry.



It is expected that this resolution

will pass the House and receive the

President’s signature. And may it not

be. that, growing out of this thought-

fulness of a nation, the farmer ulti-

mately may find more respect for his

home and property, his business better

protected, and his profits at little more

certain.





ROM figures com-





The piled by the de-

American partment of agricul-

ture, it appears that



Peasant fewer people left the





farm for the cities in

1927 than for the preceding year, but

slightly more than migrated in 1925.

On the other hand, 1,374,000 people

moved from the cities to farms last

year, against 1,135,000 in 1926 and

1,066,000 during the year of 1925. Thus

for the past year there is a net move-

ment from the farm to the cities of

604,000 persons as compared with

1,020,000 in 1926 and 834,000 in 1925.



A study made by the above depart-

ment shows further than eighty-seven

per cent of the people going back to

the farms have had previous farming

experience, indicating that many who

were discouraged with farming during

the depression of recent years have

decided after all that the occupation

is not such a bad one to follow.



It all means that farming is self-

adjusting. Ii'hen conditions on the

farm are bad, the situation is relieved

by people leaving for other occupa-

tions. When agricultural conditions

improve, and the farmer fares better

than people working at other lines,

the drift is back to the farms. From

this it would seem that the only

chance for the development of a peas-

ant class in America is for all other

lines of industry to reach such a poor

economic status that farmers would

have no place to go when reduced to

the conditions of peasantry.





SHORT time ago





Michigan’s f ”11" ec‘: Ha giefie

o 9 ran ap' 8



Secret Association of Com-

Socwty merce, gave a talk be-





fore some fruit grow-

ers in Fennville, in which he said that

one of the greatest handicaps to Mich-

igan was a nameless secret society.

Michigan farmers as well as the re-

sort keepers of this state were suffer-

ing as a result of this society. Its

membership is very large and influen-

tial as most every person in the state

is unconsciously a member.





This society exists because we keep

quiet about the advantages of Mich-

igan and its products. For instance,

Michigan grows some of the finest

flavored fruit in the world, but no

effort has been made to tell the world

about it. Michigan potato growers are

prominent members of this society as

Michigan potatoes are not even men-

tioned on the menu cards of the Grand

Rapids hotels.



We believe Mr. 'Bierce when he says

that the Bay of Naples has nothing

on the scenery and sunsets found

along the west coast of this state, nor

are the Idaho potatoes worth ten cents

a pound as compared to sixty cents

a bushel the Michigan farmer gets for

his product. But the world knows

about Naples and Idaho potatoes, as

well as western apples. \Ve agree

with Mr. Bierce that Michigan needs

a publicity department which could, in

an inexpensive way, let the world

know about many of Michigan’s out-

standing qualities. A good bushel of

Michigan Northern Spies sent to

President Coolidge would gain adver-

tising of untold value which money

could not buy, if accompanied with

proper publicity efforts.



Again we concur with Mr. Bierce

when he says that one of the chief

troubles, perhaps, is that we have not

sold Michigan to ourselves, but when

we do we will be so proud of our

state that we will not be able to keep

still. Grant it that everyone in Cali-

fornia has just reason for being a

booster for that state, there is no just

reason why a Michigander should not

be a. rooter for this state for there is

plenty to root about. Perhaps the

state should hire a psychologist to

help us change our attitude of mind

and break up this nefarious secret

society.





ELOVV are given





Breeders, the seven require-

Business ments of a business

code just published



Code by the American Jer-





sey Cattle Club. The

employment of sound ethics in the

pure-bred business should prove of

particular benefit to those who are

constantly joining the ranks. The

code reads:





1—Animals offered for sale must

be from a Federal Accredited herd

or have passed a satisfactory test

for tuberculosis within the past

year.

2—-—Bulls offered for sale must be

from dams having either official or

herd improvement association re-

cords of not less than 350 pounds

of butter-fat. '



3—Every bull over one year old

is guaranteed a breeder providing

the buyer’s cows are in good con-

dition. An animal is to be con-

sidered a breeder if he has sired

two or more living calves in the

herd of the purchaser. If not a

breeder, the animal shall be re-

placed by one equally as good or

to be returned to the seller in good

condition and purchase price re-

funded at the option of the seller.

In case. of exchange, buyer and

seller each are to pay transporta-

tion charges one way. If the ani-

mal is taken back, the seller pays

transportation charges.



4—Every cow or heifer over one

year old when sold is guaranteed

a breeder and taken back or ex-

changed on the same basis as for

bulls.



5—The seller must call attention

to any unsoundness of udder or

otherwise. But if an animal sold

as a heifer (previous to having

dropped first calf) proves to have

a defective udder when she calves,

it is the purchaser’s loss.



6—The registry certificate and

recorded transfer are to be supplied

by the seller at his own expense,

and the transaction is not complete

until these papers are in the hands

of the purchaser.



7—Price quoted shall also specify

crating and delivery cost.





Although the provisions of this code

are not binding, proclaiming them will

tend to crystallize in the mind of buyer

and seller an understanding of what

is just and fair. And that is the way





to better and more business whatever.





he the property offered.





.1





4 think of it there ain’t





MARCH 17, 1928





HE Canadian gov-



A ernmcnt has an-



. nounced that the im-

ljlttle. portation of alfalfa

Rectproaty seed into Canada will

- not be permitted, un-

less at least ten per cent of the seed

in each container is colored red. Ex—

ception is made of‘alfalfa. seed grown





in any state bordering on Canada, or .





in the states of Utah, Wyoming, or

South Dakota, which may be imported

when at least one per cent of the seed

in each container is colored orange,

or sealed in the container by officers

of the state in which the seed orgin-

ated, and if certified that the seed is

of the Grimm, Baltic, or kindred vari-

eties of alfalfa.



This move is asserted to be for the

benefit of the American purchasers of

Canadian alfalfa seed as well as for

the Canadian purchasers. It will pre—

vent the shipping of alfalfa seed from

southern European countries into

Canada for reshipment into the United

States to be sold as Canadian seed.





St. Patric/é ’3 Day





ND, be gorrah, if this ain’t St.

Patrick’s Day. I almost fergot it



like I did my wife’s anniversary when

she got married to me. This is the

time when you think about lads and

lassies, and comin’ through the rye.

and singing “VVearin’ of the Green.”

Well, if you wanta. show loyality to

any Irishmen’s country you’ve gotta.

wear green on this day 0’ Celebration.

But when I gotta celebrate my wife’s

anniversary I gotta wear black. And





 





   

 

 





   

   





   

   

 





to the grave and





the way Sofie





t i

;,,/ ‘ acts on that day,

d/QWIM I sometimes





think she’s glad of it.



This Mr. Patrick became famous

’cause he drove the snakes out of

Ireland, like Mr. Volstead is tryin’ to

do in this country. I don’t know how

long it took the Saint to do the job

but Mr. Volstead ain’t gettin’ them out

by shakin’ his Congressional robes at

them like Pat must 0’ done. '



I don’t know if St. Patrick has got

anything to do with it or not, but the

Irish is up—and-doin’ kind 0’ folkses.

When they come over here they fergot

all about farmin’ and get all the

policemen’s jobs they can, or if there

ain’t none of them around they be-

come politicans or lawyers.





‘8‘

3,





she says that’s

;/;WWWW7//flg nobody’s funeral

’/ _; but ours, but I

% g guess it’s ours al-

% % right, Each cele~

/ - % bration means

/ % 0118 Year nearer



./



y



y





&





/





 





Now, if it wasn’t for the Irishman

and the Jew, there wouldn’t be no

jokes, unless they'd be about mother-





in-laws. So maybe there’s something

common about Irishmen, Jews, and

mother-in-laws. I guess maybe it’s





talkin’. You never see a Irishman,

Jew or mother-in-law that couldn’t

. talk. The Irishman uses his mouth,





the Jew his hands, and the mother-in-

law anything that comes handy.



Well, there’s three things I ain’t,

Irishman, Jew, or mother-in-iaw and

I ain’t wishin’ myself any bad luck,

but I hope I won’t never be accused

of bein’ one. If a Irishman and a.

Jew is funny, and a mother-in—law is

funny, 3. Irish or Jewish mother-in-law

must be awful funny. But come to

nothin’ funny

about a. mother-in-law you kin ask

any son-in-law about that.



I’m just wonderin’ what kinda a.

mother-in-law Sofie’d make. I bet

she’ll make her son-in-law wear green

fer her on St. Patrick’s day, even if

she is Dutch. HY SYCKLE.





 





A careful study of the records of

American Guernseys a n d t h o s e

brought from the Island show that the

American cows are equal to those

from the Island of Guernsey. ' “





 





 





.oish. ‘





5' oi:





it

_t

«t
. . ““>';.-"_ .





_:





 

 





 





 

 





 





”bees. ‘ ‘However, when cold,





MARCH 1-7, 1928





fire Big“ Factor: in flux Setting of Fruit Crop





By H. D.





agent for cross-pollination has



not always been appreciated by

fruit growers. Many fruit growers

have entertained a rather hazy im-

pression that pollen is carried from

one blossom to another or from one

part of an orchard to another by the

wind. This is not the case. Fruit

pollen is moist. It is seldom if ever

blown about by wind. Pollen trans-

fer is carried on mainly by insects

especially honey-bees. The importance

of honey—bees as agents for cross-pol-

lination cannot be over emphasized.

No other insect is so_well adapted for

this purpose. The commercial fruit

growing of the future will be largely

dependent upon the domestic bee.



In a former article I mentioned the

change that has taken place in fruit

growing during the last twenty-five or

thirty years. The transition from

small orchards of: many varieties to

large commercial orchards of com-





T HE value of honey-bees as an





H ootman





ing the blossoming period wild insects

are of little value, and even the in-

fluence of honey-bees cannot readily

be observed for more than a few hun-

dred feet from the location of the

colonies. To assure sufficient insect

activity under all weather conditions,

colonies of bees should be distributed

through the orchard at the rate of one

colony to the acre. The placing of

colonies in an orchard will provide

for the most economical utilization of

any flight that is made by the bees.

Move the Colonies Into the Orchard



No good fruit grower would think

of harvesting his crop, carrying per-

sonally from his orchard to the pack-

ing house or storage each basket of

fruit as it was picked. He increases

his efficiency by moving crates or con-

tainers for the fruit into the orchard

where they can be rapidly filled. To

be consistent, the honey-bees effi-

ciency can equally be greatly in-

creased, by moving the colonies into





 





_





Ben Davis Blossoms in a Bee Yard Near a Northern Spy Orchard





paratively few varieties has caused

pollination problems in some orchards.

Under the variety conditions that gen-

erally exist in small orchards, the

wild insects, and what honey-bees

there are near the orchard generally

are sufficient to effectively pollinate

a satisfactory. crop; but with the

planting of orchards by the square

mile or in large acreas where a whole

community is engaged in fruit. grow-

ing, the wild insects are wholly inade-

quate to pollinate effectively the vast

expanse of bloom.



Last spring a prominent Michigan

fruit grower said to me, “I never see

any bees in my orchard and I always

have apples.” He would not be con-

vinced that insects were responsible

for the transfer of pollen until he had

erected at his owu expense an eight-

een foot cage around one of the Mc-

Intosh trees in his orchard. This cage

was covered with muslin during the

blossoming period to exclude all in—

sects. He anxiously waited until the

time when the muslin could be re-

moved to note the results. Just eight

apples ”set” upon the tree within the

cage; while other trees of equal size

in the same row harvested from





' twelve to fifteen bushels per tree. This





grower now realizes the importance of

bees and has already provided for fifty

colonies to be placed in his orchards

this spring.



The location and size of the indivi-

dual orchard are apparently the im-

portant factors that determine

whether or not colonies of bees should

be distributed throughout the orchard

during the blossoming period. Or-

chards not too large in size, located





near woods, swamps, or uncultivated

-lan’d where wild insects can winter





over in large numbers, usually set a

satisfactory crop without additional

‘ rainy

weather prevails previous to and dur-





 





 





the orchard during blossoming, where

the bees have the advantage of a.

shorter flight.



About 37,000 loads of nectar are re-

quired for the production of a pound

of honey. it is apparent that even a

very slight saving of time or labor,

becomes in the aggregate of great im—

portance to the colony—not only by

increasing the production of honey,

but the more important task of pro-

viding for cross-pollination. For pol-

lination purposes, the place for bees

during blossoming time is in or near

the orchard—not a half mile away.



Success with bees as pollinizing

agents in an orchard is largely deter-

mined by the man using them having

a knowledge of bee behavior. Only

strong colonies should be used. Prop-

er care must be exercised in moving

them, and, lastly the proper placing

in the orchard is all important. In-

stead of adhering strictly to the rule

of placing colonies 210 feet apart each

way in the orchard, (one colony to the

acre) bee flight will be encouraged

and better results obtained by locating

the colonies in sheltered ravines away

from windy, exposed locations. When

the wind is blowing over twenty miles

an hour bee flight is greatly reduced.

Wind blowing among the trees creates

eddies and cross currents which are

avoided by bees.



Value of “Wind Breaks”



I sometimes think the greatest bene-

fit of “wind breaks” near many or-

chards has been the shelter afforded

pollinizing insects working the blos-

soms when they are in bloom, rather

than the saving of fruit that might

be blown off near harvest time.



Orchard Planting Practice



In a large number of Michigan or-

chards, such standard varieties as

Northern Spies, Rhode Island Green-

ings, or McIntosh have often been



(Continued on page 377)





THE MICHIGAN' FARMER





Bees Help the Fruit Growcr‘





Below: Fruit and

branch sprayed

wlrbour Kayso.

Note uneven coat-

lng.





. spray

nsurance





for only

’1 % of your

spraying cost





Have you ever had a rainstorm

wash expensive spray materials of}.

your trees—just when you finished

spraying?



Or have you discovered that your

fruit—supposedly well sprayed—

becamc infested tgfnr .cpr‘ztyilzg?



Today thousands of. farmers “in-

sure” against just such spray losses

as these simply by adding Kayso to

their spra" mixtures.





Illa/res sprays reaily cover





Kayso (Calcium Casc-inare) acts

in a spray mixture as a spreader, an

adhesive, and an emulsifier.



Used in a liquid spray, it keeps

the mixture in even smpension in the

tank, preventing clogging and insur-

ing equal strength in every gallon.

That means more trees _spraycd from

each tank full.



in the spraying operation, a Kayso—

treated mixture forms a heavy fine

mist which covers the sprayed sur-

face evenly and thoroughly. It does

not collect in drops, as ordinary





liquid sprays do.





 

   

 





Above: Fruit and

branch evenljcov-

cred with Kayeo.

treated spray.





 

 





And when the spray is on, Kayso

makes it rtz't/i. Heavy dews, or even

rainstorms rarely wash a Kayso-

treated mixture 0H" the trees.





Effective in any mixture





Kayso is effective in any mixture

_..cht or dry—under any condi~

tions. Lime sulfur, Bordeaux, lead

arsenatc, nicotine and white-wash

all cover better and stay on longer

when mixed with Kayso. In the

home-making of oil sprays, Kaysot

is a perfect emulsifier.



Practically speaking, Kayso pays

for itself in savings of material, labor

and fruit. Actually, its first cost is

only about 2 % oi‘total spraying cost

—based on proportions of] pound

of Kayso to 100 gallons of spray.





You can’t afford to go without

this cheap spray insurance. Place a

trial order with your dealer today;

or write direct for full particulars.





GOLDEN STATE SALES

CORPORATION

175 Franklin Street, New York





 





BPREADS THE

S PRAY AND

MAKES IT

STAY





 





Estate,

Articles.





TRY a Michigan Farmer Liner to sell Your Poultry, Real

Seeds and Nursery Stock and Miscellaneous

See Page 401 for Rates.





 





um i'





   





 

 

 





um un





'filgiilllln

"3":7’





when the load is dropped.

Hundreds of farmers who equipped their

tractors with Pickering Governors report

“steady, smooth power.” “25% more

power,” “No more engine racing."

Pickering Governors are built for Ford-

son, McCormick-Deering, Twin City, Hart-

Parr and all other tractors.

Clip coupon for frée pamphlet which tells how

Pickering Governors make tractors live longer.





 





/ TIRCtOl‘ M

an Early Grave ; '





Engine racing has sent many a good tractor to an early grave.

let engine racxng is easily prevented—with a Pickering Governor..





For 8. Pickering Governor automatically controls the motor—it re-

sponds instantly to the slightest load change—there’s no overspeedingl





 

 

 

 





 

 

 





I The Pickering Governor 00..

Fenland. Conn.





Send me free pamphlet (11E





I Name .......... . ............. .uuc'ooe‘oo'on

Address ........ o ......... ..c..-.uoono-ooo.

Tractor ....... ...........................u'.





' Defler'l Km hoe-oodooa-bvo'oouo-ueon-e
MULE-Hlfii

. ’ROOFS





‘lvora mcx » -





w





.1 l A

HILL/ON FEET





Tu‘t‘E-Stuif





That’ a what MULEoHIDE

roofs are made of.



You buy years of wear

when you insist on MULB-

HIDE.



Roll roofing or our various

styles of shingles—~we use

all-rag felt for a base. After

this base is thoroughly sat-

urated and waterproofed

with high grade Mexican

asphalt, extra heavy coat-

ings,——top and underside,

—are added to insure long-

est wear.



There’ a MULE-HIDE dea-

ler near you. Write us if

you have any difficulty lo-

cating him.





The Lehon Co.

44th St. to 45th St. on

Oakley Avenue

CHICAGO. ILLINOIS





 





RY a Michigan Farmer

Classified Liner. It will

help you dispose of your



real estate or some miscell-

aneous article. It will help

you find that extra help you

may need. Michigan Farmer

Liners get big results, and

cost little.





 





. -~ ‘JL '



.xal'f"\' (Q

l N - ,.

filfiQi-{fé

_’.:} all ‘1





L

.





u?





Some farmers go broke while

others succeed, and here’s a secret

of many of the successful ones.

They GET THE GREATEST POS-

SIBLE PRODUCTION OUT OF

EVERY ACRE THEY CULTI-

VATE. It costs just as much in

time, labor, and seed to get poor

crops as it does to get good ones.

It's entirely a matter of proper

cultivation.

STUDY KOVAR CONSTRUCTION

"tweak at the high arched tooth

which the center hitch buries into

the ground at exactly the right

draft. Complete flexibility of frame

causes a hinging action on the

teeth protecting them against

breakage and preventing accumu-

lating of rubbish from the field.

Chrome vanadium steel in teeth

and high carbon steel in body make

an implement without an equal.

Big Success in Michigan

Every year sees more‘of these

sturdy general cultivators and

quack grass diggers in use in this

state. They are proving to be

exactly suited for soil conditions

of this state.

Get Full Information



Learn all about this cultivator

for your crops’ sake. Write dis-

tributor or direct to factory now!

W. J. HARDY. Deckerviile. Mich.

Distributor

Joe. J Kovnr Co., Owatonna, Minn.



"The Original Quack Crane Digger"





 





 





 





 





I Pie-ac send me information of the KOVAR |





 





 





THE MICHIGAN FARMER





Roosevelt Saw Farm Crisis Coming





At the dinner in New York City

to commemorate the twentieth anni-

versary of the appointment by

President Roosevelt of the Commis-

sion on County Life, Senator Cap-

per was principal speaker, deliver-

ing the address from which these

extracts are taken. Dr. Nicholas

Murray Butler, president of Colum-

bia University, presided, and

Colonel Theodore Roosevelt, Jr.,

was guest of honor. Other guests

were five hundred professional men

and financiers. The address dealt

fully with authoritative statistical

evidence proving the economic

needs of agriculture—Editor's Note.





HAT this gathering of men and



women for the purpose of ad-



vancing the Welfare of the farm

people of America should be inspired

by a man whose death occurred nearly

ten years ago is not surprising to those

who knew Roosevelt well.



The death of Theodore Roosevelt

was a real loss to the farmers of

America. More than any other na-

tional leader he foresaw and under-

stood their diificulties and had a. real

desire to extend to them the nation’s

help in solving their economic diffi-

culties.



Many years before most of his con-

temporaries, Roosevelt perceived that

the people of rural America were eco—

nomically handicapped. He foresaw

the farm crisis long before it became

an actuality.



I know this to be so because I was

one of the last men in public life to

talk with Roosevelt, and he then ex-

pressed to me his belief that the farm-

er was not on a fair and equal foot-

ing with industry and business, and

that hard times were ahead for our

rural population unless a constructive

national agricultural policy was

adopted.



Our meeting was in the Roosevelt.

hospital in New York, December 12,

1918. I was then governor of Kansas,

and while in this city on a business

trip, called upon Roosevelt at his re-

quest. I had been elected to the Sen-

ate for the term beginning the follow-

ing March, and he wished to discuss

with me the legislative needs of the

farmers. A few days later he was re-

moved t'rom the hospital to his home

in Oyster Bay, and died the following

month.



In our conversation, he expressed

the deepest interest in the condition

of the farm people of America. He

realized, long before most men of na-

tional prominence in political life, that

there was a farm problem. Knowing

my own interest. in rural conditions,

he volunteered to cooperate in work-

ing out a national agricultural pro-

gram at \Vashington.



The farmers were even then labor—

ing under difficult economic condi-

tions, but; Roosevelt saw even graver

trouble ahead unless comprehensive

and practical measures were adopted

immediately to remove the handicaps

to rural progress. It was not until

two or three years later that the agri-

cultural situation and depression be-

came most acute—and even after that,

indeed up to the present day, we had

and have men in public life who deny

the farmers’ need to legislative assis-

tance. They blandly assert that the

farmer can work out his own salva-

tion by increasing his efficiency.



Such was not the View of Roosevelt

ten years ago. Indeed in the last are

ticle which he wrote for a publication

—written where I saw him, and pub-

lished in the Metropolitan Magazine

of February, 1919, he urged the impor-

tance of promoting agricultural pros-

perity and welfare. Furthermore, he

spoke of the need of getting the farm~

ers’ own viewpoints on their problems

and of following the recommendations

of farm leaders. He advocated the

sending of farmers to Congress, and





Cultivator. I

I _______ I he emphasized the importance of deal-

I Name ....................................................... l ing intelligently With the pI'Oblem of

' Addy....................................m Stitc............ marketing farm prOducts.





r

-——-—-———-—--





Despite years of discussion of the

subject, there is still some lack of un-

derstanding in the industrial East of

what constitutes the real farm prob-

lem.



The kernel of the whole agricultural

problem is- in the difference between

the value of what a farmer sells and

what he buys. The things that a. farm-

er sells bring thirty-four per cent more

than before the war, but the average

selling price of commodities which the

farmer must buy is fifty-nine per cent

higher than before the war.



The difference between the thirty-

four per cent and the fifty—nine per

cent shows the handicap against agri-

culture. Expressed in another way, a

farmer’s dollar is worth about eighty-

five cents, while the rest of us have

a dollar with an exchange value of

one hundred cents.



Efficiency of the farmer, measured

by productivity, has greatly increased.

But his costs of production also have

increased, and out of all proportion

to the prices the farmer receives for

his products. Therefore, the problem

of agriculture is one of marketing as

well as of production. Dealers and

distributors make more out of the pro-

ducts of the farm than the farmers

themselves.



The great trouble with the farmer





today is that he has not been able to





pass on to the consumer his doubled

cost of production, as other industry

is doing. He sells largely on the. basis

of a world market, and buys on an

American market.



The West has waited patiently for

the same degree of legislative assis-

tance and relief that the Government

nearly always has extended to the in-

dustrial East. But the West cannot

wait forever. The people on the

farms demand a fair return for their

labor. They are entitled to it. They

must have it. I say it is due the farm-

er, morally and economically, to place

him on an equality with labor engaged

in industry. .



Necessarily the fight for so-called

farm-relief legislation must go on until

these things finally are accomplished.



The farmers have asked for no more

of a price-fixing plan than our protec-

tive tariff is. I’nder the tariff laWS

the country has prospered amazingly

with the exception of agriculture,

which has not been admitted to full

membership in the American protec-

tive system. If it is not entitled to

full membership, then other industries

are not.



I have been an advocate of farm-

relief legislation because I believe it

the part of wisdom to bring the farm-

er’s standard of living up to the gen-

eral level, rather than to drag the rest

of the country down, as must happen

if we do not meet this situation

squarely.



The problems of rural life in Amer-

ica are many and serious. They will

be solved by the understanding, good

will, and cooperation of all our

people, because this is not a nation

where class is arrayed against class,

but because the people of America are

united for the common good.





WANT MORE MONEY FOR

RESEARCH



EPRESENTATIVES of the farm



organizations and other groups

interested in the work of the Depart-

ment of Agriculture are now wholly

satisfied with the appropriations car-

ried in the Agricultural Department

bill as passed by the House, and will

carry over into the Senate their fight

for larger appropriations for agricul-

tural research. The bill Was amended

in the House by an increase of $280,-

000 to the $1,300,000 appropriation for

agricultural extension and demonstra-

tion work and $170,000 increase in the

appropriation for reforestation. For

tuberculosis eradication work $5,708,-





MARCH 17, 1928





000 is allowed which is $245,000 below

last year’s allowance. The decrease is

due to a falling off in demand. An

appropriation of $441,000 is allowed





for eradication of hog cholera. and,





$887,660 for corn borer control.





CORN BORER ERADICATION

IMPOSSIBLE





R. MARLATT, chairman of the



Federal Horticultural Board, is

quoted as saying that “there is no

possible means of eradicating the corn

borer.” In his testimony before the

House appropriation committee, Dr.

A. F. Woods, director of scientific re-

search, Bureau of Chemistry and Soils,

said that the best that could be done

by the government was to slow down

the spread of the borer and aid farm-

ers in keeping the damage to a mini—

mum. This must be done by cultural

methods, the planting of: corn that is

more resistant to the borer, and by

a different cropping system. It is not

expected that the corn borer will ever

be eradicated and in all probability it

will spread to the entire corn belt of

the United States.





 





 





News of the Week





Investigation by Dr. A. M. Barrett,

of the Psychopathic Hospital in Ann

Arbor, shows that there are 6.000 in-

sane. people in Michigan that are not

recelvmg adequate care.





Major Thomas Lanphier, command-

er Selfridge Field, will quit the army

to devote his time to the commercial

development of the “fuelless” motor

invented by Lester Hendershot.





Senator \Voodbridge N. Ferris has

announced that he will not run for re-

election.





VVm. H. Crane, one of the world’s

greatest comedians, died at Hollywood,

California, last week at the age of

eighty-three.



Tom Sawyer, the original of Mark

Twain’s character, died in Spokane

last week.





The police officials in Detroit report

that crime has decreased one-third in

that city since the first of the year.





The Protestant ministers in Boulder,

Colorado, have agreed not to remarry

those who have been divorced unless

the divorce has been the result of in-

fidelity of their mates.



Influenza is raging in Japan, espe-

cially in Tokio. Two thousand deaths

are reported and the emperor himself

is afflicted.



Charles Levine, who flew as passen-

ger from New York to Berlin, made

a non-stop flight with Wilmer Stutz

and Miss Mable Boll from New York

to (Havana, Cuba, the first one to be

ma e.





Anti-Mussolini demonstrations be-

came serious in Vienna when a mob

of Austrians threatened to do damage

to the Italian embassy.





S. H. Bemenderfer, a former official

of the Ku Klux Klan, has testified

that the Klan is a huge swindle, and

that Catholics run the order in many

states.



President Coolidge believes that the

resources of the country will warrant





 





 





another $225,000,000 reduction in

taxes.

Lorene Jones, a sixteen-year-old





Kansas City high school girl, swore

out a warrant charging her mother

with assault for whipping her when

she took out the family car, used up

sixteen gallons of gasoline, and re-

fused to tell where she had been.





The Detroit electrical workers union

business agent, Harvey Watson, has

been held by kidnappers for $25,000

ransom.



Mrs. Catherine Fenton of New York,

104 years old, was thrilled by her

first airplane ride at St. Petersburg,

Florida.



There are 218,168 students attend-

ing the public schools of Detroit. This

is an increase of ten thousand since

February, 1927.



Reports show that Chicago is the

only one of twenty~three large cities

which shows a decrease in unemploy-

ment during 1927.



Marshall Armond Diaz, commander

of the Italian armies during the World

War, died at Rome last month. He was

67 years old.





 





a





 





asseev .-





a;





 





.- «Vivi-“M”? . '





 





 





.“ \
i

i

1

E





 





MARCH' 17I 1928 if





.. Oil facts for farmers





THE MI’TH-IGAN FARMER'





This page fromairplane history settles the

question: “What oil is the QUALITY oil?”





Your tractor engine operates under load con-

ditions very similar to the airplane engine.

Both engines operate under heavy load con-

dition for hours at a time. Both run most of

the time with throttle wide open, using 75%

or more of their power. '



Mobiloil’s success in airplanes is duplicated

by its success in farm tractors, trucks and

automobiles.



In every section of the country you will





find shrewd farmers who look beyond the

purchase price when they buy oil. With

Mobiloil in their tractors they frequently save

10% to 50% on oil consumption. They save

on gasoline consumption. They get rid of

frequent overheating.



They find repair and replacement costs are

substantially lowered. You can get these

benefits, too, from Mobiloil —- the world’s

Quality oil.





 

   

   





EVERY one of these recent

flights was made with

M O B I L O I L





I. 1924—Round-the-World;U.S.ArmyFliers(U.S.A.).



2. 1924—Dawn-to-Dusk across United States; Lieut.

Maughan (U.S.A.).



3. 1926—To the North Pole; Commander Byrd

(U.S.A.).



4. 1926—New York to Buenos Aires; Duggan,

Olivero and Campanelli (Argentina).



5. 1926—Round Europe; Capt. Stanovsky (Czecho-

Slovakia).



6. 1926—0ver the Andes; Lieut. Doolittle (U.S.A.

and Chile).



7. 1926—Over the Andes; Lieut. Cuddihy (U.S.A.

and Chile).





8. 1926—Tour of the U. S. A. in Byrd North Pole

Plane; Pilot Bennett (U.S.A.).





 





 





 





a





" srfiAv -





9.1927—Winter flight over Canada; lst Pursuit

Group of U. S. Air Service (U.S.A.).





10. —-1927—Paris to Madagascar; Major Dagnaux

(France).





11. 1927—Around Union of South Africa; Major

Miller (British).





12. 1927 —San Diego to New York; Col. Lindbergh

(U.S.A.).





13. 192 7—NewYorktoParis;Col.Lindbergh (U.S.A.).





 





Mobiloil





The World’s Quality Oil





“ ____ __ f-f ‘ ' Mega H





__,,__ _7,__ A k“ _ H w __ _A._ - "4 ‘ - .

=-=-=-=-=-=-=-_-=-_:-=-=I





 





 





14.1927—Around Australia; Capt. C. Kingsford-

Smith and C. P. T. Ulm (British).





15. 1927——San FranCisco to Honolulu; U. S. Army

Fliers (U.S.A.).





16. 192 7—Around U. S. A.; Col. Lindbergh (U.S.A.).



17. 1927—Around Japan; Japanese Flier (Japan).



18. 1927 ——Prague to Tokio; Col. Skala (Czecho-

Slovakia).



19. 1927—San Francisco to Honolulu; Art Goebel

(U.S.A.).





20.1927—New York to Spokane; Charles Meyers

(U.S.A.).





21. 1927—Washington, D. C., to Mexico City and

Central America; Col. Lindbergh (U.S.A.).





NOTE: Mobiloil “B” and “BB” of the same

uniform quality as used on these flights is recom-

mended for the lubrication of tractors, and is avail-

able at all Mobiloil dealers’.





 





VACUUM OIL COMPAN





Other branches and distributing warehouses throughout the country





New York, Chicago, ’P/Jiladelpbia, fioxton, ’Baflalo, “Detroit, St. foals,

fittsbarg/J, Cleveland, Cincinnati, Minneapolis, Kansas City, @alla:
37H





 





FOR forty years “The

Fertilizer Leaders of

America” have been

making High Grade

Fertilizer to meet the

soilconditionsandcrop

requirements of your

farm. They have fol-

lowed the advice of the

foremost agricultural

authorities ofyour State

in blending the best and

richest plant-food ma-

terials into satisfying,

crop-making, fertil-



izers.





A dealer for one of the

leading brands shown

below is near you to

serve you. See him

about spring fertilizer.

Hewill save you money.

The best farmers of

your State trade with

“The Fertilizer Leaders

of America” and rec-

ommend these fertil-

izers to you.





 





 





 





 





 





[THE MICHIGAN FARMER





 

 

 

 

 

 

 

 

 

 

   

   

   

   

   

   

   





Soft corn is poor property. You

can’t sell it at a profit and it makes

sorry feed. Yet for the last five sea-

sons the crop has been from 25% to

40% soft. A big loss—and, if you had

any soft corn, you shared that loss.





Fer-tilized corn grows rapidly, ripens

early, and is almost sure to be ahead or

the frost. A couple of weeks’ delay at

planting time can be made up where 300

to 500 pounds of available plant food is

applied to insure constant, steady growth.





Get your fertilizer from “The Fertilizer

Leaders of America,” and use it on your

corn crop this year. Use more pounds

per acre, and notice the difference. It is

your only crop insurance-and the in-

creased yields of better corn will be re-

membered long after your investment is

forgotten.





OK) FERTILIZER.>OK l 5'





 





 





 





——;llll [fi’ili





lllL

l





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





i

!

I

\.





 





 





édém/ Chemical co.- Inc.





LOUISVILLE KK NASHVILLE TEA/IV. COLUMBUS O.





/





     





   





.fEDERAL





@I





M





 





1:4:





 





SProvedBest.’





 

 

   

 

   

 

 

 

 

 

 

 

 

 

 

   

   





 





Double

Protection ’





 





FOR 9YEARS





When seed men start talking alfalfa, Grimm

is the standard of comparison. That’s be-

cause for 69 years Grimm has proved best.





Double Protection For Buyers

This year, playabsolutely safe. Sow Blackfoot

Brand Idaho Grimm —-State Certified, pro.

duced underclosest supervision from sowing

to market by the largest and most reliable

Grimm Alfalfa Seed Growers’ Association.





Do not confuse Blackfoot Brand Grimm

with “Moonshine” or Grower affidavit

Grimm. Unless seed is state certifi-

ed it is not recognized as genuine by

the State Seed Commission of Idaho.

When you buy, insist on Blackfoot

Brand in sealed bags.





If your local dealer cannot

supply you, 'write direct to





’IDAHO GRIMM ALFALFA SEED

GROWERS’ ASSOCIATION

BLACKPOOT. IDAHO





ALPALFA SEED





 

 





 





 





 





 





 





 





Handy Man’s Corner





 





 





SWEARS OFF ALCOHOL





O prevent'the' trouble from stop-

page of oil circulation in a car

in cold weather, due to freezing of

the condensed moisture which collects

in the crankcase and mixes ‘with the

cylinder oil, I put into the crank case

one-half pint {of alcohol for each gal-

lon of cylinder oil, and I have no

trouble with my oil freezing in winter.

I have used this same plan for three

or four winters, and as one reader

reports, have had no trouble with my

oil circulation freezing up. Recently

an oil man showed me a sample of

good oil into which a small proportion

of denatured alcohol had been mixed,

and how a thick gummy residue had

been found. This explained the stringy

clots I had sometimes found on drain-

ing out my oil, and I decided right

there that I did not want such oil in

my car. Most oil men agree that this

is not good practice and that it is

likely to cause damage if the car is

driven hard with such oil in it.



This fall I put a partial suction pipe

from my carburetor intake into my

crank case through a hole in the valve

cover plate, so as to draw out a. small

part of the crank case air at each

suction, and since then have had no

more trouble from oil circulation

freezing up, even during the extreme-

ly cold'weather in late December and

early January. This suction should

not be made too great, as this would

tend to pump out too much of the oil

vapor and thus use up the crank case

oil too rapidly. But no more alcohol

in my cylinder oil, thank you!—

Dickerson.





RADIO BATTERY DOESN’T WORK





What is wrong with my radio A~





battery? When it is about half dis-

charged, it won’t run the set. The

tubes are dim when lit. Please ad-





vise—P. S





The ordinary manner for testing a. ‘





radio storage battery is by means of

the hydrometer—«1175 on the hydro-

meter usually indicates a complete

discharge while 1275 to 1300 indicates

a full charge. However, if at some

time or other electrolyte was added

instead 01' distilled water, the hydro-

meter reading might show one-half a

charge when in reality the battery was

fully discharged. The fact that your

tubes are dim would indicate to me

that the battery is discharged, there-

fore thc hydrometer readings no long-

er indicate the value of the charge.

I would suggest that you take the bat-

tery to a battery service for testing.

-—-E. A. Sauve.





SPEED OF BUZZ SAW





What is the maximum speed for a

common cordwood saw, diameter 24

inches?——0. A. C.



The safe speed of a 24-inch circular

saw is about 1,500 revolutions per

minute. This value is based on a

peripheral, or tooth speed, of 9,000

feet per minute which applies to all

sizes of circular saws. For example,

a 24inch saw would have a circum-

ference 01' 6.28 feet. Dividing 9,000

by 6.28 will give 1,432 revolutions per

minute safe speed. This value can,

however, be raised to 1,500 revolutions

per minute and still remain a safe

operating speed—E. C. Sauve, M.S.C.

LIME IN GAS ENGINE HOPPER





What would take the lime out of a

KatIeIr hopper on a gasoline engine?—





Lime may be removed from the

gasoline engine by putting into it a





‘mixture made up of seven parts of





rain water and one part of muriatic

acid. Leave the mixture in for thirty-

six hours. At the drug store ask for

commercial muriatic or hydrochloric

acid. It will be as effective as the

higher grade acid and be less expen-

sive—F. E. Fogle, M. S. C.





 





J. S. Caldwell. Vinton. Iowa, let the hogs follow

the plow to clean up the grub worms in a well-

fe lO—acre clover pasture when he broke it:

up for corn. His crop ran 60 bushels to the acre

at $1.10.n total of $660.00. On his other ten his

fence was poor. Grubs got all but 150 bushels——

a total loss of 45 bushels per acre that could

have been saved with a hog-tight fence. “You

can borrow $1,000 at 7% , put it mto fence and

make money”. says Mr. Caldwell. We claim





RED BRAND FENCE





“Galvannealed”-Copper Bearing





is the best investment any farmer can make. A

teat. many have proved this true. They know.

mm experience. that hoggingdown, pasturing



after harvest. and crop rotation Will pay for



RED BRAND FENCE in from 1 to 3 years.



They know. too. that this real good , copper-



bearing steel with its extra heavy zmc “galvan-



nealcd" coating keeps rust out;that these two



things make RE D costlcss by lasting



longer. Its stiff stays well-crimpcd line Wires.



can’t-slipknots, help ecpitstraightJrim .hog-



tight and bull—proof. The fence that Wlll last:



the longest is the cheapest fence to buy. _



hat has been your experience With or With-



out good fence? We will pay $5 or more for each



, letter thatwe use. Writeforfietallsncatalog and



31nteresting booklets



' that; tellhow oth-



' as have made



more moneywith



hog-tightfences.



, ileystone Steel

" d Wire Co.



4913 Industrial

St, Peoria, lll.





 





 

   

   

 

   

 





 





 

 

 





' R(edl Brapd

. , topwire “





Nothing liner for Garden

’ Plowing. Harrowing.

Seeding. Culthminl. Sprlvlng. Lawn

Mowing. Bolt Power.





 





 

   

   

 

   

   

 

 





 

 

 





 





' qultily interch-nrr

Able. l-pomt new tools. Arched Ax e.

Tool Control. Power Turn and other vital

foul-rel. Power Pulley for Bell W

- Time Plvmenl plan. Write today.

, GILSON MANUFACTURING. C0»

788 htk Street. Pan Washing WI .





 





 

 

 

 





 





 

 

 





 

 

 

 

 

 

 





 





"m A Powerful Tractor for Small Farms. ,-‘~ . '

500‘. Gardeners. Florists. N uraenes. Fruit mil!

Growers and Poultrymen. .n/w,

now: been ilfifl's Ironic p. x,

mm Walking In Riding Equipment :- " ,5





Free Catalo Rum Ben Jobs

STANDARD ENGI E COMPANY

821! one Ave. Minneapolh. Minn. L ,5

Eastern Branch 145 Cedar St” New York ' a -





INTERNATIONAL PAPER COMPANY

New York, N. Y.. February 20th. 1928.

[the Boa-rd of Directors have declared a regular

quarterly dividend of one and thl'i'e-(lum‘l‘fil‘s (l%%)

per cent on the Cumulative 7% Preferred Stock of

this Company. and a regular quarterly dividend of

one and one-half (1%‘%) per cent on the Cumulative

13% Preferred Stock of this (Tmnpany, for the current

quarter, payable April 16th, 1928. to holders of record

at the close of husluess~April 2nd. 1928. Checks

will be mailed. Transfer books will not closet

OV‘VEN SlIl‘Il‘HJ'lllD, Vice-President & Treasurer.





 





“10 to 40 Years of Service

With Clark ‘Cutaway’

Harrows”Say T have Farmer:





"l have a ('lurk 'Cutaway' Harrow that my father

bought nearly 40 years ago. When he died 18 years

ago it came into my possession, and I reckon it has

lxmt used t-vory year since it was bought. 1 run a.

twmhorst- farm and use it a good donl."~~J. F.

)lr-(‘omwlL Ashland, Ga.



"St-11d )uc prices of parts of your Clark G-ft. Re-

versible l'lxtellsion llurrow. I haw had it 10 or 18

years: it, is the finest cultivator in an omhard I ever

used. and l hau- tricd out several kinds.”~—-F. G.

I’ll-Inning. Juliet. .Moutana.



“Send me the price of a set of wooden hearings for

a, two-horse Reversible Single Action Harrow.

bought this burrow from you over 10 years ago. It,

has rendered satisfactory service your after year in

spite of the fat-t that it rw-eivcd the roughest usage

of any tool on the fa1‘lu."—J. Philip DetSCh. Nail-

hobu, Muss.





 

 

 





   

   





s_"....s____ . _«._;__

|L‘ 5|“ch in Tim; ”qule





Single Action Harlow fitted



1dr with cutout or solid disks of



cutlery steel. heat treated and



forged sharp for better work



and longer wear. Reyerslble gangs. Light draft.



Disks carry weight of machine. Made with extension



heads for ordiwd work. Mail coupon] for tree cata-

log and book. "'l‘ho Soil and Its Tillage.”





THE CUTAWAY NARROW COMPANY

704 Main St. Higqanum. Conn.





Please send me FREE your cam cos. and

boot. "The Rail and m rinses." 0" mi





m onnoo‘vanso.none-oouonouaoooceno‘ooeoccone-o-u-





 





 





it“ otouIoout.IIonvootlooolaOOOOOloOIolcput-co.

.





 





3:3

; 5::

J.)





 





‘« “r. 4" ..\
igweiifiwflsaw ..





'Mkos; 43-5“ ‘f ‘1, ,





 





 

 





 





MARCH 17, 1928





 





 





Service Department





 





 





BUILDING OF BOAT HOUSES





 





What are the laws, if any, regard-

ing the subject of boat houses on the

small lakes of Michigan?——R. G. S.





The owners of the shores have the

right to build 'boat houses. They may

build them out over the water if they

desire. There are no regulations es-

pecially applicable as to boating on

small lakes—Rood.





SPECIAL PERMITS FOR KILLING

SKUNKS





 





Is it legal to send away skunk hides

to have them tanned after the season

is closed? I want them for my own

use. Would I be violating the law by

killing muskrats on my barn floor?

They are destroying corn in bundles.

Could I have their hides tanned for

my own use ?——Reader.





The pelts of skunks taken during

the open season may be shipped for

tanning or sale at any time. It would

be a violation of the law to kill

muskrats during the closed season

without a permit. Fur bearing

animals that are doing damage to

property may be destroyed under spe-

cial permit on the condition that the

pelts of such animals must be prop-

erly cared for and sent to the Depart-

ment of Consevation, Lansing—G. M.

McCann.





CONTROL OF MOLES





 





I have set rose bushes and flowers

in front of our house. I have noticed

that something digs under the roots

which seems to pick up top ground,

flowers, shrubs, and roots thereby

causing them to die. How can I get

rid of this pest? There are also large

bugs in this piece of ground. They

resemble the caterpillar and are white

or gray—S. G.



The animal which is digging under

your shrubs and lawn is undoubtedly

the mole. There is a number of ways

of eradication. Traps are used. Seeds

of castor oil plant may be inserted in

the runways. They are deathly to the

mole. Carbon bisulphide dropped into

the holes on cotton will cause suffoca-

tion. Sodium cyanide will have the

same effect. The white grubs that you

mention are probably out worms. The

best method of control is by means of

poison bran mash. Mix bran with a

little white arsenic and cheap molas-

ses and then add a. few drops of

banana oil. Scatter this bait about the

plants and you will have no trouble

in ridding the place of the pests, but

use care in protecting other animals

from it.——Alex Laurie.





PAYMENT OF HIGH SCHOOL

TUITION





 





We have a son who attended the

rural school up to the eighth grade,





 





THE MICHIGAN FARMER





" $11'





You probably never think of Buick as selling for

only $1195—and yet you can buy a Buick and

true Buick quality at this extremely low price.





You have your choice of three popular Buick

models—the roomy Sedan, the trim Coupe or

the smart Sport Roadster.





And you can have it on terms so liberal that

you need not deprive yourself of the joys of

Buick ownership.





Luxurious bodies by Fisher in distinctive Duco

colors . . . flashing getaway and the virile power

of Buick’s famous valve-in-head engine . . .

supreme riding comfort resulting from Buick’s

Lovejoy hydraulic shock absorbers and Buick’s

cantilever springs.





Only Buick offers these fine car features at such

moderate prices. See and drive a Buick. We

will be glad to demonstrate at any time.





 





SEDANS $1 195 to $1995 ' COUPES$1195 to $1850

SPORT MODELS $1 195 to 31525





All prices f. o. 6. Flint, Mich, overmnent tax to be added. Tbe G. M. A. C.

finance plan, I e most desirable, is available.





BUICK MOTOR COMPANY, FLINT, MICHIGAN





 





Division of General Motors Corporation J‘

Canadian Factories: McLAUGHLIN-BUICK. Oshawa, Ontario





BUICK





 





took the seventh grade county exam-

ination and passed. Then we sent him

to a parochial school in town. Does

the district in which we live have to

pay his tuition at high school as well

as for any other child graduated out of

our district as this is an accredited

school? His diploma is signed by the

superintendent of schools of our town.

~—F. C. B.





High school tuition can be paid by

the district board for applicants who

have a county eighth grade diploma

or a certificate of promotion out of

the eighth grade given by a graded

school district employing a superin-

tendent of schools. If the boy men-

tioned in the above question does not

posses either of these the board can-

not legally pay his tuition. The fact

that he took the seventh grade county

examination and passed does not en-

title him to the high school tuition.

He must have passed the eighth grade

and received an eighth grade county

diploma or a certificate of promotion

as mentioned above—C. L. Goodrich.





A bill before the Quebec legislature

provides a tax five per cent on

restaurant meals costing over a dollar,

the tax money to go to support of

hospitals. '





 





Loveioy Hydraulic Shock Absorbers.

front and rear





Smart low-swung Fisher bodies

Form-fitting tailored seat cushions

Rich color harmonies, inside and out

Bullet-type headlamps



Adjustable steering column





The Buick Double-Lock (One turn of

the key locks both ignition and steer-

ing wheel)





The famous Buick Sealed Chassis—

with every operating part sealed in-

side a dirt-proof, dust-proof. water-

tight housmg





Triple-sealed engine

Vacuum cleaned crankcase





Ohne universal ioint. instead of two or

t





Buick mechanical 4-wheel brakes

Torque-tube drive



Five-bearing surface steering gear

Controllable-beam headlights

Balanced wheels



Air filter



Oil filter



Gasoline filter



Thermostatic circulation control

Automatic heat control



Vacuum ventilator (no oil dilution)

Spark plugs sealed against water

Engine mountin s of resilient rubbcr





 

 

 





.-———V





II? '

/ Kg“ .‘1 .





 





 





 





9—376





15 o. 6. Factory





-bu 8 true Buick

quality and all the

famousBuickf





eaiures





Study tbz's list of unrivaled [





Quality Features —





I 1 1





rec — and automatically lubricated





0th from an rear





 





, i L





 





:A

a")

\‘Q-}





   





Series 1 r 5 five- assenger two-door

Sedan—an idea carfor eneralfam-

ily use. 31 195 f. o. b. lint. Mich.





WHEN BETTER AUTOMOBILES ARE BUILT, BUICK WILL BUILD THEBI





 





 





Come to





Canada





Opportunities in every



branch of farming, in all



parts of Canada, are de-



scribed in illustrated



literature sent free on

request.





MAIL THIS COUPON TODAY

To nearest Canadian Government Information Bureau:





Detroit. Mich—F. W. Kerr. Dept, 8-39. 10 Jefferson Ave. E.





len .mld m: fru Illustrated Broiler: an Farm Opportunitiu in Canada.





NAME .......................





I Hi‘} ADDRESS ...................................................................................................





 





_5_Q

PER

Samples Sent Free—Wonderful Bargain. Scariflg‘llbv

cleaned White Blossom Sweet Clover. Makes wonderful

ture. Unsurpassed for fertilizing. Excellent for hay.

rite for free samples and a ecxal low prices on beat

lweet Clover Red Clover, Alta fa. Timothy and other

ll‘ieldlileeds. Our-prices lowest yet. 52- age catalog

_.. u: all field Seeds. Investigate gweet Clover now.

American Flold 899d 00.. Dept. i231, chloago. Ill.





 





 





 





 





 





PAY BIG-"EASY TO KEEP



We will tell you how. Write



today for handsome free book-



let. Tell us if you keep hers.



now. Here is a bargain:



,Gleanings in Bee Culturc.monthly mag—



azine. 2 years, $1.00. "Starting Right



With Bees." a book with 128 pages.124



illustrations. and Gleanings in Bee Cul



ture. 2 years. both $1.50. These will

absolutely teach you beekeeping.



l The A. l. Root Co., 613 Liberty 5... Medina. O





1 Did You ’ DAY?

”An-25w "





l

l

l

I house Pal-Ito. Vamlalloo Sums. Brushes.

} ace. Factory to user! west. prices—big





 





 





 





commissions — easy pale-I Paint salesmen

make the big manor-season just starting. I

Writp aulck for our wonderful new III. DIN-I-



INT 00.. Dept. ”0 b -

an, at.





LIBERTY PA

66“: l; 80. Nan-I’m

,. fi “va0: ,4
arc v.5. DA? on





TILLAGE IMpLEMI—zm's





For Horseand Tractor?





.) 1"





   

 





- Tractor Dis‘ci Half-03:



HE dollars you spend for Rod- 32,;‘3:2:‘o..“’ .

erick Lean Harrows buy more ‘



in quality—more in long life. more thorough work. more conveni-



ence of operation, than any dollars you can ever spend for ordinary





barrows.





60 years spent in specializing in har-

row making are your guarantee that

Roderick Lean Harrows are better than

the average-not “just barrows."





And they cost you no more than ordi-

nary harrows. The entire output of

our huge factory is confined to har-

row and cultivator manufacture—thus Spike and Spring Tooth Barrows. built

costs are lower—quality higher. especially for the Fordson.





The RODERICK LEAN COMPANY, Mansfield, Ohio





W not et the most for the money

yoil‘ry open?” Insist that your imple-

ment dealer give you ormation on

Roderick Lean Harrows. If he cannot.

write us.





Fordson Owners: See your Fordson

dealer about the Roderick Lean Disc.





 

 

   

 





 





W a.

J.- m!.“.—9"5

1-; -‘.,'!";.".'_-!",""'





 

 

 

 





 





1‘ i ‘ " _ ,3

. “ I. urine.

= "filing” 7,





   

   

 





 





 





 





   

 

   

 

 

 





Spike Tooth Barrows.

Ten different types. for

every condition.





Spring Tooth Har-

rows. Elghtkinds. Al-

1!? I!“ sonpeclal alfalfa and





ii“: ' up: quack grass barrows.





 

   

 

 





 

   





 





 





Horse Disc Harrowe.

for field . orchard and

vineyard.





_ 1'





 





IMention The Michigan Farmer When Writing to Advertisers

h i 0 hi [9]





 





 





Work this Out Yourself





Here’s how you can pay for a new planter.

Suppose your land will grow 50 bushels of

corn per acre, planted in 42 inch rows.

Now if, because of an inaccurate or worn

planter—you miss only 6 hills out of each

hundred, then you’ll lose 3 bushels per acre

at harvest time. At 60¢ a bushel this loss is

$1.80. On a 40 acre field the loss will more

than pay for a new Black Hawk Planter.





The Black Hawk drops seed in every hill

--it puts exactly the right number of ker-

nels in each hill and checks the rows per-

fectly so cultivation and harvesting is easy.

Made in either check row or drill type.

A Black Hawk pays for itself and you

have the planter at the end of the year.





The Ohio Cultivator Co.

Bellevue, Ohio





mom‘omohiohiohiomomoniomoh;





3’0-‘30w30w30“JO—~30-30-30-3’O-3'O-3





 





' iJ'O-iSO-CSO i-D'O-JO-fiO-D'O "30"30-‘30-‘3'0”30730-3





       





 





 





THE MICHIGAN FARMER





 





MARCH 17, 1928 '





 





News and VieWs

From IN'GLESIDE F ARM—By Stanley Powell





 





IGHT per cent on your capital in-

vested! ll'ould you feel fairly

well satisfied if at the end of the



coming crop season your farm ac-

counts would show that you had paid

all operating expenses and could de-

clare yourself a dividend of eight per

cent on the capital which you have

tied up in your farm in the form of

real and personal property?



But why do I ask you if you would

be satisfied with a net profit' of eight

per cent? Well, I’ve just been glanc-

ing through an attractive little pam-

phlet received through the mails re-

cently from one of the big meat pack-

ing firms. In the address of the presi-

dent of this company delivered to the

shareholders, we note the following,

“It is a satisfaction to report that the

affairs of our company are in good

8 h a p e, e v e n

though we are un-

able to show as

large a profit as

we have for the

past few years.

Our results are

not good enough

to brag about nor

bad enough to

cry about. We

shall not be satis—

fied with this in

years to come, as

we should be

building up our surplus to a larger

degree from time, to time.”



Turning to the balance sheet of this

packing firm for the past year we find

that the company declared an eight

per cent dividend on its $150,000,000

of capital stock and in addition added.

a tidy sum to its surplus, which now

amounts to $73,326,702.16.



Read These Bold Words



But not only is the president of the

firm sadly disappointed over the poor

showing of the company, but the

treasurer seems to regard the past

year’s results as very unsatisfactory.

However, he is determined to improve

conditions. Observe his sentiments:



“You have heard of the man who

said his wife had ‘enjoyed poor health

for a number of years.’ Well, we

don’t propose to endure (much less to

enjoy) poor returns for hard work

and hard-earned capital. We will not.

stand and let the world go by. 'We

will ‘go after’ the markets of the world

until they stop and listen, for we have

a message for them of good goods at

fair prices and they will ‘stop and

shop!



“We do not propose giving our

labor to barren fig trees or our hard-

earned capital where its assistance is

not appreciated in the returns.”



Ah, brave words are these, and

manfully spoken, but oh, how much'

better they would sound to me if they

were uttered by the loyal membership

of a. powerful and effective organiza-

tion of farmers. Isn’t it about time

for us to say with emphasis, “We will

not stand and let the world go by.

we will ‘go after’ the markets of the

world until they stop and listen . . .

We do not propose giving our labor to

barren fig trees or our hard-earned

capital where its assistance is not

appreciated in the returns."



A Half Bushel of Sparrows



But now to get back home to Ingle-

side. I guess I never wrote anything

about my experience poisoning the

pesky English sparrows that were

making such a. nuisance of themselves

all around the farmstead. Well, I

mixed a batch of wheat flavored with

strychnine, put a few kernels here

and there on window sills and other

places where the sparrows would be

likely to eat it, but where it wouldn’t





 





endanger the live stock. I’ve picked

up a half bushel basket of dead spar-

rows and haven’t any idea how many

more there may be that have crawled

into various hiding places or have

been eaten up by our cats.





A good many folks have inquired

about that old mother cat that ate

the army of mice at one sitting when

we were rebuilding the horse stalls.

She’s very well, thank you. I don’t

like to have her or any other cat

chewing on a sparrow that has been

killed by strychnine, but though I try

to keep the dead sparrows picked up,

the cats have more leisure for this

chore than do I.





If interested in this matter of trap-

ping or poisoning English sparrows

write for Farmers’ Bulletin 493 of the

United States Department of Agricul-

ture, Washington, D. C. There are

many ways of mixing the poison this

bulletin recommends.





This is rather late in the season to

be giving this advice as the poison

in most effective just after a heavy

snow storm when the usual feed of

the sparrows is covered. This time

of year care should be taken not to

poison song birds. lli‘robably the Eng-

lish sparrows have our feather friends

driven away from the barnyards so

that there would be little "danger of

harming any good birds by poison

spread near the barns.





Do Bird Liee Bother Cattle?



Several of my neighbors who are

good stock men insist that cattle get

their lice from straw in which lousy

sparrows have roosted. I inquired

from the Entomology Department of

the M. S. C. as to whether or not this

were a fact and received the answer

that it would be “biologically impos-

sible.” However, just to settle the

query a little more definitely they

suggested that I send in a few

samples for identification. With some

difficulty I lassoed a. few from a white

heifer and sent them to the college.

In a few days I received the following

interesting letter from Mr. R. H.

Pettit, Professor of Entomology:



“The specimen arrived this morning

and Miss McDaniel identifies it. as

Trichidectes scalaris, the common

biting louse of cattle. “'9 find perhaps

as good a dust as any to be made of

equal parts of powdered Naphthalene.

tobacco dust, and flour of sulphur. I

would dust this on the animal and

rub it in a little with a brush.





“This louse works on cattle alone

and could not possibly come from

birds, poultry. or any other animal.

It is the louse usually found on cattle

and the only reason that we do not

recommend a dip of Kreso or Zeno-

leum or something else of this nature.

is because of the danger of causing

the animals to catch cold, if used at

this season of the year.”





The professor is probably right

about the danger of dips and sprays

during the winter months, but our

cows have been washed with dip

twice this winter with no noticeably

bad effects. They still have a. few

lice. I hope to get them doped again,

either with dip or powder, before this

appears in print. '



The new tractor hasn’t been de‘

liver-ed yet. The old one has worked

well On the buzz saw lately. It was

always pretty dependable on the belt,

but was rather unsatisfactory in the

field. ‘





With us it has been an unusually

favorable winter to keep the manure

drawn out. A manure spreader is cer-

tainly a great invention. As a. .the

and labor saver, few tools are more

valuable on a. live stock farm. i:





new... .- .3 , _





«W...
n.--w1~ ._...





 





 





 





 





 





 





 

 





 





 





 





   

 

 





 

   





‘ deposit eggs.





MARCH 17, 1928

BEES HELP'THE FRUIT GROWER





(Continued from page 371)

planted as permanent trees in large

blocks. The filler trees in many of

these orchards are generally such

early bearing varieties as Wagener,

Jonathan, Wealthy, or Grimes Golden;

which serve as pollinizers for the per-

manent trees.





The complete removal of all the

fillers in many such orchards would

eliminate the pollinating variety. Sev-

eral of these filler trees should be left

on each acre even though it should

cause a crowded condition in parts of

the orchard or necessitate the re-

moval of some of the permanent trees.





Pollination

Orchards





In young orchards recently planted

in which pollinating varieties are en-

tirely lacking, the most convenient

means of providing pollinizers is to

top-work. every fourth tree in every

fourth row to another variety. Occa-

sionally cross-pollination can be pro-

vided by planting the va’Cancies

caused by trees dying out to a pollin-

izing variety. A variety planted as a

pollinizer must have a blooming sea-

son that overlaps that of the variety





Providing for in Young





it is intended to pollinate. i





“Bouquets” In Mature Orchards

In orchards of mature trees, where

it is suspected that fruit setting is





 





limited by lack of pollinizers; top:

grafting as was suggested for young;

trees is the most permanent means of:

insuring pollination. Until the grafts|

start blossoming “Bouquets” of mixed

varieties (pollinizers) should be placed I

in buckets of water hung in the trees,I

or placed in tubs of water ten to?

fifteen feet in front of colonies dis-:

tributed throughout the orchard.





Making a Stubborn Orchard Bear





Early last spring there came to my

attention a. Northern Spy orchard lo-

cated near Belding, Michigan. 0. W.

Braman, its owner, informed me that

the yield from the eleven acres set

solid to Spies had never been over

1,000 or 1,500 bushels any season dur-

ing the past eight years. Practically

all apples had been harvested from

the north side of the block where an

old home orchard of mixed varieties

stood close by.





In 1925 it was thought that lack of

insect. activity was responsible for the

unproductiveness of a south half of

the orchard. A yard of forty colonies

of bees was established in the orchard

but this did not materially increase

the yield. In 1927 “bouquets” of Ben

Davis, VVagener, Rexbury Russet, and

Tolman Sweet blossoms were placed

in tubs of water in the bee yard.

About forty more half barrel tubs

were filled with “bouquets” and scat-

tered through the south side of the

orchard“. Bucket “bouquets” were

hung in the trees. Six additional

colonies of bees were moved into the

orchard for the blossoming period and

substantial “bouquets” placed about

ten feet in front of them. What were

the results? “Bouquets” plus bees did

the trick. A 5,200 bushel crop was

harvested.





 





 





GROWING PLANTS UNDER

CHEESE CLOTH





OOD use can be made of cheese



cloth for protecting tender plants

against frost and cold winds during

the spring months. Several kinds of

vegetables can be grown under such

covering when it would be unsafe to

trust them in the open.





Protection against the cold is not

the only advantage in using the cloth.

It keeps out many insects. It seems

that the adult insect is guided by its

eye in search for suitable place to

The cloth conceals the

plant and thefly is deceived. Many

growers of’vegetable plants who have

become discouraged through repeated

failures to grow certain things should





'





 





”ma-.423





AMERICANS SHOULD PRODUCE'THBIR OWN RUBBERW





try a strip of cheese cloth stretched

along the row and a few inches above

it, high enough to give the tops room

for growing.





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





 





lTHE MICHIGAN F‘ARMER 11—377





 





All the scientific skill and creative ability of the world’s larg‘

est organization devoted exclusively to tire building enter

into the manufacture of Firestone TireS. Engineers, chem-

ists, designers, and the thousands of stockholder—employees

are pledged to maintain the Firestone ideal of “Most Miles

per Dollar.”



The Firestone Guvaipped Balloon is their supreme achieve-

ment—recognized as the quality standard of the industry.



Firestone advanced the science of tire building many years

by developing the Special Gum—Dipping process by which

every fiber of every cord in Firestone tires is saturated and





insulated with rubber, minimizing friction and heat and

adding many extra thousands of miles.





With world-wide facilities for controlling raw materials

at the sources, and direct distribution only to regular tire

dealers through 149 Factory Branches and ‘Varehouses,

Firestone eliminates middlemen’s profits and assures fresh;

clean tires to motorists everywhere. Firestone Dealers-—

specially trained at Firestone Tire Repair Schools and Edna

cational Meetings and with better service facilities—give

valuable assistance in securing longer tire mileage and

lower car upkeep.





MOST MILES PER DOLLAR





     





 





COURIER

-—low price; carries Standard

anufacturera’ Warranty.





OLDFIELD

—built according to Firestone

long mileage principles.





FIREST ONE

—the tire de luxe; Gum—Dipped for

extra strength, stamina and mileage.





AIRWAY





—a good tire at a very low prices

designed for the light car.





SEED CORN





Wing’s Improved White Cap still holds_0hio State

test 'eld. Other varieties also.

$322: {giralfilyegield gods. Moderate prices. Write





' l ’ ' .. (.321 Mechanicshuru. (Jilin

Spinach, cauliflower, lettuce, radish- Chas. 8. “III Seed 60 Ben .





 





es and some other vegetables do not





 

 

   

   

 





to the Bone





 





Try a Michigan Farmer Liner





 





 

     





. ' -' . . _ on Farm Lawn Fence

giow u e11 during the-hot days of sum Steel Posvts, Wire.Pamté

mer. A strip of thin cloth protects andRooflnz- summed. 12- KINKADE GARDEN TRACTO

. . “3‘24 hour A“ Kltselman and Power Lawnmower z» .

them from the drivmg rays of the Fence now SUPER-Galvanized with ’





sun and keeps the ground cool and

moist. The difference between the

surface thus protected and that left

exposed can readily be detected. The

little shade, although thin, is suffi-

cient for the protection of a crop that

can be made use of. And besides this,

the growth under cheese cloth is more

rapid, and maturity is hastened. Tests

have been made that showed a gain

of a week or ten days, and that means

much to the one who takes pride in

an early garden.





The market gardener, however,

finds this method of growing his pro-

ducts rather impracticable, the ex-

pense is too great, the covering will

last only for one year. But with the

home garden this extra trouble and

expense-is not the consideration—-

V. M. C.





 





Indians of North America. made





mirrors out of mice. J





 





99 94-100 percent

ity; as on TELE o



tory Prices lowest in years. WE PAY ‘l' E FREIGHT.

You save. Don’t. delayi Write today for REE Catalog!

KITSELMAN BROS. Dept-278 MUNCIE, INDIANA





e zinc same qual-

w





 





ire. Fae.





   

 

 

 

 





A Practical, Proven Power Cultivator for ...

Gardeners, Suburbsnitcs, Truckers. ‘ ,





   





Florists, Nurserymen. Fruit Growers. ‘lflj—jly ,

American Farm Machine Co.. ' " *2





 





 





1003-33rd Av. S.E.,Minneapolls.Minn. ‘





   





Mention The Michigan Farmer When Writing to Advertisers





 





 





 





 





Full Weight,





Galvanized—

assure: economy,

utility and endurance!





 





 





 





iilllIlumlmimmllllt_





   





innmunnnnmlt





ear mum PLATE commune-mu 046mg, .. .K .. g, , .. Rn. .





And Apollo-Keystone Copper Steel

RUST-RESISTING Galvanized





Roofing and Siding





For lasting service and fire protection use metal roofing

and Siding—adapted to both rural and city properties.





Aroma-KEYSTONE Galvanized Sheets(nlloycd with copper for mn-reaismncehlves

maximum wear and umiscnon. Sold by leading metal merchants. KEYSTONE COPPER

513m. in llkCWlIc cancelled for Roofing Tin Plus: for residence. sud public buildings.





AMERICAN S





 





Send for "Burma BUILDINGS"





liImimmmmnmnll..





 





for roofing. uidinz. mitten. mnt- ‘

ing. [ruin bins. tanks. culverts.

flames. and all sheet theta} uses.
33182—12





 





Larger Yields Per Acre Mean

MOKE MGNEY for YOU!

Fertilizer Makes Earlier— Eager Crops '

Youroost per acre for land, taxes, seed andevenlabor is about





the same for grwing a twenty





fleecost ofgroWing-perbushel islessfor the big-crop andas i





a result you make extra profit.





In Darling’s Animal Base Fertilizers part of the mittogen

is available at once and feeds the plant during early '

growth. The remainder of the nitrogen is sup.

plied gradually and feeds the plant through-

out the season. This gives the plant a





quick start and





steady,

sturdy

growth





 





 





 





4201





Superphocphate

{Formerly m Phosphate]



is nmde by special process. Super-



phosp‘hate made this way is better



because it mntains less free acid



and less morsture.



This gives our Fexfilizer mixtures

better handling qualities and they

do not clog in the drill. Our new

million dollar plant is the only one

in the middle west using this spe-

cial process.





Write today for literature on Darling‘s Fertiliser

and information about our agency proposition





DARLING 8 COMPANY





 





bushel crop as for forty, but Your





 

 

 

 

 

 

 

 

 

 

 

 





.car, have access to his granaiy,

‘ chicken coup, dwelling, and other farm

buildings where valuable property is

stored and also to his safety deposit

box in the bank and the strong box

holding the family valuables. In fact,

. the keys on the farmer’s key ring are

the means of reaching practically all

of his personal property.



The Michigan Fuhrer Protective

‘Service is designed to protect the

farmer’s keys as well as his personal

property from theft and his farm

against trespassing. This is done

~ through the registered key tag which

goes to every member of the Mich-

igan Farmer Protective Service.





’.





*0





 





 

 

 





 

 

 

 

   

   

   





newness-u was 1“

. no cum mu. a: SEI’I

V Emotn uA-muc'tms MIE

3.10 we urn-«mu Tl-RI'ER

DETRD'ILIl-CN.





em. 20

S. Ashland Ave., Chicago





 





 





It works in this fashion. John





 





Smith of Dowagiac, Michigan, Route





 





 

 

 

   





 





9 s . mem ershi in the

xygwl‘ @5st0.! 9.9% 04 9530-11 9539" No (itakes out a b . p .



vac of“; «rod. $06. v'" Ask Mich1gan Farmer Protective Sermce.



"‘ _ ‘1‘ so” $33334 Besides receiving his membership



wring-“forth certificate, bearing his name and re-



anawe . . . , - .



Anewquestion gistratlon. numbei, a metal Protectlve



eve month— Servrce Sign, a Horton Trespass warn—





f°rm ing sign, he also receives a key chain





and tag which contains a serial num-

ber recorded in the Michigan Farmer

offices. This metal tag has a repro-

duction of the Protective Service sign

on one side and instructions to any

finder advising that upon returning

the keys to the Michigan Farmer he

will receive a reward.



If John Smith loses his keys the

finder will be moved to return them

to the Michigan Farmer for one of





 





 





paring our com insures germination and vigor.





PAUL C. CLEMENT, -





 





 





REGISTERED and CERTIFIED SEED CORN





Clement’s White Cap Yellow Dent, Picketts Yellow Dent and Michigan Yellow Dent

(a very early dent), Certified Worthy Oats, Two-Row Barley and Sweet Clover Seed.

Why take a chance on common seed when our scientific method of drying and pre-





Member ofthe Crop Improvement Association.





three reasons. He may do this be-

cause he is honest and wishes to do

,what is right; or possibly to secure

___i the reward offered; or he may choose

to do it out of respect for registered

property which it would be unwise to

have in one’s possession when accom-

panied with instructions on how they

may be returned to their rightful

owner. This plan multiplies a thou-

sand times the chances of 10st keys





a].—





Thls Shows Both Sides of Registered Key Tag





 





 





 





By E. A. Shearer

Manager of Protective Service

_ - EYS are small, but to the farmer,

they are very important prop-

erty. With them he can use his





being returned. When received al the

Michigan Farmer offices, the regis-

tered number enables us to return the

keys promptly to the owner.



It will be observed, therefore, that

this registration of membership and

the 1 3y tag is a. valuable part of the

Michigan Farmer Protective Service.

There is, however, an additional use-

fulness that presents a real human

feature. How many times do we rush

off in a hurry to some city or town

twenty-five or fifty miles distance from

our home, leaving behind all means

of identification. We know who we

are, where we are from, and where

we are going. Thus it may seem of

little importance to have any means

of identification on our person. But,

at the coroner’s court or at the mor-

gue in any of our large

cities, one can be thor—

ough-1y convinced of the

need of always carrying

upon his person a

means of identification.

Scarcely an issue of-ihc

daily press passes with

out recording 5 omc

accident on how some

person is rushed to a.

hospital in a critical

condition and in a state

of coma, separated for

days from friends and

relatives for lack of

identification marks.





The key tag about which we have

been writing serves this purpose. By

communicating with the Michigan

Farmer offices and reporting the regis-

tered number on this tag, the name

and the address of the owner can be

quickly determined. This is particu-

larly true with respect to the automo-

bile since one’s keys are necessary to

motoring and the tag would quickly

come to the attention of those who

are rendering first aid.





This feature of the Michigan Farm-

er PrOtective Service indicates how

carefully this whole program has been

studied to give the members the ut-

most of property and life protection.



The coupon below is published to

make plain to our readers how they

may become members of the Mich-

igan Farmer Protective Service. Sim-

ply follow the directions given in this

coupon and you will be entitled not

only to the service mentioned above,

but also to the protection against thr-

theft of farm property as outlined on

membership certificates, and also

against the trespassing upon your

premises as provided in the Horton.

Trespass act. Simply fill out the cow

pon below and mail as directed.





 





Write for Circular and Sample.





Britton, MiChc, Dept. B E. A Shearer,





 





 





1632 Lafayette Blvd., Detroit.





 





Please Mention The Mich-

igan Farmer when writing to

advertisers.





 





SENS A110 One of the most productive

' oats in cultivation. 75:

ha. and upward per acre are frequent with

Sarge white meaty sins weighing 44-46 lbs.

per measured bu. ogrthe highest quality. We

are making an exceptionally low price in quan-

tities. You should bfiail 1118qu try thgse “921:8.

l 1 - , r- are e an 0

SEE” 00“" any Exec nt 'ylelders





and never fall to ri :1. Choice seed .as low





es 32.75 bu. Also bar cy. grass seed. ,mytbeana.





 





etc. Write for circular and samples.

Melrose, 0. j

I





Theo. Burt & Sons 45





Dear Mr. Shearer:





SHIP YOUR

DRESSED clCALVES





LIVE lion“

BERG" BEEF COMPANY:





Oldest and most reliable commission house 3





in Detroit. Write for new shippers' guide, i Name . . . . . . . . . . . . . . . . . . . . .

shipping tags and quotations. . .

Detroit Beef Company, P. O. ..... .





19% Adelaide St. Detroit, Mich. .





 





 





Manager, Michigan Farmer Protective Service,





Enclosed find twenty-five cents for which enroll me as a member

of the Michigan Farmer Protective Service and send me the weath-

er-proof, steel Protective Service Sign, the Registered Tag and

Key Chain with proper r€gistration in your Detroit offices, a signed

Membership Certificate, and a. Warning Sign carrying the announce-

ment of awards for capturing thieves and trespassers.

closing the stencil of my address from the Michigan Farmer

showing that I am a boni fida subscriber to that publication.





cooIeeeeoeeeeeeelee-Cecene-oe-eeecame oeuo:o'.oo.-DOOQ.





1am on-





...R. D. .





coyote-eel...-
MARCH 17, 1928





 





THE MICHIGAN FARMER





, Radio Increases Milk Production





Prove: T flat Contented





COW! Give More Milk





By Clare Bloss '





issue of March 3rd in regard to



farm radios, I believe the readers

of the Michigan Farmer may be inter-

ested in a radio I have in my barn

and the results from same.



I have a herd of twenty pure-bred

Jerseys and a year ago I made— a

radio to place in the barn, from spare

parts left over from building other

sets to sell. I not only put it there

for my own pleasure but as an experi-

ment. And it surely has proved a

profitable~one for me. I was milking

eight cows at the time and these eight

cows under the same care, feed, and

water as the week previous, produced

seven pounds of butter more the next

week, and they never dropped back.





Milk is made while you are milk-

ing and the mental impression that

the cow has while you are milking,

determines the quantity of milk. Milk

production centers around the nerves

of the cow and the nerve center starts





SINCE noting your article in the





 





 





.The Loudspeaker and the Milkpail Go

Hand in Hand on the Bloss Farm





at the head. The mental impression

of the cow determines milk produc-

tion. If anyone doubts this hit the

cow you are milking over the back





with the old three legged stool and'





see her hump up her back and hold

her milk.





No doubt you have read where

music has been used to quiet the

nerves of a patient being operated

upon in the great hospitals of the

country. In just the same way the

music from my radio makes the cows

quiet and contented and they give

more milk.



This herd of Jerseys has been high

herd and high cow for Genesee

County No. 2 C. T. A. two years in

succession and they were high herd

for the state one month.





Of course, there is a great deal of

pleasure for the person doing the

chores in the barn. The night of the

big feet ball game in California, I was

milking cows in Michigan at six

o’clock at night by artificial light and

listening to a game being played two

thousand miles away at three o’clock

in the afternoon, and getting every

play as I put an extension cord on

the loud speaker and put it behind the

cow I was milking.



The set is only three tubes and the

“A” Battery lasts a month and the

“B’s” a year or more so the expense

is nothing when, compared to the pro-

fit and pleasure.





NEWS FROM THE AIR





 





VHE identity of “the Old Stager"

who presides over the destinies of

the Philco hour presentations of must-

cal comedies and operettas has just

been mended after months of strict





 





secrecy. He is Henry M. Neely,

newspaper man, music critic, and

magazine editor, born in Philadelphia

in 1878 and when the war broke out,

went overseas with the Y. M. C. A.

Ralph \Ventworth, veteran radio an-

nouncer, is an enthusiastic gardner

and is now hoping for the snow to

melt in order that he can get his daily

dozen on his “New Jersey Farm.”





 





 





During his recent morning pro

grams, Walter Damrosch confessed

himself in doubt as to the correct pro-

nounciation of “Iowa.” A few days

later, letters and telegrams came pour-

ing in from the Middle W'est but, it

turned out, that not even Iowans them-

selves agree on the pro’nounciation. A

letter from a newspaper man in Des

Moines declared that the majority

called it “l-uh-wuh," rather than

I-O’wa or I-O-way. But according to

an article forwarded, the Indians who

lived in this district and gave their

name to the state were called Ioways,

and the efforts of early French and

English settlers to spell the name, sup—

port the correctness of the final “ay.”





SAD BUT TRUE





 





Smith: “How many controls are

there on your radio set?”



Jones: "Three. My wife, my daugh-

ter, and my son.”





. ., .m.-..‘. m. 1.. -....... H > .... , ..





, humans-m mahsqummmm - » " 'm *' »'« 29‘... A’ ‘M..gwchgg.~;"W

‘ ' w -H... » a" - ”mu—En...._.‘L..,,-,.m.l.va...-.. ”Mg...“ -. aw“.-- ,_,- . ,.. u .._..,_,_H__,_ . .‘n





.13: 3:9





 





Like MAGIC





for

VEGETABLES @





IME to be thinking of next season’s vegetable



crop. Would you like to make more money on

your truck? There is one sure way to do it . . . fertilm

ize with Chilean Nitrate of Soda.



Nitrate of Soda is magic on vegetables. It gives.

them an early start . . . brings them through bad

weather and other adverse conditions . . . makes a

bigger yield and a better one in every way. Crisp,

tender, juicy vegetables that bring top prices.





Fertilizer Information

FREE—Our new 44-page book, "How to Use Chilean Nitrate m

Soda”, willbe sent to you free, on request. Tells how and when





to fertilize all crops. Please ask for Book No. I, or tear out

this advertisement and send it with your name and address.





.' Cbiiean

Nitrate . of Sofia





EDUCATIONAL BUREAU





55 East State St., Columbus, Ohio





 





Please direct your letter to Del); 15-C





 





 





 





 





'i‘t’rr’ '





 





 





 





IN 13 MONTH





00.





NEARLY A Million:

MEN HAVE CHANGED

To CHESTERFIELD !





 





MY SATISFY





and yet THEY’RE MED





AND HERE’S WHY:





WE STATE it as our honest

belief that the tobaccos used in

Chesterfield cigarettes are of

finer quality and hence of better

taste than in any other cigarette

at the price.



beam & Mun: Tonococo.
380—14





 





_ , ’-





 





fr " Wa unload





,Fercilizcmr $1S19





The most expensive fertilizer ingredient is nitrogen, but you don’t

need to pay a high price for all your nitrogen. Red Clover,

Sweet Clover, Alfalfa and otherlegume crops can secure free nitrogen

for you out of the air and convert it into plant food form, providing

they have present in the soil plenty of live root-nodule bacteria of the

right kind. Each different class of legume crops requires a different

type of bacteria. Inoculation of the seed ensures a supply .

of the right bacteria, and makes certain the addition of

the greatest possible amount of nitrogen fertilizer to the

soil. Your experiment station urges inoculation. ‘





Nod-O-Gen Inoculation the Greatest Fertilizer

Bargain—Nod-O-Gen Inoculation is a pure culture of

vigorous nitrogen-gathering root-nodule bacteria—the

right kind for each crop. It is prepared on special food

jelly in patented stopper bottles that furnish air,

food and moisture, thus preserving the life and vigor of

the bacteria indefinitely. Every four-acre size bottle

of Nod-O-Gen contains over 500 million live bacteria.



A bottle of NOD-O—GE‘N costing only $1.00 will inoculate

4 acres of Alfalfa or Clover and enable the plants to secure 400





lbs. of free nitrogen from the air equal to 2800 lbs. of nitrate of

soda, worthover$100.00. NOD-O-GEN isa 100 to 1 investment.





NOD-O-GEN INOCULATION is produced in the soil

{laboratories of The Albert Dickinson C0., and sold everywhere

by dealers who handle Dickinson’s “PINE TREE” Farm

Seeds. If your dealer doesn’t have NOD-O-GEN, mail the

coupon below with a dollar bill, and a four-acre size bottle of

NOD-O-GEN will be sent you at once, postpaid.





THE ALBERT DICKINSON C0., Box 788 13, Chicago, Ill.

Please send----four-acre size bottles of NOD-O- I





 

 

 

 

 

 





NOD-O-GEN

A UN cullureof

‘NODULE racism





For lnoculaiing





   

 

 





 





 





 





6“ 7% GEN for (name of cnop): ....................... to:

Name .............................................. I

R. R. or Box No ................................... I

hum Town """""""""""""""""""""""" I

V. ‘ (Be sure to specify name of crop to be inoculated) I





 





 





 

 

 





I c H I c. A N



"crate SI [05 ' ‘

AV E



’Rlalfiidazzrc‘éi'iiiu'amu. iiidiii’dwg: :35?





future and erect tor you under best known

processes.





' Special Terms 1! You Orderflow! -

- ’ MICHIGAN sun to. Kalamazoo. Michigan





 





'KL—SIKP 93





AND TIMOTHY 3“-





45 lbs.. Bags extra 25c each 20 per cent clover.

The George W. Young Company. Owosso. Mich.





   

   

 





 

 

 

 





 





4.1:

4;





 





 





A Michigan Farmer Liner Gets Results—Try One





 





 

   

 





limestone





dollar





Here’s how—when you buy lime

you are really buying lime oxide (its

active chemical property), and this is what you get:



For $125.00 you can buy, on an average, delivered to your station,



25 tons Solvay Pulverized Limestone containing 12 ,12’ tons of limeoxide, or



9 tons Burnt Lime containing 7 54 tons lime oxide, or



10 tons Hydrated Lime containing 7 % tons lime oxide.

You obtain 66% more actual lime for I.your money when

you buy Solvay Pulverized Limestone}

Spread Solvay this year—note the bumper crops—and

you’ll spread Solvay every year!



. Write for booklet.

SOLVAY SALES CORPORATION



DETROIT, MICH.





 

 

   

   

   

   

   

   

   

 





 

 





 





%~

Sold by

LOCAL DEALERS





THE MICHIGAN FARMER





MARCH 17, 1938





 





 





Readers’ Opinions





 





 





 





, N a recent issue appeared an arti-



cle by G. E. C. which states that

farming was God’s

flicted on man for his disobedience.

I find this so contrary to my interpre-

tation of the story that I Wish to pre-

sent thc other‘ view.





While it is true that “God sent him

forth from the Garden of Eden to till





(Gen. 3:23) a very little study of the

second chapter of Genesis will at once

prove that the need of a farmer was

created. Genesis 2:5, in reviewing

the creative work, says,

was not a. man to till the ground”

showing that the job was here before

the man.





Again in the fifteenth verse we read,

“God took .the man and put him in the

Garden of Eden to dress and keep it.”

Here again is proof that Adam had

work as a. farmer before he sinned,

even before he was forbidden to eat

the fruit of the tree “in the midst of

the garden.”





Man was made for the occupation

rather than the occupation infliCted as

his punishment and perhaps if he had

been busily engaged at tending the

garden, his work would have prevented

those longing glances at the tempting

fruit.



So far as our being “inflated? over

our job, we, as well as any other hon-

est productive workman, should find

joy and contentment and share a fine

sense of pride in meeting well the

responsibilities of our agricultural pro:-

fession.



But let. no one attempt to humble

our farmers by calling our basic and

most necessary industry, a punish-

ment. An occasional inventory of the

advantages and blessings of farm life

and the confident assurance that God

wanted, had work for, and created

farmers, should surely make us all

better, more contented citizens, co-

operating with Him to ”dress and





Almy.





 





TRESPASS LAW WORKABLE?





 





AM in receipt of a letter from 'a





of conservation of this state comment-

ing on my article in your issue of

February 25. He claims that our new





ferior to the one we had previously.

In answer to the question of its work-

ability I referred him to a neighbor of

his that it cost $16.00 and a consider-





on my place without my consent this

last fall. ‘

We like the new law and regard it





easy of operation. No posting is nec-

essary in fact as long as it is up to

the hunter to personally cbnsult the

owner, it seems to me, posting is in-





on any hunter to show his hunting

license to the owner of property upon





are provided in case he refuses. I





 





' warrant.





never knew of his refusing. With his

name gained from the license in your

possession you make a complaint to

any justice and he will issue you a

Give the warrant to any

deputy sheriff or other deputy and in

the culprit comes. As far as I know

they all plead guilty, thereby saving

costs. For a second offense a. jail sen-

tence is manditory. This is a good

law, all the law we need with plenty

of teeth to keep the hunter where he





tion as it is possible to imagine any

law of being—A. B. Cook.





 





able amount of inconvenience to hunt .





as vastly superior to the old one and .





advisable. The law makes it manditory '





l





keep” His earthly garden—Clifton C.





trespass law is not workable and in- ,





A REPLY TO THE PUNISHMENT‘ .

’ APPLES





punishment in- -





the ground from which he was taken” '





a part. of the reason Why man was .





“and there ,





former director of the department »





 

 





SQUEEZE

DOLLARS

FROM





WITH

A





 





F ar-quhar

Cider Press





PREPARE NOW TO TURN CULLS

AND SECONDS INTO MONEY





Operate a Roadside Market





Apple Growers in your community will keep the

press 'busy through the entire season and you

will have a. profitable income each year. Built

in sizes up to 400 barrels of older per day—

for Roadside Marketing. the Individual 0r-

chardist and Custom Pressing.



New Catalog No. 126 just off the press. Write

today and learn how a. small investment will

reward you handsomely.





A. B. FARQUHAR C0., Limited,





30): 179 YORK. PA.





 





 





 





 





 





 





 





Pl... mayor meow-toasted.





 





 





2193 W We, nuns our! '0

mm M ”at. alumni. Mt.





   

 





 





 





 

   

 





“ ' on





.. ; TRACTION SPRAYERS

., ' ~ Write for catalog

-4 :34 and learn about

'1‘“?\ the many exclu-



ééé "-:‘~ sive features of

"" this fine sprayer.



"FRlEND" MANUFACTURING CO.

I 142 East Ave.. Gasport. N. Y.





 





 

 

 

 

 

 





FRUIT [TREES





Seeds—Berry Plank—Ornamental:

3-4 ft. Apple. 251:: 3-ft. Peach. 15o each post:

paid. Guarantor-d. stock. Farm. Flower and

Garden Seed. We have 600,000 Fruit Trees.

Ever-greens. Sheds 'Trees. etc. in fact,

our 1927 (‘atnlog has merything





 





for Ga. . Farm and Lawn. p

A-LLEN'S NURSERY . ‘ .

EE HOUS 1

. BOX 7. GENEVA. OH-IO fl 4

I-“ II: \





 





 





 





which he is fOund and stiff penalties =





belongs and just as easy of applica— _





. heats .Ar‘mc Connors for preparing :flne seed





. Nothing cuts. crushes. puli'erizes. and





 





“New Coulters Make

an Old Acme as

Good as New’ ’





I! you have an Acme Harrow or XL Cultivator

that's standing idle because the cmllters are worn

out Listen to this:



Your implement. dealer can furnish you with new

(pullers which will make your old Acme AS

GOOD AS NEW.



It makes no difference if your Arms is 30 years

old for present day Acme ‘oulters tilt Acme

Harrows bought since 1892.



And we don't have to tell YOU that nothing





Hillltlkflr and cheaper than any other implement.

levels dike

Lhasa sharp, double—curved Acme Connors.

(flip coupon for free Avmo (‘umlog It tells an

(attractive way to get rid of the corn borer.





--------—---——-—-_---—¢»-__—





RUSSELL & BECK SUPP-LY HOUSE.

17 Anon Street. Columbus. Ohio.

Send me free Acme analog described shove. '





 





 





 





 





 





.L \,,,._,/»





 





 





 





 





15.4%,»





may





. ca»? h. "-“5





 





. t. 4-1..” ‘ A.~.~&/

L"A<«.Ww ,.
5 They’re bobbing their hair and

' inventing new musical instru-

ments in Japan.





 





 





 





 





“The Spirit of Orange Juice”——Lindy’s plane

modeled in a new medium at theworlds

largest orange show in San Bernardmo, Cal.





 





If you lose, go right next door to the hock shop! .

going and coming in Borneo town, where one man runs a gambling

house and his neighbor a pawn broking place.





 





 





 





 





 





 





 





N ah-Nee-Num-Skuk,





119

old, never sleeps indoors or

eats cooked food.





years





 





 





 





 





 





 





President Machado and U. S. statemen, Hughes





ship Maine which led to Cuba’s independence.





 





 





3“» row .

.~;.,,« 4? w.» 3 '.





2r.





 





 





 





 





 





 





 





Eight-year—old Helmuth Lichter-





2 _. - 30.:





 





._ u.





feld breaks one-fifth inch





chain in bare hands.





 

 





 





 





the thirtieth anniversary celebration of the sinking of the battle-





and Fletcher, at This is





 





 





 





 





 





 





They get you Sum job! Mental phenomenon,





Fraeulein Alba adds six col-

umns of figures at same time.





 





 





 





 





Presho Stephenson and James Angel, experi-

enced aviators, will attempt to wing their

way around the horn of South America.





 





not a head-hunter’s collection—it’s a. display of masks





made by the famous artist, W. T. Benda, a leading exponent of

this type of artistry.





 





 





 





 





Thousands witnessed this plane crash on the busiest street in

Macon, Georgia, killing two pilots and one onlooker.

inJured as the sidewalks gave way under the great crowd.





Martin Jensen, famous Dole

pilot, is coaching fiveyeanold.

Jackie Walker to fly. '





Many were





 





 





 





 





 





Copyright by Underwood & Undtrwood. New York
«*7. 30“ was aw. W’s.- . .- .





mm, «a -p we}.





“.wc'rv < ram ..—._., :4





 





C

.- I“

1

h -.,x\\\\\\\\\





 





382-16





information Katie imparted.

“Has he told you so?” Mother

O’Neal inquired. “I thought they were

leaving tomorrow.”



“Maybe so, but not Bob,” was

Katie’s comeback, and she proved a

true prophet. In halting, boyish

Speech, Bob Barton had passed on to

his father the things that Burton had

told him. The older man had listened

in silence, Mother Barton sitting quiet-

ly by.



“It’s all true, son," Bradley Barton

had admitted, “but never before has

it been brought home to me. I’ve

never been a leader,” and there was

a note of pathos in Barton’s voice,

“and I reckon God Almighty doesn’t

intend me to be one, except as I may

be His instrument with a violin. But

you have been honored, and we are

proud. of you. Give the best that is

in you, son. We’ll call off that trip;

it wouldn’t do to leave you here

alone.”





“That was a strong conceit of Mr.

Burton’s about Mother Earth,” said

Mother Barton thoughtfully. “But it

is true. too. If Mother Earth has not

paid -us dividends, perhaps we have

overdrawn on her bank of tolerance.

This may be her year to pay back.”



“That field of ours is going to be a

glorious sight; when the ears set on."

spoke up Bradley Barton, “and even

now the rustle of leaves seems to tell

a story. Here’s what it will say to us

when work is done.” Bow swept

across strings, and Bob could hear

the sighing of wind, the vibrant mur-

mur of strong stalks deep—rooted to

withstand blasts. “ ‘Spirit of the

Corn’,” announced Father Barton. “It’s

time that someone wrote an anthem

to the King of Crops. Now when I

get around to it But first. I’m going

to help you ‘make the crOp.’ We’ll

get into the fields tomorrow with two

cultivators.”





As they went down the rows side

by side the day following Burton’s

visit. it seemed there was a new spirit

of comradeship between son and

father. Bradley Barton had put his

new-found interest into words, as to-

gether they had harnessed willing

teams and wheeled into action. “I’ve

heard a. lot about what a son owes to

his father,” observed Barton, “but I’m

just beginning to be taught. through

this club work What a father owes to

his son. Reckon if what Mr. Burton

has to say about your owing loyalty

to the club is true, it applies also to

me. Fight to win, Bob, and I’ll fight

with you.” \Vith new determination

and new respect. for his father, Bob

took up the grind again. Uncon-

sciously the entire family began to

measure the standard of home and

farm achievement by the high mark

demanded in completion of club pre-

jects. While Bradley larton still

lapsed into hours of idleness when his

violin called, the burden of overwork

was lifted from young shoulders. and

Bob could find time for play without

real neglect of farm or club activities.

Ross Burton had accomplished far





BOB’S not going to leave,” was the





 





‘THE MHfinGAN'





FARMER





 





 





Under the 4-H. Flag C





By John Francis Case





 





more on that eventful day than he had

set out to do.





CHAPTER XI '

Challenge and Combat





HEN the Pleasant Ridge club

VR’ folks gathered for their month-



ly meeting there was a self-

invited guest. Perhaps rumors had

been floating about, perhaps the de-

sire to whisper compliments into

Katie O’Neal’s pretty ears brought Hal

Carson. Anyway, he was on hand

evincing keen interest in Bob Bar-





“on” the ball, Bob’s pitcher allowed

such a riot of run-making in the first

two innings that the fagged farmers

were panting for breath. Pitcher

Henderson had distinguished himself

with two home runs. Now relentless-

ly Bob and his mates began to cut

down the lead, while their pitcher

tightened and, except for Burtou, held

the seniors safe. .





The game became a riot. After five

innings, with the score 15 to 14, O’Neal

begged for time. “Let’s call it quits,”

he implored. “Five innings is enough.





 





 





‘ WAS TED SYMPA THY

By Emerson O. Gildart '





“Poor little dried-up Christmas— tree!



Were you born to this, pray answer me?



Snatched from your snug native berth in the marsh,

Rattled to town over roads that were harsh,

Hawked in the street in the blustering snow,

Smiled at one hour, amid tinsel and show,



Then dumped in the alley, with trash and debris—

Was this your whole story, from A down to Z,



You poor little rag-tag Christmas tree?”





Up spoke the withered wee Christmas-tree:



“New don’t you waste any tears on me!



’Tis true I am done for—that’s plain to be seen;



My needles are brown where once they were green;



My day was a brief one, my even was wild;



But I put a new hope in the heart of a child!



My first-fruits of Christmas will ripen some day



When my ashes are scattered and mixed with the clay.”





And the mourning old hemlocks, so green and so tall,

Were ranked by a Christmas-tree, withered and small.





 





 





ton’s play as the club boys “warmed

up” for their battle with the dads.

And this time it bade fair to be a

real battle. John O’Neal, thumping

his big glove, yelled encouragement, to

his pitcher, a tall, muscular farmer

who at one time had won local fame.

The joke was on Bob and his mates,

for Jim Henderson, father of a poul-

try club girl, had kept secret the fact

that as Jim put it, he had “limbered

up the old soup bone.” On first base,

Ross Burton performed with the ease

of a born athlete, and in practice his

crashing hits had put fear into the

heart of Bob’s hurler. \Vith Carson

umpiring. the game was on.



Bob Barton was no fool. While he

gave his best to his team, he did not

uncover the bag of tricks which had

been perfected through long weeks of

toil. But Bob watched every move-

ment of the graceful Burton, absorb-

ing all that could be learned. Before

the game began he had called his

mates aside and given whispered in-

structions which brought shrieks of

laughter. “Wonder what those young

divils are cookin’ up,” growled O’Neal.

He was soon to find out. Putting little





But Bob reminded him that the elders

had insisted on a full-nine—inning

game, and the whole club team clam-

ored for the game to go on. “Take

your medicine, dad,” cried Katie

O’Neal, “you know what you told

Bob.” ‘





“Hundred to nothing,” grinned Bob

Barton. “Come on, fellows.” On base

by virtue of a sharp single, Bob-

promptly stole second, third, and

home. As he slid into the plate and

fell away from the Wildly stabbing

catcher, Ross Burton let out a low

whistle of surprise which was not lost

on Carson. No player on his own

team ever had “hit the dirt” like that.

As he called Bob safe, Carson fell to

wondering what was the best course

to pursue in furtherng his own ends.

But soon he had other things to think

of. Like an enraged bull, O’Neal was

charging down upon him——the umpire.



“Rotten!" yelled the dads’ leader.

“Rotten! He was out. Didn’t I fall

0n him?” I'ndeniably true, but as

Carson argued that Bob was safe,

O’Neal gave a magnificent gesture of

contempt. “All right,” said O’Neal,

“all right. We quit. What do you





addictive: of A! Array—Slim Say: Hi: M z'da’le Name 2': @99qu





\— .





lumen 17, 1928





say, fellows? Forfeit the game to ’em,

nine to none. All we’gotta do to beat

’em is keep on playin’, but we feel

sorry for the kids.” There was a

chorus of acclaimtrom the weary

dads. vAs they moved off the field,

O’Neal favored Bob with an expres-

sive wink. “Thought you were smart,

runnin’ us old ‘sprays' to death,” he

growled, “but we’ll get you yet. Get-

ting beat by nine runs isn’t so bad.”

With much good-natured joshing the

game broke up. As they were leaving

the field, Carson called to Ross Burs

ton and Ted Baldwin, ignoring Bob,

who, with his mates, was celebrating

victory. But soon Burton called the

team leader. As he approached, Bob

saw Carson flush in annoyance.



“Hal has challenged our 4-H team

to play VVarford High,” said the

county agent abruptly. “As you know,

they have one of the best school teams

in the state. Do you think we should

play ’em?” . ,



“I’m. only a substitute,” replied

Bob, “and I’ve never seen Warford

play. VVhat’s the real object in Car-

son’s kindness? Of course, he ex-

pects to win.”



“I know,” spoke up Ted Baldwin,

and there was intense feeling in his

voice. “I know,” Ted repeated. “Car-

son thinks his team can show up a

bunch of farmer boys and that play-

ing against you he can show you up,

too, Bob. It looks dirty to me.”



“None of that,” spoke up Burton

sharply. “Remember, Ted, that Car-

son is on our team. What do you

say. Bob?” '



“Play ’em,” replied Bob, and his

eyes flashed. “We may not win, but

we'll give our best. I’ll look out for

myself."



“You’ve got me all wrong,” put in

Carson smoothly. “It’s not so long

now until we play Harmon County.

They’ve a crack team, and you need

a real game to put you in trim. Why

should I want to ‘show up’ Barton?

I‘ve already done that and won the

place. No man can beat me out of a.

job at first base.”



“Don’t flatter yourself too much,

Hal,” cut in the club coach. “No man

on my team has his job cinched. You

are a better man than Bob today; to-

morrow he may ‘trim’ you. Individuals

count for nothing with me so long as

we play fair. It’s the team and a vic-

tory for Brown County that I‘m inter—

ested in. All right, Hal, you’re on.

Two weeks from today we play War-

ford High.”





Ted Baldwin was still muttering





complaints as the chums moved off

together. “That guy don’t belong in

our gang,” said the team captain.

“Wants to give us practice! My eye!

Eight men on that team have been

playing together three years. Got a

paid coach, too. Fine chance we got

to beat ’em.” Yet, despite these

gloomy predictions, Bob Barton’s

heart was joyful. Again he would

measure strength.



As he looked down upon the fine

gathering of representative farmers

with their wives and children, Bob felt



(Continued on page 387)





F rank R. Lee:





 





 

 

 

 

 





9LlM,'lT-IE OLD sAP





'5 0 Yo on. HAVE To CARRY

THE BUCKETS TODAY!





 





\\\ I ’





.4





WW/

‘/\L‘m'

I





'7.





 





 

 

 

 

 





BARREL HAS SPRUNG A LEAK





 

 





WELL, OLD Tm

HEAD,YOU'RE SONG



TO HELP YOUR

UNCLE SUM!





 

 





 

 

 

 

 





 





 





l





.' {:9





a





 





GANGWAY,‘ ’> ”\

f





 





   

   





>1: UH
4—-





 





WV'L’S“ AM» k.“





.V m-..) m





1‘“. v'q—n‘





->A





 





 





 





Offering all the power, speed

and stamina of an improved

valve-in-head motor . . . con-

structed throughout of the fin-

est quality materials available,

with precision methods of

manufacturing that are un-

surpassed . . . and with its

performance and dependabil-

ity proved by millions of miles

of testing on the great General

Motors Proving Ground—





—the Bigger and Better Chev-

rolet is designed and built to

deliver the strenuous perform-





ance a motor car must give

when used on the farm.





From the heavy, banjo-type

rear axle and the stronger,

sturdier frame . . . to the

powerful 4fi-Wheel brakes and

ball bearing worm and gear

steering mechanism—this sen-

sational new car is built to

stand up! Every unit of the

chassis is designed with a mar-

gin of over-strength that as-

sures faultless performance

under every condition of usage.

Nor is this strength of con-

struction confined to the chas-





 





~Proved on the World’s Greatest Proving Ground





sis alone—for the beautiful new

Fisher bodies are built of the

strongest and most durable

combination of materials

known to the body builder’s

craft . . . wood and steel, each

reenforcing the other!





The nearest Chevrolet dealer

has on display a complete

showing of the new Chevrolet

models. Go see them. You’ll

find beauty, performance and

high quality construction that

you never thought possible in

an automobile—at such

amazing low prices!





QUALITY AT LOW COST





CHEVROLET MOTOR COMPANY, DETROIT. MICHIGAN. Division of General Motors Corporation





The COACH $585





The Touring $495 The Imperial $715





or Roadster Landau - -





The 8 Utility Tru k S

Coupe - - 595 (Chassis Onfy) 495





The 4-Door 3 Light Delive S

Sedan - - 675 (Chassis onlygy 375





The Sport 3 All ricesf.o.b. Flint

Cabriolet - 665 p Michigan ,





   





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





""" t ‘ "5""A-t - ~ .. t..‘< ["7 I“;

* ”59..., eta-miatauxl«,4: “x" *' . ‘ A Z: *' -





_ v 2“,?“-
‘ We“.

\ , art, 3

.3 g’

.wa _

g??? »’

1 5”}

’ f if??? ,

1,5,1? 1

-.' l‘,

1‘ 3,11

1,?

e»

a}





 





 

     

 





/ V. \-

:,/ 73":‘II‘I ' fix,

\ if



'\ ,





Good light at the work bench





Q2176” I





makes repair jobs easy.





 





An electric motor takes the

heavy labor out of concrete

mixing.





 

   





‘ "._i , , .



.- x"“-I ‘

. . I j ‘ .-

. , a ,z' -.

7.5- .. ‘





k , . 3; .1 ' 7";

{h :“<’"- ( ¢A\;;-\

£13: ' r-





v).



,1

1,,



1)!”





This motor-driven painting ma-

chine does the work of seven

men.





It





No time lost heating the solder-

ing iron—electricity keeps it

hot continuously,





 





 





 





 





‘ , . ",i":~- I

r, " 4,

.I ,:i ,

r: "0:: I

w , w,

: ‘ k ‘

f , I. . v ‘

2,,

a. fi. I v

"to?

1‘3“

in? 1

, i":- ‘.

‘5}

*3 v an;

“RNA“ . ...‘ ‘T ggggg I MAVAN

M a.

“We ..

.. IM‘

‘ ’ ““‘Vm.





When Time

Means Money





HE standing wheat dead ripe; dry hay in the field.



and a storm predicted; the truck loaded for a quick

run to market —it is at times like these that broken

equipment can prove very costly.





In such crises, it is satisfying to know that a little

G—E motor is waiting in your machine shop, ready to

turn a grindstone, a lathe, or a drill press to make an

emergency repair.





This is but one of many ways in which G-E motors, con-

trol, and other electric equipment are adding daily to the

efficiency and comfort of farm life. The farmer who knows

electric equipment looks for the G-E monogram before

he buys.





Ask Your Power Company





If your farm is on or near an electric power line, ask the

power company for a copy of the new G-E Farm Book

which explains more than 100 uses for electricity on

the farm.





GENERAL ELECTRIC





 





"Wad-0A.» W .
Wwflhi g, i, ‘





 





 





 





 





 





ness is not the least of its merits.





Ask any RCA dealer to demon-

strate for you this wonderful

receiver, which is the product

of the Radio Corporation of

America, and its associated com-

panieSWGeneral Electric and

Westinghouse—leaders in elec-

trical research and manufacturing.

And be sure to have it demon-

strated with one of the new RCA

Loudspeakers, Model 100A.





There are other Radiolas ranging

in price up to $895, but none

that gives more per dollar than

the compact Radiola 16.





 





 





 





 





 





 





RADIO CORPORATION





? OF AMERICA

, .3 ,





RCAeRadiolc;





WWW...— ....—._...._...





a i. . .41. “mum“; 11.1,- e_¢:c_~.m..¢m'm. . -





 





 





«

l

f,

‘ RADIOLA 16

. . HE new Radiola 16 has es-

} tablished itself as one of the

finest low-priced receivers ever

designed. Although built pri— RCA RADIOLA 16

_ . 6-tube, tuned radio frequency receiver. A big per-

maflly for USC Wlth storage—bat- formerforalittleprice. Maybe operated with storage

batteries; or, by the addition of socket—power de-

' ' vices, w'th A. C. ‘1‘ t ‘c ‘ t.

. tcry Power) Where ClCCtrlC llght Equipped with RailOErSIISf-ifrci] $82.75

C“ current is not available, it has i i‘ \

also become one of the most i.

popular sets to use with battery- 1

eliminating devices. . . ,. i ,

. RCA LOUDSPEAKER 100A

It glVCS equally fiflC performance The leader in its class. Ideal to use with Radiola 16.

. . You can tell it by its rich, mellow tone . . $35

With storage battery or electric

RCA HOUR

' ' . ° _ Every Saturda irht thro htI f ll ' 1'

, ~ line POWCI- In sensmwtya 8616c mad MathewsBraidEngagesisggfigf

tiv1ty and tone quality, it has set 8 m 9 p.771. 8 to 9 p. 7 m g p.

, _ . Eastern Time Pacific Time Central Time

a new standard for receivers in WJZ WBAL KPO KGO KYW WDAF

. . . 3553; WE}? Klgi=OA K313” i??? 0 WOW

its price class. And 1tS compact- WJAR KDKA K'HQ woCc WVIJISAhi

WTAG WLW WHO WMC

WCSH WJR : 7 WSB

iiAuthori ed:

Ba} nil/.7 (unfit/ante ; Dealer u/urc you we I/v't sign.

:i Q J is;;;;;_;3 '





NEW YORK ' CHICAGO

SAN FRANCISCO





 





i’ MADE'BY'THE'MAKERS-OF'THE~RADIOTRORI
your "cheap” paint





‘ \





\\

\I‘J'





,l/





\. i ll; ‘ é"1i.\ /

: ‘l " Sv\\ ' 4,, _

m l : m \ z... 4





/J"

“l,





I,





-x-‘ 4 .I [71‘





isn’t a wolf in sheep’s clothing





0 man ever saved money on "cheap”



aint. That is because "low-price-



per-gallon” and real economy are miles

and miles apart.



So when anyone offers you a wonder-

ful bargain on paint, look out. There are

many wolves in sheep’s clothing in the busi-

ness of selling "cheap” paint.



There’s the man who tells

you of a barrel of paint shipped ,

by mistake to your town, which '

he will sell you at a low price to

save expense of shipping it back

to the factory. Apple-sauce!



There’s the firm that takes

your order for 6 gallons of paint

and boosts it to 60 gallons——

and threatens to have the law

on you if you refuse to accept it.



There’s the unknown firm who writes

you glowing reasons why they will give

you special concessions purely out of

friendliness. More apple-sauce!



There’s the local dealer who tries to

lure you with low price.



Any paint product, to be economical,

must have (1) good covering ability, (2)

a tough, long-wearing film, (3) colors that

do not fade. And these qualities can only

be produced with the finest ingredients,

which are costly.



"Cheap” paint is cheap only because it

is made of cheap materials. And the smart





 





 

 





13141-4.

Wu.

PRODUCTS





TH »- M... - , .

‘ "‘€:§#ERWlfl-WILL(AIM5 09'





tricks described here are merely used to

"hoodwink” the unsuspecting buyer.





Why S WP costs you less

Fine old SWP House Paint, the world’s





standard for 50 years, costs more per gal-

lon than "cheap” paint. But it costs less

’ on the wall—and much less by

the year.



Because SWP is a product of

the finest white lead, zinc oxide,

and linseed oil, produced in the

Sherwin-Williams laboratories

to unusually high standards, it

has remarkable covering powers.



Where "cheap” paint will

cover, on the average, only 250

sq. feet per gallon (two coats),

SWP House Paint will cover 360

sq. feet per gallon, (two coats). Where 11

gallons of "cheap”paint are needed for the

average house, only 7 gallons of fine old

SWP are needed. It’s that four gallon

saving that makes fine old SWP House

Paint so very economical on the wall.



But that is only the beginning.

SWP, because of its fine ingredients

and scientifically "balanced” for-

mula, lasts two and a half times as

long as "cheap” paint. It gives good

lookingserviceforfiveyears,usually.

“Cheap” paint always looks cheap

and wears out in a very short time.





 

   





um ,





   





‘44





 

 

 

 

 





That is why "cheap” paint costs several

times more than SWP for repainting.





See your local

“Paint Headquarters”





Remember this—no "cheap” paint prod-

uct, whether a house paint, barn paint,

varnish, lacquer or enamel, can be eco-

nomical. It must sell for a good price per

gallon to contain the qualities that make

it economical.



Also — no unknown concern and no

concern that makes outlandish offers of

"amazing quality and low price” is safe

to deal with.



For best results and lowest cost, depend

upon your local Sherwin-Williams dealer

—°'Paint Headquarters.” He will tell you

anything you want to know. Through the

famous Sherwin -Williams Farm Painting

Guide he can sell you the right finish for

any surface,made bySherwin-Williams

to highest quality standards. But

whatever you do — buy good paint

if you want to save money.



We will gladly send you a copy

of The Sherwin-Williams

Farm Painting Guide, free.





MES/1mm” WILLIAMS 60.





Largest Paint and Varnish Makers

in the World





Cleveland, Ohio





Reg. 1). S.

Pat. OE.





SHER WIN-Wll 1 IA M53





PAINTS " VARNISHES * LACQUERS * INSECTICIDES
, ‘53-; '





 





 





 





. There may be astigmatism: it may be





 





MARCH ‘ I7, 1928





 





UNDER THE 4~H FLAG





 





(Continued from page 382)



a new sense of responsibility, a new

pride in the work. He thrilled to the

club songs and yells, the applause of

the audience as father Barton led his

orchestra in accompaniment to the

solos charmingly rendered by Miss

Edwards. As the club members stood

at Bob’s request, Katie O’Neal came

forward to lead them in the 4-H club

pledge. Her fresh young voice rang

out, its fervor penetrating to every

corner of the assembly room.



“As a true member,” began Katie

and with the others Bob took up the

words, “I pledge my Head to clearer

thinking, my Heart to greater loyalty,

my Hands to larger service, and my

Health to better living—for my club,

my community, and my country.”

There was no applause when the

pledge ended. A silence, pregnant in

its meaning, held the audience of

parents. It was an offer upon the

altar of Americanism.



(Continued next week)





 





 





RURAL HEALTH

By Dr. C. H. Lerrz'go





 





 





 





THROAT GIVES TROUBLE





 





I have throat trouble and the doctor



tells me that my pharynx is bad. My

voice is weak and my wind is short.

in cold or damp weather I have to

ough. I took treatments before,

medicines and sprays, but without a

cure. I would like to know if there

18 a treatment or operation that will

effect a cure. This ailment gives me

stomach trouble too and I have to

belch quite often. I am 48 years old

and had my tonsils taken out five

months ago—R. B.



I do not think any operation will

help. In such a case I would have a

doctor who knows all about the heart

make a careful examination of heart

action and blood pressure. If no

trouble there I would try general tonic

treatment, rest, and building up with

nourishing food.





 





TEST THE CHILD’S EYES





 





VV HAT about the eyes of a child

who supposed that birds could,

only be heard, not seen. Just last

week such a child was found in

one of our public schools, vainly try-

ing to “keep up.” Spectacles opened

a new world to the poor youngster.

Why didn’t he say something about

it? Just one reason—he supposed

everyone saw things in the same dim-

way.



Every school child should have a

simple test of vision and such tests

may easily be given by the teacher.

The Tuberculosis and Public Health

Association which carry on a very

energetic program of health education

in both rural and city schools, issue a

simple chart .for testing vision and

usually supply it free of charge. Their

instructions to teachers make empha-

tic the point that a teacher is not sup—

posed to make expert examinations or

offer suggestions about correcting de-

fects. If she finds a child with poor

vision she is to send word to the par-

ents that a doctor should be consulted.

Her responsibility ends there, except-

ing for such simple aid to the child

as giving him a place where the black-

board can be seen most easily.



If you receive word that your child

needs visual correction, take prompt

action, bearing in mind that the value

of the eye is beyond computation.

Don’t follow that foolish but common

practice of buying the youngster a

pair of spectacles at the cheapest

place. Take him to some expert au-

thority who will find out whether he

needs glasses and if. so will fit him

exactly.



A child may read the test card per-

fectly and yet have visual defects.





 





 





 





that the child is “far Mted?’ or





 





 





 





THE MICHIGANWFARMER





there may be other-defects that im-

pair the vision but do not interfere

with reading a simple chart. Did it

ever occur to you that a child with

one excellent eye and one only three-

fourths capacity was in more danger

than if both eyes were poor? In the

latter event he would get glasses

promptly. Until he does the good eye

will do all the work and thus be over-

strained while the poor eye will deteri-

orate because of its dependence upon

the other. It is good work for a teach-

er to make a simple test of the vision

of her pupils, but the conscientious

parent, instead of depending upon

that, will have the child given careful

and thorough examination by one who

is expert in the work.





 





CHILD STAMMERS





 





Would adenoids cause stammering

in a six year old child? What will

cure it?—E. C.



Stammering is due to a defect of

the nervous system. Adenoids might

affect it if they were so bad as to





impoverish the health of the child, but

as a general thing the trouble is not

so brought about. The cure for stam-

mering is by very careful training.

The child must not be frightened nor

dealth wit-h impatiently. He must be

taught to take matters of speech with

great care. He must be made to feel

that it is just a habit that he can over-

come. When he staminers he is just

oto wait a little and then begin over

again. A patient mother is the best

teacher for a stammering child.





 





CATARACT OPERATION SIMPLE





Can you tell me what causes catar-

act and does medicine cure it? If it

needs surgery, how serious is it?—

C. H. L.



Cataract is a condition in which the

lens of the eye becomes opaque and no

longer admits light. Many attempts

have been made to cure by medicine

but without marked success. The

operation for cataract is simple. It

does not even require a general anes-

thetic. After the lens are removed the





21—4387 '





patient is fitted with proper glasses

and usually gets excellent results.





 





ULCER OF THE STOMACH





 





What is the approved way to diag‘

nose ulcer of the stomach? Is it ever

cured without surgical treatment?—

B. Ache.



A doctor may diagnose ulcer of the

stomach with fair accuracy from the

symptoms and by examining the stom-

ach contents. He may confirm this

by X—Ray examination, but this should

be done by a specialist as it is diffi-

cult for anyone but an expert to inter-

pret the X-Ray findings of ulcer. Di-

etetic and medicinal treatment is

often successful and in most cases

should be considered in preference to

surgical treatment.



In 1924 only 48 gallons of wood al-

cohol’were imports. into the United

States; then synthetic methanol was

produced and in 10 months of 1925

Germany sent this country 415,000 gal-

lons.





 





”





~ If you smoke

for pleasure





 





 





—then Camels are





 





 





 





1928. R. I. Molds Tobi???

onpnny, Winston-Solemn. N. C.





made for you.

Mild, mellow, fra-

grant—there’s a

world of enjoy-





ment in smoking





Camel





Today, as for many years, Camels lead





by billions, and they continue to grow
INTENTIONAL SECOND EXPOSURE





 





SC sure





your ”cheap” paint





 





 





isn’t a wolf in sheep’s clothing





() 1111111 11V11 r an 1111 money 1111 "cheap”



paint. 111111 is because low—price-



per-gallon ’ 111111 1111111 economy ate miles

and 111i111 1s apart.



511 “1111111 anVone 11111 rs you a wonder-

ful 1111r11ain 1111 paint, look 11111. There 1110

many V1111V11sin s11111ps1111111i11g111 thebusi-

1111ss of selling “cheap” paint.



'1‘11111’11515‘ 1111: man who 11111s

you 11111 11111'1‘11111111111111 shipped

by mistake to your town, which

he will s1111y1’111111111ow price to

save expenseof shipping it back

to the factory. Apple-sauce!



There’s the firm that takes

your order forOgallonsofpaint

and boosts it to ()1) gallons-—

and 1111'111111111s 1o 1111Ve 11111 law

on you ifyourc 1111s11 1111111 1111 pt 11.



'11111 1111‘s 11111 unknoVV 11 1i1m VVho VVIites

you 1rlowing masons VVhy 11111 1v V1111 11iV11

you 5111 11111 1111111111~si1111s 11111111v out o1

fliendliness. M11111 1111/1/11- 511111 e’



'l‘here's 11111 11111111 1111111111‘ who tries to

lute you with low [111111.



Any paint pr1,odu1t 111 11c 11110110111i111l,

must have (1) good ('UVt‘Flll“ ability, (.3)

a tough, long- w1aring film, (1) colois that

do not fade. And these qualities 11111 only

be produced with the finest ingiedients,

which are costly.



"Cheap” paint is cheap only be éause it

is made of cheap materials. And the smart





 





Witt/1115

Pnooucrs /





 





tricks described here are merely used to

"hoodwink” the unsuspecting buyer.





Why S WP costs you less

Fine old SWP House Paint, the world’s





standard for 50 years, costs more per gal-

lon than "cheap” paint. But it costs less

011 the wall—and much less by

the year.



Because SWP is a product of

the finest white lead, zinc oxide,

and linseed oil, produced in the

Sherwin-Williams laboratories

to unusually high standards, it

has remarkable covering powers.



\Vhere "cheap” paint will

cover, on the average, only 250

sq. feet per gallon (two coats),

SWP House Paint will cover 360

811. feet per gallon, (two coats). Where 11

gallons of "cheap”paint are needed for the

average house, only 7 gallons of fine old

SWP are needed. It’s that four gallon

saving that makes fine old SWP House

Paint so very economical on the wall.



But that is only the beginning.

SW1), because of its fine ingredients

and scientifically "balanced” for-

mula, lasts two and a half times as

long as "cheap” paint. It gives good

Iookingservice for fiveyears,usually.

"Cheap” paint always looks cheap

and wears out in a very short time.





 

 

 

 

 

   





Trade-M ark

Reg. U. S.





That is why "cheap” paint costs several

times more than SW]? for repainting.





See your local

“Paint Headquarters”





Remember this—no "cheap” paint prod-

uct, whether a house paint, barn paint,

varnish, lacquer or enamel, can be eco-

nomical. It must sell for a good price per

gallon to contain the qualities that make

it economical.



Also — no unknown concern and no

concern that makes outlandish offers of



"amazing quality and low price” is safe

to deal with.



For best results and lowest cost, depend

upon your local Sherwin -Williams dealer

—"Paint Headquarters.” He will tell you

anything you want to know. Through the

famous Sherwin-\Villiams Farm Painting

Guide he can sell you the right finish for

any s11rfacc,111ade by Sherwin-Williams

to highest quality standards. But

whatev ver you do — buy good paint

if you want to save money.



We willr gladly send you a copy

of The Sherwin- Williams





Farm Painting Guide, free.





7H5 SHE/PW!” WILLIAMS 60.





Largest Paint and Varnish Makers

in the World





Cleveland, Ohio





Pat. Off.





PAINTS '1 VARNISHES * LACQUERS ' INSECTICIDES
M ARCH 17, 1928





UNDER THE 4-H FLAG



(Continued from page 382)

a new sense 01‘ responsibility, a new

pride in the work. He thrilled to the

club songs and yells, the applause of

the audience as father Barton led his

orchestra in accompaniment to the

solos charmingly rendered by Miss

Edwards. As the club members stood

at, Bob’s request, Katie O’Neal came

t'orward to lead them in the 4-H club

pledge. Her fresh young voiCe rang

out, its fervor penetrating to every

corner of the assembly room.



“As a true member," began Katie

and with the, others Bob look up the

words, “I pledge my Head to clearer

thinking, my Heart to greater loyalty,

my Hands to larger service, and my

Health to better living—for my club.

my community, and my country.”

’l‘here was no applause when the

pledge ended. A silence, pregnant in

its meaning, held the audience of

parents. It was an offer upon the

altar of Americanism.



(Continued next week)





 





 





 





 





 





RU RAL HEALTH

By Dr. C. H. Lerrigo





 





 





 





 





L...“





m..—





THROAT GIVES TROU BLE





 





 





l have. throat trouble and the doctor

tells me that my pharynx is bad. My

Voice is \vt-ak and my wind is short.

't cold or damp weather I lime to



mgh. i took treatments bel'ore,

n--tlicines and sprays. but

cure. i would like to know it”

lreatmt-nt or operation that

wiiv't'l a cure. ’l‘his ailment

stotvtach lrtmble too and l

bl Lt'it quite (men.

not had my tonsils

nan-aths ago. it. 1:.



l do think any operation rill

I! ‘31»





dr'ic‘or who knows all about the heatt





.\{l





taken out





not.





clitlte

action and blood

l‘ttlihit‘ there I would try general tonic

treatment, rest, and building up it ith

'1 a'ti'ishing food.





’8 EYES





 





TEST THE CHILD



a". HAT about the eyes of a l‘ilIIti

V who stpposed that birds tonld

may be heard, not seen.





yin-k such it child was





 





without a,

there:

\\ iII

gives me?

hate to:

l am »l\‘ years old,

ii\t"





In such a case I would hate a‘





:t cart-,t‘ul examination ot‘ heart.

pressure. It no‘





.Iust In'll

round in‘





or." of our public schools, vainly try-3





his: to “keep up.”





Spectacles opened:





a new world to the poor )oungstvr.‘





\‘v’hy didn’t he say somethina about

Just one he

:"-.':‘i§f0n£> saw thing;. in the saint-

way.





livery school child





H33 SOI‘. "





should





simple test. ot' vision and such tests

may easily be given by the teacher,

The ’l‘ubcrculcsis and l’ubltc llealth





Association which carry on a

energetic program of health education

in both rural and city schools. issue a





\Vi‘ik‘V





supposetlif

dim}





have al





simple chart tor testing Vision and,

usually supply it tree 01' charge. ’l‘heir'





instructions to teachers make empha-





tic the point that a teacher is not sup»;





pOsed to make expert examinations or

Ont-r suggestions about correcting de—

fects. it she





finds a child with pootw





vision she is to send word to the par-2





cuts that a. doctor should be consulted.





Her responsibility ends there, except-t





ing for such simple aid to the child

as giving him a place wht re the black

bnit'tl can be seen most easily.



it you receive word that your child

visual correction, take prompt

action. bcaring in mind that the \ZtIlIO

of the eye is beyond computation.

Don’t follow that foolish but common

practice ol' buying the youngster a

pair of spectacles at the cheapest

place. Take him to some expert au-

thority who will find out whether he

needs glasses and if so will fit. him

exactly.



A child may read the test. card per-

[eclly and yet have visual detects.

There may be astigmatism; it may be

that the child is “far sighted;n or





fiends





 





THE MICHIGAN





there may be other defects that im-

pair the vision but do not interfere

with reading a simple chart. Did it

ever occur to you that a Child with

one excellent eye and one only three

l’ourths capacity was in more danger

than if both eyes were poor? In the

latter event, he would get glasses

promptly. L'ntil he does the good eye

will do all the work and thus be over-

strained while the poor eye will deteri-

orate because of its dependence upon

the other. It is good work for a teach-

er to make a simple test of the vision

of her pupils, but the conscientious

parent. instead ol‘ depending upon

that, will have the child given carel‘ul

and thorough examination by one who

is expert in the work.





CHILD STAMMERS





Would adenoids cause stammering

in a six year old child? \Vhat will

cure it?v~lt‘r. C.



Stammering is due to a defect of

the nervous system. Adenoids might

affect it if they were so bad as to





 





FARMER





impoverish the health ol‘ the child, but

as a general thing the trouble is not

so brought about. The cure for slam

mering is by very careful training.

The child must not be l’rightened nor

dealth with impatiently. lie must be

taught to take matters ot‘ spet‘ch with

great care. lie musl be made to feel

that it is jtisl a habit that he can oven

come. \Vhen he slammers he is just

ato yait a little and then begin over

again. A patient mother is the best

teacher tor a stamniering child.





CATARACT OPERATION SIMPLE





Can you tell me what causes catat-

act and does medicine cure it‘.’ II' it

needs surgety, how serious is it‘.‘

F. H. L.



Cataract is a condition in which the

lens of the eye. becomes opaque and no





longer admits l'Lcht. Many attempts

have been made to cure b) medicine

but without marked suctwss. The





operation for cataract is simple. it

does not even require a general anes~





thetic After the lens are removed the





21—387





patient is fitted with proper glasses

and usually gets excellent results.





 





ULCER OF THE STOMACH



What is the approved way to diag-

nose ulcer ol‘ the stomach? Is it ever

cured without surgical treatment‘Ls

ll. Ache.



;\ doctor may diagnose ulcer ol‘ the

stomach with t‘air accuracy from the

symptoms and by examining the stom—

ach contents. llc may confirm this

by X-Ray examination, but this should

be done by a specialist as it, is dillc

cult for anyone but an expert to inter—





pret the Xilay findings of ulcer. Di-

etetic and medicinal treatment is

ol‘ten successt'nl and in most cases





should be considered in preference to

surgical treatment.





In tail only 4.»; gallons ot' wood al-





cohol wwre illlDtHlt. into the l'nited

States: then synt , Itic methanol was

produced and in ltt months ot‘ 1925





Germany sent this country 115,000 gal-

Itlll- ‘





 





 





 





If you smoke





for pleasure





 





G) 1928, R. ’. Reynolds Tabla;

Conlpnny, Winston-Salem, N. C.





L





 





-—-thefl Camels ate





 





merit in is





made for year.





.,





Mild, meliow, f'aa-

grant—nthere’s a





world of cnj oyw





moidnc





/





E“





 





‘ I

Today. as for many years. Camels lead





by billions, and they coulinue to grow
HE Farm Service

“tag” hanging in

the windows of our



stores is an invitation for

you to come in whenever

you want honest advice

and help in the selection

of maintenance or equip-

ment and hardware sup-

plies. The word “serv-

ice” in the “tag” means

service to you. Why

don’t you make a greater

use of it? It costs you

nothing and may save

you much in the way of

both time and money.

The next time you see a

Farm Service store come

in and look around.





“jolt





Have you a personal set of tools

for your kitchen? There are many,

but a pair of pliers, screw driver,

hammer and a box of assorted nails

and tacks are mighty useful. Stop

into a “tag” store and let us fix up

a set that you can keep in a handy

kitchen drawer where the men

folks will not be apt to carry them

away. The small cost will be





repaid in convenience many times.





 





 





’VE been too busy hanging onto

motorcycle handle bars and keep-

ing my bare knees away from the

sizzling hot motor between them—

and sleeping the sleep of the just

tired at night—to find time to write

articles of romance, adventure, and

agriculture. Instead I will simply pass

on the following observations from our

log book as Jim and I motorcycle

across the continent of Africa.





November 10—We are finally on the

road with our little one-cylinder motor—

cycles—headed for the bush. Four

thousand miles of jungle, bush, pla-

teau, desert, and mountains ahead of

us. The Niger and the Nile valleys

to cross, the great Sahara Desert, and

the whole black continent of Africa—-

and it’s never been done on motor-

cycles before. We’re off—in a clump

of bush.



Real jungle this, with trees, shrubs,

and riotous tropical vegetation so

dense and interwoven in many places

that man would have to chop his

way through with an axe. And yet a

good road has been laid right through

its heart between the black walls of

jungle on either side. A surfaced

highway that shoots through the black

of night, this road pierces the African

bush. It is the road that draws the

native blacks out of their mud huts





THE MICHIGAN FjARMEiRW





A Diary from the Jungle I





Four T lzoumnd Mile: of Jung/e, Plateau and Derert

Ahead of Rang/z and T umé/e





By Francis Flood





 





I





twenty miles a day, for five consecu-

tive days.



A screeching, honking lorry comes

crashing down the road and we pull

off to one side and slow down lest

the black devil at the Wheel rip ofl.’

two of our motorcycle wheels or

wreck his own bus, overloaded with

freight and bouncing passengers.





A LITTLE cluster of grass huts

that calls itself a native village

wakes up as we put-put past and

all hands rush to grab the long-haired

sheep and gangling dogs which always

watch and wait peacefully in the road.

These African dogs, for some reason,

have the same feeling of indifference

toward an automobile Or a motorcycle

that an American cow has. Between

dodges I wonder why the sheep here

have hair instead of wool, while the

natives have wool instead of hair, and

then I recall an old Hausa trader who

tried to sell me a native-made blanket.

It was made in Timbuctoo, a few hun-

dred miles up the desert and was

rather nattily decorated. .

“Is it cotton or wool?” I inquired.

The old boy didn’t savvy “wool” at

all, but he’d been trying to sell me

ostrich and maribou feathers and he

knew his wares.

“It be sheep, sah.” he insisted. “No





 





 





 





 





 





 





Building Sand and Other Materials.





in Ithe bush and leads them into the

ig t.



Hot, it is! So hot that even with

our cork helmets, and our red—lined

spine pads buttoned down the backs

of our bush shirts, and even with the

breeze stirred up by our twenty-mile

gait, we welcome the shade when the

sun, that was practically straight

above our heads at noon, ducks for a

moment behind the jungle wall. Our

baby-white bare knees, and consider

able bare legs as well, exposed equally

to the sun and the public gaze on ac-

count of our new “colonial” suits of

“shorts,” soon red up angrily, but

they’ll get more than this before we

cross the sizzling Sahara so we let

’em broil in their sweat.



A half-dozen, half-naked, half-asleep

black men, hacking away at rough

places in the road with their murder-

ous looking matchetes scurry to one

side and grin at us as we boil on.

A good American one—man tractor

grader would do more road work in

a day than fifty of these cheerful

natives, but it would cost more to hire

one per day too. If a few tons of

gravel, stone, or dirt are needed for

a grade or bridge approach, it is car-

ried there by these happy menials of

the Dark Continent, a basket or cala-

bashful at a time on their kinky, sol1d

heads. One contractor introduced the

wheelbarrow in a gang ‘of natives who

were carrying sand about a quarter

of a mile, unloading a boat. He found

them a few hours later first filling the

wheelbarrow with their calabashes

and then loading wheelbarrow and all

onto their heads and plodding patient-

ly along. “These trousered apes don’t

know how to use their heads for any-

thing else anyway,” he growled.





HAD seen, in Lagos, blacks going



home from school with a book, a



pencil, or even a bottle of ink

perched serenely on their heads and

tripping along just as any boy would

do at home with the same things in

his pocket. I’d seen them carry type-

writers and alarm clocks and chickens

in crates, and I even saw one how-

legged old blackamoor treading down

a Lagos street with a big steel safe

settled snugly on his head, unsteadied

by either hand. A missionary friend

told me of a native carrier of his who

had toted, on the mass of bone he

called his head, a crated kitchen stove





 





 





weighing 142 pounds, and be logged it





Are “Hauled” on Heads of Natives





be cotton. It be sheep, sah.”



“Oh, it be cheap, eh? Well, how

cheap?”



“No, it be sheep, sheep. It be

sheep’s feathers, sah. Be make from

sheep’s feathers in Timbuctoo.” I

bought two of them, a sort of hair

blanket woven in strips about eight

inches wide and then sewed together

to form a blanket. (And we needed

them both, and more too, those cold

Harmattan nights in the desert a few

months later.)



November Il—Armistice Day! Mr.

Patterson, our American missionary

friend in Abeokuta, sixty-five miles

inland from Lagos, invited me to enter

the annual tennis tournament Which

seemed to be the principal event of

the ArmistiCe Day fete. We registered

as an all-American entry in this Afri-

can tournament— and found twenty-

four Britishers opposing us. Sheer

modesty forbids description of how

Mr. Patterson and I won our way to

the finals just as it grew too dark for

any more playing.



This tennis in Africa was a new one

on me. At home when I see a tennis

ball bouncing along off the court it is

second nature for me to chase it. But

as tennis is played here, a. half—dozen

black men or boys are deployed back

of each end of the court and they

chase all the balls. A white man would

scorn to walk three feet for a tennis

ball, and it was embarrassing for a

born retriever like me to find myself

galloping off with the blacks after a

stray tennis ball.





0V. 12—As early as it was safe to



discard our cork helmets and be



out in the sun, an hour and a half

before sunset we met our opposing

English finalists for the championship

match. Bingo! They won the first

set. But we didn’t care, for we won

the second and third, and the match,

and the championship of Abeokuta for

the Stars and Stripes. And that was

that. Another big day right on the

heels of Armistice day.



Nov. 13—My birthday! Three big

days in a row. (I won’t discuss this

subject because I’ve reached the age

when one doesn’t welcome birthdays.)



Nov. 14—1 might have known it!

Too much celebration, and the only

indisposition I’ve felt on the entire

trip as a result. I’d stood all the

terrors of the African tropics, but gave

way before the dinner table hospitality





MARCH 17, 1928.. r





Travel the- .. _ .





feat Lakes





First!





- -» FL:





~~w—*





D. o c. Steamers Guldedbu Radio Compass Signals

To Lovers of Sen, Sky and Drifting Clouds:





Summer is just around the corner, and

it is in order to suggest a cruise on the

Great Lakes as part of your vacation.





::_'_. ‘ f___. __ .





We would be pleased to help you plan

an outing of two, four, six or eight days'

duration on the Lower Lakes, and supply

you with pictures and descriptions of

pleasant places: Niagara Falls, Mackinac

Island, and others.





If you contemplate an automobile tour.

plan to make part of the journey by boat.

Our overnight service between Buffalo

and Detroit; Cleveland and Detroit, is

used extensively by automobilists. if you

desire a longer voyage our line between

Cleveland and Chicago. via Detroit,

Mackinac lslandand St. lgnacc, willappeal

to you. Dancing. concerts, radio enter-

tainments, deck games on shipboard—

not a dull moment.





A. A. SCHANT Z. Provident





WWII





 





 





Fares: Buffalo to Detroit, $5; Cleveland to

Detroit, $3; meals and berth extra. For the

Chicago-Mackinac lolan tours fares given are

for the round tn . and include o expense on

steamers: Bufla o to Mackinac la and, $49; to

Chicago, $79. Cleveland to Mackinac Island.

$4|.50; to Chica o. $7l.50. Detroit to Mackinac

Island, $30- to C icago. $60. Stopover: at Mack-

inac Island and other ports. or reservations ‘

address E. H. McCracken. C. P. A.. Detroit and

Cleveland Navigation Co.. Detroit. Mich.





Fast freight service on all division: at low rateu.





 





BLANKETs—and Colonial Cover-lets. Send



BATTING— us your wool and we will

ROBES— make beautiful. serviceable

products that will give satisfaction both in possession

and the service they render. We Sell direct. Write

for catalog and samples. WEST UNITY WOOLEN

MILLS. “)8 Lynn St. WEST UNITY. OHIO.





 





Genuine





PPERS





$5Q’VALUE

ALLRUBBER,

" 4Buchleildqhi





 

 

   





Greatest Ovenhoe Bargain Ever onendi First

quality women's all rubber Genuine Zi pers, known as

the best automatic gaitem,made, sci where ‘for

$5.00 and more. close-out purchase 0 a.

quantity enables us to offer them at; 81.59. . For this

reason the names have been butt on. They are all

rubber outside, friction lined, 111 um t. Easily

washed—Just the thing for weaning! roads this

5 ring. Medium last—will not fit over extra Wide

3 oes. Low heel only. Half sizes. . . - -

No. 490, slzos 2510 I, $1.59r —





SEND NO MONEY gnaw“? ”fit





your order by letter or Ronni. We'll send at once by

parcel grost. 0N APP Ogle}. Pay pointman only

9.





Waite Foo OUR FREE CAT/Hon





 





 





.'

b





 





 





USlilllllllailP? c





 





“a... a. -_.._.A.- ...





.. _.-~_-
\n





 





Manon "17,1928 '





of an American missionary. Intem-

perance'finally got rue—at the home of

a missionary too. Each night as Mr.

Patterson bowed us to bed he courte-

ously offered “Now if there’s anything

you want, ask for it—and if we don’t

have it we’ll send for it.” And when

a good South Carolina cook extends

that principle to the dining table as

Mrs. Patterson did, it is no wonder

I weakened and fell after three holi-





davs.



Nov. 15, 16, and 17—su11 under the

weather, but on November 18 we start

out again and drive thirty—five miles to

the government agricultural experi-

ment station near Ibadan.



“Better have dinner and stay all

night,” invited Mr. Faulkner, Director

of Agriculture for Nigeria, “and let us

show you what we’re doing here on

the farm.” .



That evening, after looking over the





' Sincerity vs. Formalism

Our W eat/y Sermon—By N. A. Mchme





RAVELLERS in the Far East re-

l port the use of prayer-Wheels

among the Tibetans and Mongo-

lians. These wheels are inscribed

with prayers, or have pieces of paper

tied to them containing prayers. When

the wheel is turned rapidly, the pray-

ers are supposed to attract the atten-

tion of the gods. But there are other

forms of formalism as meaningless as

this, and even more deadly, because

the worshippers know better. Jesus

denounced such formalism. Many

people were exceedingly particular

about this feast

and that custom,

but “in vain do

they worship me,

teaching as their

doctrines the pre-

cepts of men,”

and leaving un-

touched such

weighty virtues

as justice and

mercy. As a matter of fact, all wor-

ship tends to become formal, and to

lose its essential inner meaning, un—

less the worshipper is on the watch

to guard against it. Habit is strong

with all of us, and habit is our salva-

tion in every-day affairs. By habit we

go through the mechanical operations

of the day, such as getting up, dress-

ing, walking, eating, doing the chores.

If we had to stop and think every-

thing out,‘ the work would be long in

getting done. But when this is ap-

plied to religion it is fatal, for reli-

gion requires that we put our best

thought, our soul, into it. Habit, in

the sense of mechanical performance,

does not go.





 





In other words, Jesus was pleading

for sincerity. An English cynic said,

“A little sincerity is a dangerous

thing, and a great deal of it is abso-

lutely fatal.” But we know that he

was talking for effect. Sincerity is

fundamental to any sort of a decent

world. If people are not sincere when

they tell you something, it is useless

to waste time in listening. As Carlyle

says, “A false man found a religion?

Why, a false man cannot build a brick

house! If he does not know and fol-

low truly the properties of mortar,

burnt clay and What else he works in,

it is no house that he makes, but a

rubbish heap.” A farmer of whom

I heard recently had had a hard time

of it. He lost money farming in Colo-

rado, and went to Texas, where he

again 10st, running up an account for

groceries at one store for fifteen hun-

dred dollars. He then moved back

to Colorado, and .as he left he said to

his creditor, “I will pay you all I owe.”

“I believe you,” said the store keeper,

and he did pay it. It is this kind of

honesty that we must put into our

forms of worship, if they are to have

meaning.



How the New Testament drives this

home! Jesus called the professional

religionists hypocrites because they





' did not carry out their professed be-





liefs ‘sincerely. James says, “Pure

religion more God and the Father is





 





TH E: MI CH '1 GiA‘N ”FEARM’EZR





farm we. strolled through a native

cemetery and noticed the following in-

scriptions, most of them crudely hand

carved on an ornate monument of

sandstone: “Anna S———————, devoted

wife and partner of her husband’s mis-

sionary labors in the —— district

where they scored four converts in

forty years. Well might she exclaim

‘Lord, now lettest thy servant depart





)n





in peace .





Another read, “In loving memory of

Okoya Onilegbola. Died 10 December,

1909. Aged 120 years.” Two graves

away was another who had died at

102. This epitaph interested me. “S.

P. Joke, who died -———- leaving a

mother, husband, and ten little Jokes.”



Our visit at the experimental farm,

and something about agriculture in

general in Nigeria will be discussed

next week.





this, to visit the fatherless and the

widows in their affliction, and to keep

himself unspotted from the world.”

John says, “Let us not love in word,

but in deed and in truth.” Paul says,

“Though I give my body to be burned,

and have not love, it profiteth me

nothing.”



Take the ordinary church service.

How much of it do we enter into,

thinkingly? Perhaps the Apostles

Creed is part of the program. How

quickly that is rattled off, “I believe

in God the Father Almighty, Maker of

Heaven and Earth, and in Jesus

Christ His only Son, our Lord.” Sup-

pose we stopped there some Sunday,





 





 





and started out to sincerely live that,

week as if we actually believed thatl

we believe in God the Father and;

in Christ the Son. Life would take?

on a happier and more kindly tone.

The Lord’s prayer is a part of most!:

church services. “'hen we repeat;

that—think! “Our Father—4’ “Our?

Father”—to whom does the “our” re-.~

fer? All we Americans? All we white}

people? It must refer to all thel

human race, who believe in God. Then

if we have a common Father, we must

be brothers, all of us, white and black

and brown and yellow.





What about racial consciousness,

and White superiority? Who says we

are superior? Did anybody say that,

except we white folks? I know this

goes terribly against the grain. But‘

that is because we do not take our

religion into the world of life in a

sincere and whole hearted way. 0,

don’t be alarmed. I am not arguing

for intermarriage between the races.

I am just talking about treating other

people as if we believed that Christ

was not joking when he said, “All ye

are brethren.” Otherwise we had

better stop using the Lord’s Prayer.

Sincere religion goes deep, and it

blows up our dearest prejudices.



Other people have brains. \Ve white

folk are not the only ones who have.

One of the most popular American

poets of the day is Countee Cullen, a

colored boy. I wish we had space to

quote him. A man who has interests

in a large timber tract was telling me

about a Chinaman. At their saw mill

they have a sealer who stands where

the logs are drawn up out of the

water, and placed on the car where

they are sawed up. The sealer they

had was a good one, and seldom made

a mistake, in estimating the number

of board feet in a log. He quit, and

the company employed a Chinaman.

He did not use a scale, but did alll

the figuring in his head, and, my

friend states that, as far as he knows,

the Chinaman never made a mistake.

Sincere worship, sincere religion. Let

us try it. It will save a. world of

tears and trouble.





 





 





SUNDAY SCHOOL LESSON FOR

MARCH 24, 1928





 





SUBJECTz—Jcsus Denounces Formal-

ism. Mark 7:1 to 23.

GOLDEN TEXT:—Prov. 4:23.





 

   





 





'7'





   

     





I GROW ALFALFA





or Sweet Clover this year





00D farm management always includes the grow-



ing of some legume crops, particularly alfalfa or

sweet clover. The successful production of these crops

requires a soil of neutral or alkaline reaction. Lime

or limestone makes the condition of the soil favorable

for the growth of these crops when it is applied to

the land in the proper amounts.





About one-fifth of the crop producing area of the

United States is knoWn to have acid or sour soils.

Most of this area is in the central and eastern states.





The New York Central Railroad always has advoca-

ted the liberal use of liming materials and the growing

of legume crops as good farm practice.





   

 





 

 





,m Plan now to apply lime to your soil this





(\r’ 3...... ‘

/ PUT IT ON—DON’T PUT IT OFF!





NewYork’Central Lines





Boston & Albany—Michigan Central—Big Four—Pittsburgh & Lake Erie

and the New York Central and Subsidiary Lines





Agricultural Relations Department Ofl‘ices

New York Central Station, Rochester, N. Y. 68 East Gay St., Columbus, Ohio

La Salle St. Station, Chicago, Ill. Michigan Central Station, Detroit, Mich.

466 Lexington Ave., New York, N. Y. 902 Majestic Bldg., Indianapolis, Ind.





 

 

 





 





 





 





CAMBRIA FENCE

adds





value to value





AMBRIA FENCE retains its newness

and original snap for years—it adds

value to your property.



Cambria Fence is a standard, hinge—joint,

cut-stay field fence made of selected steel

wire, heavily coated with zinc by our own

process.



Cambria Fence protects stock and crops,

greatly assisting the owner in keeping his

property secure and in order.



Cambria Fence is a good investment—

Ask your DEALER about it!



CAMBRIA STEEL FENCE POSTS in

Angle and Tee Sections are the strongest

fence posts obtainable for erecting farm,

poultry yard, orchard and garden fence.





 





Two rolls of Cambria Fence

displayed with Barbed Wire





BETHLEHEM STEEL COMPANY, Bethlehem, Pa.





BETH LEH EM
. "MARCH 17. 1928-





 





 





 





 





 





akc Your Own Spring Flowers





Chase Away Witter Dal/72655 5y Scattering a Bit of Brzgflt Color Aéout tée Home

By Dorothy Wright





SN’T it a joy to have flowers in

I abundance, to add cheer and



beauty and comfort at home, in

the schoolroom, the church, and in

the hospitals!



After the long winter when blos-

soms are so scarce, every one is

hungry for the bright yellow daffodils

and jonquils, the dainty narcissus, the

fragrant hyacinths and all the other

early spring flowers that are always

so lovely. That longing can be satis-

fied now. Not always, perhaps, with

the real flowers, but with flowers that

are the result of your own handiwork.



Crepe paper is made in all shades

and colors, so that at least half of





 





Hyacinths Are Particularly Pleasing

Arranged in Window Boxes





the problem of natural effects in ar-

tificial flowers is solved at the very

start. One of the greatest delights to

be experienced in crepe paper flower

making is the simplicity and ease with

which, seemingly complicated parts

are overcome. There are so many

short ways of accomplishing results

that no matter how large the quan-

tity of flowers made, the fascination of

the work is not lessened.



The hyacinth is usually displayed

as a growing plant in a window box

or a flower pot. About thirty-five or

forty of the small blossoms are ar—

ranged around the main stem with

three or four buds at the top.



The little buds are made by first

cutting a piece of pink (or other de-

sired color) crepe paper, across the

grain, three-quarters inch wide and

five inches long. Stretch the strip and

cut into three inch lengths. Double

the strip lengthwise making the

double strip three-eighths inch wide.

Now bring the two ends together by

making a semi-circle of the strip with

the folded edge to the outside. Pinch

the strip together and roll between

the fingers. Cut off one inch down

from the top, open a little at the base

and with a bit of paste fasten the end

of a two-inch strip of spool wire on

the inside. Then press it tightly with

the fingers. About four buds are

enough for each stalk.



The blossoms are made of the same

color as the buds, and are cut across

the grain in one and three-quarters





inch wide strips allowing one and one-

half inches in length for each blossom.

A strip seventy-two inches long will

make forty-eight blossoms. Fold the

strip in the center three times to

eight thicknesses. With the strip

folded in this way out down from the

edge one—half inch, every quarter inch,

all along the edge through the eight

thicknesses. Before unfolding the

strip cut the petals into points (eight

at a time) and then cut into strips

of six pointed petals each. Lay a six-

pointed-petal strip on a flat surface,

brush the lower edge and side edge

With paste. Place a two—inch strip of

spool Wire at the center of the lower

pasted edge, three-eighths inch in.

Press pasted side edge on top of the

opposite edge overlapping only enough

to hold securely, gather the petal one

inch down from the top and press

firmly around the bottom edge so the

stem will be securely held in. Curl

each pointed petal outward over a

blade.



To assemble the buds and blossoms,

first wrap two No. 9 wires ten inches

long, with a one-half inch wide strip

of moss green crepe paper, out across

the grain, fastening at the end with

paste. Place one of the buds at the

extreme top of the wire and with the

one-half inch strip of moss green crepe

paper wrap in the short wire stem.

Add three more buds near the top on

Opposite sides, wrapping them in with

the green strip, and in the same man-

ner, place the blossoms around the

stem, wrapping their stems close to

the main stem. The blossoms should

be placed so close to each other that

little, if any, of the main stem shows

between. The buds and‘ blossoms





should cover about seven inches of

the stem. Continue to wrap the stem

and two inches below the last blossom

insert two leaves on opposite sides

of the stem. The leaves are cut from

the moss green crepe paper, from

base to tip running with the grain of

the paper. They should be eight and

one-half inches long and one and one-

quarter inches wide in the center,

which is the Widest point. Taper the

top into a point and the base to a

width of one inch. Complete the stem

wrapping and fasten with paste.



The jonquil and the narcissus are

equally as easy and fascinating. The

jonquil is usually made in two stades

of yellow, and the narcissus in pure

white with a single yellow stamen in

the center.



Directions for making the jonquil

and narcissus as well as twenty other

kinds of artificial flowers are con-

tained in the bulletin, “How to Make

Crepe Paper Flowers.” For a copy

send ten cents in stamps or coin to

Desk L, Michigan Farmer, Detroit.





 





GETTING YOUR APPLE A DAY





 





RAW apples are more useful in

salads than almost any other fruit

for they add crispness and combine

well with other ingredients. Salads,

made with diced apples and cold

cooked veal or pork and celery cut in

small pieces are delicious when mixed

with mayonnaise or boiled dressing.



Apples, oranges, and onions make

a salad combination worth trying, and

the addition of chopped peanuts makes

it even better. Diced apples, grated

raw carrots, and raisins make another

good salad. Apple, celery, and nut





Plan a St. Patrick’s Day Party





OMIC ingenuity may well take

C the place of expensive elabora-



tion for the St. Patrick’s Day

party. The hostess who entertains on

March 17, may easily carry out the old

tradition by decorating her table in

green and white and giving her guests

souvenirs in the form of silk sham-

rocks, chocolate harps, or long clay

pipes.



A clever centerpiece for the table

can be made by dyeing four-inch split

pine sticks with green vegetable dye

and arranging them in rail fence

fashion around the space reserved for

the centerpiece. A few green pigs

should be wandering in this pasture

lot, nibbling at sprigs of shamrock.



A dish of colorful fruit also makes

an unusual centerpiece especially if

topped with an Irish potato whose

eyes are cinnamon candies, whose

nose is an extended row of cloves and

whose mouth is a bit of curved cinna-

mon bark from which protudes the in-

evitable white clay pipe.



St. Patrick’s Day can easily be made

a feast of fun at little expense.



In this connection, the following

suggestions are timely:



St. Patrick’s Day Luncheon





Cream of Pea Soup, Garnished

with Parsley





Croutons ‘

Shamrock Salad T Rolled Sandwiches

ea

Irish Syllabub and White Cake

Mince





Shramrock Salad





2 tbsp. chopped nuts

Dash of paprika.





2 green peppers

1 cup cottage cheese

3 tbsp. cream





Cut off stem end of peppers, remove

seeds, and soak in cold water for ten





minutes. Combine the remaining in-

gredients and pack tightly into the

peppers. Chill and when ready to





serve, slice thinly. Serve three or four

slices on a bed of watercress in such

a fashion as to resemble a shamrock.

Dot with mayonnaise.

Rolled Sandwiches



Remove crust from loaf and cut in

thin slices the length of the loaf with

a very sharp knife. Spread each slice

evenly with creamed butter to which

finely chopped parsley has been added.

For one loaf of bread, use one and

one-half cups butter and three-quar-

ters cup chopped parsley. Roll the

slices and wrap them firmly in a clean

towel. Chill and when ready to serve,

slice each roll thinly.



Irish Syllabub



1 cup heavy cream. 2 cups peach pulp



whipped 1 tbsp. lemon juice

a; cup confectioner's % cup chopped nuts



sugar



C mbine the last four ingredients

and! blend with the whipped cream.

Fill dessert glasses with this mixture

and garnish with cubes of plain mint

gelatin.





 





When oranges are expensive or dif-

ficult to obtain, canned tomato juice

may be substituted for baby's orange

Juice.





salad is well known as Waldorf salad.

Pineapple, celery, and apples go well

together. Sliced apples and dates;

diced apples, oranges, and marshmal-

lows; apples, bananas, and figs or

dates, are combinations which are

favorites also. Any of these salads

may be served with mayonnaise or

boiled dressing on lettuce, watercress,

or shredded cabbage leaves.





WOULD PLAY MORE





 





AM nearly forty years old and

have been a housekeeper for sev-

eral years. Have a family of three





 





 





The Smiling Face of the Jonquil Radi-

ates Cheer on Dull Days





growing girls and a mighty good bus.

band. We are renters and like other

humans have our ups and downs.



As to mistakes, I have made many.

First of all, if I had my life to live

over again I would play more, espe-

cially with my family. There would

be more excursions to the woods or

maybe to just a shady spot in the back

pasture, with a basket_filled mostly

with sandwiches and plenty of cookies.



In my early housekeeping days it

would have been scandalous to leave

for a day right in the midst of a pro-

gram of cleaning. I used to feel quite

guilty when making sandwiches to

take on these sprees. Sometimes I

wouldn’t go, and the children would be

so disappointed.



Does it pay? Yes, for my husband

says it is one hundred per cent for

making even tempers and my little

girls talk and talk about the trips we

have take . hey wash up a big pan

of dishes so quickly while I go about

the other work. They are growing

up to know real fun and will look

back upon a happy childhood—Mrs.

C. P.





HELPFUL HlNTS





 





Brown sugar is preferred by most

cooks for fruit cake or‘ any dark cake.





 





To keep your electric waffle iron}

bright and clean, use ordinary baking

soda and apply it dry.





 





Cut marshmallows inyfourths ‘fwith

sharp scissors and use as a garnish

in bowls of cream soup. .Allow, one

marshmallow to every .thL. .. a





   





 





1.: .4.‘
l

. l

I





In~.aV4‘_>_f;_ s





MARCH. 17, 1928





WHAT WE’LL WEAR on seams

AFTERNOONS





 





IAGONAL treatment of neckline

and waistline, with circular skirt

fulnes's at front, is the latest and most

important movement of fashion. Pat-

tern for this charming dress comes





h V

in sizes 16, 18 years, 36, 38. 40, and 42

inches bust measure. For it, send 13





cents to our Pattern Department.





THE MICHIGAN FARMER





 





Shop Wisely to be Well-Dressed





OR most women, buying is a fas-



cinating game; but the acid test



in playing the game well is not in

spending money but in getting real

value in one’s purchases. The diffi-

culty with most women who just miss

the satisfying, well-groomed appear-

ance, is not that they do not spend

enough money—or enough time even

—but that they have not the right

kind of philosophy about the prin-

ciples of dress. The woman who

dresses in good taste often spends

far less money than the one who has

not a definite understanding of what

she needs and wants.



To understand values and to deter-

mine between needs and desires, re-

quires definite planning and displaces

hit or miss buying which is never

economic. If a girl or woman wishes

to appear well dressed. she will study

her individual style, the lines of her

figure and coloring and in a sense set

her own fashion but on which will re-

flect the tendencies-.of the prevailing

mode and at the same time express

the individual.



One of the principles of correct

dress is that all the garments worn

at one time should appear to belong

together. This is to be more impor-

tant this season than ever, and it is

one of the commonest mistakes made

by women in the selection of gar-

ments.





hat, for the hat’s sake—it’s such a

pretty brown—«but she fails to remem-

ber that it will not look well with her

new green dress—her gray shoes

which she bought because she loved

gray shoes, and her black coat which

she hoped to wear another season.



Consequently she feels quite uncom-

fortable in her clothes because things

do not belong together. To make out

of such a collection a suitable and at-





tractive wardrobe, one must spend'





more money than the woman who is

wise enough to build her wardrobe

about one color. The ensemble in

dress is especially emphasized for the

spring of 1928 and not only colors but





 





Tribes of American Indians.





the teeming urban population





orchard and dairy.





quail, the winter feeding

view of Eastern Oklahoma.





chased here, now, at a lower price





 





You Are Invited to





Come to EASTERN OKLAHOMA





The Inland Empire of Undeveloped Resources





Altho less than 21 years old since admitted to statehood, Oklahoma

stands Well to the front in agricultural production.



The Western half of the state was opened to settlement first, the

Eastern portion being reserved for occupancy by the Five Civilized





Later, as the Indian has adopted the manners and customs of his white brothers,

the surplus lands have been sold and are being brought into cultivation.



The Eastern half of Oklahoma probably has greater resources of agriculture,

oil, gas, zinc, lead, coal and lumber than any other equal area in the United States.

Almost in the geographical center of the nation, with easy and quick access by

rail or hard-surfaced road to such market centers as Kansas City, St. Louis and

Chicago; only a few hours run by rail or motor car to gulf export harbors; with

of Tulsa, Muskogee, and other fast growing

cities, we have an unsurpassed market for all the products of field, garden,





Alluvial valleys of unfathomed fertility—undulating prairies of black limestone

soil—wooded hills and ridges specially adapted for growing peaches, grapes, and

other fruits—limpid streams stocked with many kinds of fish—the home of the

ground of countless wild fowl—this is a panoramic





Based on production values oflicial records show that farm lands can be pur—

than in any of the surrounding states.

Located far enough south to escape the long, dreary winters of the north central

states,-uo't so far south as to encounter the dampness of the lower blississippi

valley, we have here an all year climate that makes life worth living.





We have room for many more thrifty, .

we therefore earnestly and cordially mvrte you to





COME TO EASTERN OKLAHOMA





National Colonization Company





Reference, Chamber of Commerce of State of Oklahoma. Petroleum Bldg"

Oklahoma City, Tulsa Bldg" Tulsa, Oklahoma





COUPON NATIONAL COLONIZATION CO.. Room 123. No. 14 E. 3rd St. ’I‘ul'sa.0kla.

Gentlemen: Please send me at once. free literature and price list of your

Eastern Oklahoma farm bargains.





.........................................................................................................................................





energetic, intelligent farm families, and





Frequently, in an impulsivel

moment, a woman buys a becoming]





fabrics and accessories must harmon-

ize.



The ideal way to plan a wardrobe is

to realize that fewer and better

clothes is the way to appear smart

and well dressed at all times—if these

have been bought with the above

principles in mind—M. Atwood, Mich-

igan State College.





 





SAVE THE SOUR MILK





 





HAT hall? a. cup of sour milk or



cream too often goes down the

sink-drain instead of being used in a

delicious cake or a loaf of brown bread

for supper. In many kitchens, sour

milk is allowed to stand about while

the cook hopes for an inspiration as

to how to use it. Finally it becomes

too old and is thrown out.



But sour, like sweet milk, adds mate-

rially to the nutritive value of any

food of which it forms a part. More-

over, sour milk and cream are neces-

sary ingredients in a large variety of

delicious recipes for breads, cakes,

cookies, doughnuts, salad dressing,

sauces, and waffles. The thrifty house-

wife uses every drop of sour milk

and keeps on file a little collection of

sour-milk recipes which she has tried.



If you would like a group of recipes

that require sour milk or cream, send





   





25—391





a. stamped addressed envelope to

Desk A, of this department—Martha.





 





FINDS CHICKEN PROFIT IN SOUP

AND SANDWICHES





ATHER was not pleased when he



learned that the city wanted a part

of our timber pasture for a tourist

camp. I said, “Rent it to them or

sell it—any way to bring the tourists

near enough to sell food to them.”

Reluctantly he sold the desired acres.

Now we have tourists with us in

droves during the whole season.



After giving the subject much

thought, I decided to specialize in hot

noodle soup and chicken sandwiches.

I chose noodles and chicken because

I wanted to give them something that

they could not get in town. Also, I

raise hundreds of chickens every

year. By the time the tourist season

opens, my hens have laid their eggs,

raised their brood and are ready to

be sold. These and the young culls,

I sell at a good profit in soup and

sandwiches—Miss H. A. S.





 





A RELIEF





 





Doctor: “As I said, you’ve just re-

gained consciousness after an automo-

bile wreck. I’m Dr. Peter and—”



Victim: “Oh! Are you quite sure?

I thought you might be St. Peter.”





 





 





 





have served for twenty years

“getting along" with them.





 





its uniform excellent cooking.





\\%\\_

\ . .





——/-“-.:"—3' ‘

ZZCAT





 





 





H._.______.____—-—._.___A.._A.. NV . . .v .





Name ................

R. F. D or Street No ..............





City or Town ....................





 





 





tolerate flan.





0ut~0f~ date. range ?





THERE ARE, in so many farm homes, ancient kitchen stoves that





or more—housewives are still





These stoves were perfectly satisfactory before kitchen com,

fort and convenience were thought of. They gave fine service when

wood lots were bigger than the cornfields.



But now! Economy must be considered because fuel today costs

money. Comfort and convenience are vital, because women are

finding that the kitchen, the most used room in the house, can be

made a pleasant, cheery place in which to work. How? By getting

the best and most uprtodate range, because a range, you know,

is used more than any other item of home equipment.



This very modern range, the GLOBE, combines oldrtime principles

of perfect cooking (possible only on a. coal and woodvburning range) with

its many modern and exclusive features. Its new ideas in economy, and





convenience and comfort are unequalled today. The GLOBE Cast Iron

Range is beamiful, too. You‘ll be proud of its good looks, and proud of





The GLOBE STOVE €99 RANGE 00., Kokomo, Indiana

\\\\\\\\\\\\\ild////////////////%/





RANGES





/////////////////////’ I' l \\‘\‘\\\\\\\.\‘\\‘\\<\\\\\





Tun GLOBE Srovs AND RANGE Co. 405 Broadway, Kokomo, Indiana.

Gentlemen: I am interested in hearing more about this modern range that is

revrvmg the oldrfashioned art of good cookery.





.................... coco-coon...-





............. State................





/

E763

f;





R

%





 





 





 





 





 





LET YOUR DEALER SHOW YOU HOW TO OWN A GLOBE _
The whole world knows Aspirin as

an eliective antidote for pain. But 52":

7.145! (15 wiper/(mt to know t/mt t/zere is

on/v one nguine Bayer Alspz'rz'n. The

name Bayer is on every tablet, and on

the box. If it says Bayer, it’s genuine;

and if it doesn’t, it is not! Headaches

are dispelled by Bayer Aspirin. So are

colds,and the pain that goes with them;

even neuralgia, neuritis, and rheuma-

tism promptly relieved. Get Bayer—at

any drug store—with proven directions.





Physicians prescribe Bayer Aspirin;





it does NOT effect the heart





Aspirin is the trade mark of Bayer Manufacture

of Monoueticacidester of Sslicylicscid





 





New FREE



hoowk quotes Reduced



Factory Prices. 5- Year



Gunarantee Bond

scl‘hlrna 9.5 200 thlcsnnld



sizes. eEeautifucle orcelnin enamel



ran on and com instion gas and

gee. Mal] ogsny porcelain

enamel heat ing stoves.

Cashoreasy terms. 24- h.

shipments 80 0-day Ireo

tri 3.] 360- day test. Satis-

faction guaranteed. '6

years in business. 650 000

customers.





rFREE





Kalamazoo Stove Co.

Manufacturers





in Rochester Avenue

Kalamazoo. Mich





Kalamazoo. .

. 1:. Direct to You'





STRAWBERRIES i~2I?i1”°lI%3°°.r“%§l¥§





Plants. Grape Vines, Fruit Trees. Ornamental Shrubs.

and Bulbs. Largo stocks; low Dl‘iI-PH. 38 Years- ex-

pericntc. Write at once for free illustrated catalog

giving big discounts for early orders.



1. N. ROKELY & SON, Box 6. Bridgman. Michigan.





Loosen Up

Chest Colds





Just Rub

AwayDanger





When your lungs

are congested and '

you have shocking

cough watch out!

RubMusteroleonthe

sore spot. There’s

nothing better for

quick,safe relief.

Musterole pence

trntestheskinbring-

ingasoothing,cool- 2’

ing sensation and welcome relief.

Recommended by doctors and nurses,

Munterole relieves cold in chest, sore

throat. bronchitis, aches and pains in the

back and joints. Keep Muster-ole handy.

To Mothers: Musterole is also made

in milder form for babies and small

children. Ask for Children '3 Manuals.

Jan &. Tube.





 





 





 





 





 





 





 





BITTER THAN A MUSTARD PLASTEB





 





 





Use this department to help solve





your household problems. Address

your letters to Martha Cole, Michigan

Farmer, Detroit, Michigan.





 





JOHHNY CAKE LIKE MOTHER

USED TO MAKE





I would like a recipe for the good

old-fashioned Johnny cake. I have

tried several recipes but they do not

taste like mother used to make.—

Mrs. H. B.



There is a number of ways of

making this kind of cake. This one

was contributed by one of our read-

ers who signed herself “Seventy

Years Young.”



Cornbread

‘3 cups corn meal 2 tbs. shortening

2 tbs. «Igor L: n-ggs, beaten





l“; tsp. salt 1 tsp. soda.

1: runs sour milk 1 tb. cold water





Mix the first 5 ingredients in the top

of a. double boiler and cook for five

minutes. Let cool, add well beaten

eggs, and soda dissolved in the cold

water. Bake in a shallow tin in a

moderate oven for twenty-five minutes.





MEALY BUG ON OLEANDER





I have had an Oleander house plant

for eight years which always bloomed

but this year it looks sickly. Some-

thing is forming on the stems which

looks like cotton batten and is sticky.

I tried to wash it off with unfavorable

results. I also have a smaller plant

which is the same way so I don’t think

the trouble lies in the soil. Vt’hat kind

of manure would be the best to use

101' plants to make them grow better?



L.





1





The cottony substance that is form-

ing on your Oleander is the mealy

bug. It may be eradicated by spray-

ing with a. preparation known as





Volck, which can be secured from any





seed house. I would not advise the

use of household ammonia for plants.

It is true that plants rennin: nitrogen.

but not in the form supplied by the

ammonia. I would suggest that you

get either a. preparation known as

Plant Marvel or Plant Tabs. Either

may be secured from your local florist.

The directions come with the mate—

rial. It is easy to apply and safe if

used in the doses recommended—Alex





GERANIUM DOESN’T BLOSSOM





A year ago we bought a. Martha

Washington geranium that blossomed

so much I finally picked the buds off

as the flowers were getting to be very

tiny and I was afraid the plant would

die. The plant has grown quite large.

Can I do anything to make it blossom

again this spring‘?— S. P.



Your Martha Washington will blos-

som again this spring if you apply

some complete fertilizer to it regular.

1y. I would suggest the use of Plant

Marvel for the purpose. It may be

bought from your florist. There are

other preparations of similar nature.

It would be desirable to set this plant

out-of—doors during the summer and

make cuttings from it late in the sea-

son. They root readily in sand and

will give you fine plants for next year.

———Alex Laurie.





LICENSE TO SELL





If I sell home baked goods in my

own home, would I have to obtain a

license?——H. I B.





We are not aware of any regulation

outside of local ordinances requiring

any license—Rood.





 





 





 





STATE SECRETS





There is an old fashioned conundrum,

You may have heard somewhere;

“If Miss Ouri wears Mis’Sippi’s New



Jersey,

Now what can ——?”





 





 





 





 





 

 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 





 

 

 

 





 

 

 

 

 

 





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





 





 





LITTLEcFoLKs





for all school districts.





 





The pieces of this puzzle when cor-

rectly put iogcthcr, make a. map of

the state which this verse describes.

The star indicates the capitol. When

you have solved the secret of which

state this is, write me all you can

about the state and its capi101.~—-Aunt

Martha.





The answer to last week’s secret

was California and its capitol is

Sacramento.





va0 AM I?





AM a. cheery little bird just five



inches long and I wear a jet black

cap. My throat is black, also, but my

wings and back are ashy gray. On

cold winter mornings I fly to your

window sill and beg for food.



It makes little difference to me

Whether I am right side up or not.

One of my favorite stunts is to hang

with my head downward from the tip

of a branch while I am busy picking

out seed or searching for insects’

eggs. I am the farmers’ best friend

for best of all I like canker worms for

my dinner. _



I build my nest in knot holes and

line it with moss and soft feathers.

Sometimes I appropriate the wood-

pecker’s last year’s nest. What am I?



(The answer to last week’s bird

guessing contest was the white

breasted nut hatch. Did you guess

rightly? \Vrite a letter and tell some

of the things you know about our

feathered friends—Aunt Martha).





 

 

 

 





Forty-two states have enactments

requiring school medical inspection,

but only sixteen make it compulsory





 





“ MARCH 17.1928





on: i





or THE MANY ,

ISBELL

Write fr

SPECIALTIES THIS BOOK





This' 18 only one of many

famous lsbell specialties described in





Isbell’s 1 928 Seed Annual





-contains over 400 illustrations from our

own photo dgrsphs—28pagesintrue-to-nature

colors an ccumte descriptions of best‘

varieties of Northern Grown field, rden

and flower seeds. Tells how and w co to

plant for best returns. Quotes direct from

grower prices on Bell Brand Quality Seedl.

Write today. It’s FREE.





5. M. ISBELL &c0., Seed Growers

126 Mechanic St. Jackson, Mich. 11





 





 





soul’s. EARLY Bino‘





   

 





 





 





 





 





MEDICINAL





HERBS





AND ROOTS





Used and recommended for the treatment

of scores of ills and diseases. We have the

particular root or herb that has been recom-

mended to you—all finest quality and abso~

lutely fresh. We are known to a million

customers as America's largest growers and

importers of medicinal Herbs and Roots.





Send for complete list of more than 1000

kinds and varieties. Write lor full panic.

ulars. Ask for a copy of our





64-page illustrated

FR HERBAIJST

1928 almanac





Filled With up-to—date interesting and val-

uable tacts. Our supply of these books is

limited. Send today. Address





INDIANA BOTANIC GARDENS

Box 5 HAMMOND. 1ND.





z57TANNlNGHIflES





9uwleoeawaze£mzeza

IJFF





 





 





Better w o r k --- better service

direct to you at agmts' prices.

Tanning horse and cow hides,

$3.50 to $5.50. Ship where thou-





 





 





   





WR’IT E sands of others are shipping

FORFREE Emil saveR2g%. Y‘Vidte for nudges

I’l ll

CATALOG a gel-Stages: aPoini,ailiilsri° 0

Gel Low Prices

on Berry Boxes

. and r

INllIIINllllllllllllllllllm Baskets





 





l' 0 to] l Sh Wrilzforoqu‘l"

ree I o; owsyou owy



can save money b flying direct

from the largest on: and

Basket Factory in them Chantry.





New Albany Box & Basket 00.. Box "2 New “Mink“.

M ETA I... I





EDWARD ROOFS





LAST LONGER LOOK BETTER’





AVE YO

SMON EYU"





Edwards Metal,

roofing, . shingles, .

Spanish tile, sid-’

ings, ready-made

. gun a and farm

. buildings, are rust.

/, proof, firo- proof-

Kw lightning- proof. Last

//,1 /three times as long as or-

/ dlnary kind. Quality in ev-

ery detail. Styles and types for

every purpose. Easy and economical

to apply. Lifetime satisfaction.



We are the world’s 1 eat manulactums or sheet

metal buildin mmrlrlo. We control every op-

eration from a row metal to thennl shed woductu

You can buy from“ us at monuhcturer’o prices 3nd





intern d1 mow

Write ”today for :w‘tllmpsm-u

FREE m m,

samruz locum. .





or (or

Books on - ..

B‘oti‘mdtoo ~.‘





 





 





 





 

 

 

 





 

 

 





 

 

 

 

 

 

 





 





 

 

 

   

   

 

 

 

 





 

 

 

 

 

 

   

 

 

   





 

 

 

 

 





 





 

 

 





 





 

 

 





 





 





 





. A". ~z—_:~.¢;~<; ,
.MARZCH 17,1928





n





 





 





THE MICHIGAN FARM'ER





 





 





 





White Diarrhea i





Remarkable Experience of Mrs.

C. M. Bradshaw in Prevent-

ing White Diarrhea





 





 





The following letter will :no doubt be





i





of utmost interest to poultry ‘raiserS!





who have had serious losses from

White Diarrhea. We will let Mrs.

Bradshaw tell of her experience in her

own words:



“Dear Sir: I see reports ‘of so many





losing their little chicks with White.





Diarrhea, so thought I would tell my

experience. I used to lose a great

many from this cause, tried many

_ remedies and was about discouraged.

As a last resort I sentto the Walker





_'L





Remedy Co.,- Dept. 510 Waterloo, ‘

Iowa, for their Walko White Diarrhea =





Remedy. I used two 50c packages,





raised 300 White Wyandottes and.

never lost one or had one sick after .





giving the medicine and my chickens





are larger and healthier man ever be- '





fare. I have found this company





thoroughly reliable and always get the .





remedy by return mail.——Mrs. C. M.





Bradshaw, Beaconsfield, Iowa.”





 





Cause of White Diarrhea





White Diarrhea is caused by micro--





scopic organisms which multiply with

great rapidity in the intestines of

diseased birds and enormous numbers

are discharged with the droppings.





Readers are warned to beware of White '





Diarrhea. Don’t wait until it kills half

your chicks.

that saves nine.” Remember, there is

scarcely a hatch without some infected

chicks. Don’t let these few infect your

entire flock. Prevent it. Give Walko

in all drinking water for the first two

weeks and you won’t lose one chick





Take the "stitch in time 1





where you lost hundreds before. These .





letters prove it:





 





Never Lost a Single Chick

Mrs. L. L. Tam, Burnetts Creek,





Ind, writes: "I have lost my share of :





chicks from White Diarrhea.

I sent for two packages of Walko. I

raised over 500 chicks and I never lost

a single chick from White Diarrhea. Walko

not only prevents White Diarrhea, but it

gives the chicks strength and vigor; they

develop quicker and feather earlier."





 





Never Lost One After First Dose



Mrs. Ethel Rhoades, Shenandoah,

Iowa, writes: “My first incubator

chicks, when but a few‘days old, began

to .die by the dozens with White Diar-

rhea. I tried difierent remedies and

was about discouraged with the chicken busi-

ness. Finally, I sent to the Walker Remedy

(20., Waterloo, Iowa, for a box of their ‘Walko

White Diarrhea Remedy. It's just the only

thing for this terrible disease. .

thrifty, healthy chicks and never lost a single

chick after the first dose.”





You Run No Risk ‘

‘We will send Walko White Diar-





 





Finally .





We raised 700 .





rhea Remedy. entirely at our risk—.





postage prepai you can see for





yourself what a wonder-working rem- '





edy it is for White Diarrhea in babyj





chicks. So you can prove—as 't‘hou-





sands have proven—tha‘t it will stop.





your losses and double, treble, even

quadruple your profits.





Send 50c for?





package of Walko (or $l.00 for extra large box) '

——give it in all drinking water and watch results ’





You’ll find you won’t lose one chick where you

lost dozens before. It’s a positive fact. You

run no risk. We guarantee to refund your

money promptly if you don’t find it the greatest

little chick saver you ever used. The Pioneer





National Bank. the oldest and «strongest bank in .





Waterloo, Iowa, stands back of our guarantee.





Walker Remedy Co., Dept. 5l0 Waterloo, lmva ,





 





Just Try a Michigan Farmer





Liner for Quick Results.





 





Potato

lanter-





Incream Yield—Lower: Labor Corr



Pays for it»)! many times over. One man and team



, opens lurrow. drops need any distance or depth, drop.

tortillur (it-desired), conrl up. mun next row. Au-

tomatic. lose neonate. dependable and quicker than

hand planting. Iu rrowopcna and needing: In plain ~

sight. Dournot injure and. Ban [on lib. needs kw

repairs. Sites for I or 2 rows. from you null-I

”unit!” and coau- 'lavuuuu In. ,





erie for Carob: ,,





 





: handle and run light straps from each

. and to a point on the handle about,





‘ advantage that it pulls the droppings

. into the container without spilling





‘We keep permanganate of potash in





'wrong with heart, lungs, liver, ctc.,'

, but where Wind pipe enters lung there.





» material is accumulating and prevent-

_ ing natural breathing.





‘ pipe of a. bird that is breathing hard





* the obstruct-ion and save the bird.





- soon had fits and died.

' it did no good.





; one turkey in three or four hours

times—Mrs. J. W. M.

Scientists have determined that





. blocks for their salt supply but the;





 





Poultry Department





 





 





FLOCK SN EEZING





 





The pullets in one of our laying

houses have been sneezing for a week.





the drinking water but they are not

improving. We removed one that had

such difficulty in breathing and killed

her. I examined her, found nothing.





seemed to be an obstruction on closer,

examination. I found the air tube;

had collapsed and for one-half inch:

Was hardened like bone.~Mrs. ‘C. S.





When most of the hens in the flock

begin to sneeze and appear to be

catching cold, it is probably due to

general conditions such as a drau-ghty

house, lack of ventilation, overcrowd-

ing or damp litter. The first step

should be to correct such conditions if

they exist. ,



Individual treatment for the colds is

the next step. Examine each bird and

press the mucous from the nostrils

with wads of tissue paper if such





Then inject

commercial disinfectant, roup cure, or

strong potassium permanganate solu-

tion with a. medicine dropper or one

of the small syringes commonly fur-

nished with commercial roup cures.





to dry up the colds.





The use of potassium permanganate

solution in the drinking water fur-





‘help prevent colds from spreading

through the medium of the drinking

water. But when the nostrils are

clogged, individual treatment is usu-

ally necessary to cure the cold

quickly.



The obstruction in the wind pipe

may have been a hard accumulation

of canker which was gradually shut~

ting off the breath and strangling the

bird and causing an inflammation in

the wind pipe. By examining the wind





it is sometimes possible to pick out





SALT POISONING





 





thing that can be done for chickens

and turkeys that have eaten salt.

When feeding the cows

sprinkled salt on them and the chick-

ens and turkeys ate some of it and





I lost 9 chickens and





twenty-five grains of salt per pound of

live weight will kill a hen. When

poultry have eaten a large quantity of

salt there is little that can be done to

help them. The condition is not

usually discovered until the birds are





dead. A large dose of castor oil might

be helpful in some cases. lfnlike the





up poisonous materials which cause

sickness and for that reason the sys-

tem is soon filled with any poisonous.

substance that is eaten. When live.





‘stOCK must be salted on a range or5_





around buildings frequented by poul-j

try, I think it often pays to use the.

hard salt blocks. The cows lick the.





blocks are very hard and loose salt





 





DR'O PP’ING BOARD HOE





 





(Continued from page 368)

ends, are about seventeen and one-half

inches apart. Bolt the center to a.





twelve inches from the socket end.

This curved hoe covers more space

than an ordinary hoe and has the-





 





Several treatments may be necessary,





nishes a mild disinfectant which may





Would like to know if there is any— '

grain, I‘





I gave oil but "





quite thoroughly poisoned and nearly ,





dog, the hen has no way of throwing ‘





is not readily broken off and eaten by. -

3 poultry.





Good Stock





Ration





Forpou‘ltryprofits,something more

must be added. That “something

more” is Pilot Brand Oyster Shell-

Flake. More than 98% pure Cal,

cium Carbonate eggshell material

that every hen must have to pro-

duce beyond a losing lay. Your

best efforts, and your profits, too,

are lost without Pilot Brand egg-

shell material for your hens.





Meatier, stronger-

bonecl fowls also result





 





Good Housing

Good Balanced





 





and Cleanliness





END U G H 3

is kept before them all the time.





To find out how inexpench Pilot

Brand really is, just figure an in-

creased egg output of 30 eggs .1:

year per hen against a cost of 3c

per hen!



Profitablewhen fed to babydiicks,

too, because it helps to bring them

to a healthy maturity.



‘Punfied and triple screened

Packed in adult and

chick size.





 





Sold Eveiytulsere





0351']!!! SHELL PRODUCTS CORPORATION

shell Building, St. Louis, Mo.





 





 





 





fOEfAR

SUPERIOR





 





flocks.

hens.





 





M;





P.— .._.- _ - --._





 

 

 

 

 

 





the ability to make heavy layers. They

have established an enviable reputation

on commercial poultry farms and as farm

The male birds used in these matings are from known record

They are also Michigan Accredited.



We guarantee 100% live delivery at the above prices and stand

squarely behind every transaction.

Our big 64 page catalog fully describes our modern breeding plant.

The largest in Ottawa County. Superior Michigan Accredited chicks

will make your poultry income safe.





Superior Poulh‘y Farms, Inc: Iceland, am: soo. mm.





Locks,





 

 

 

   





Your'

farm flock Su-

perior Commer-





' cial mated chicks are

especmlly adapted. These

rugged easy to raise chicks have





 

 

   





We also have a special grade.





Write today.

6. J. DeKOSTER. Mar.





 





 





 





 





 





 





13.3%,; i'NSP-ECI-ION (,1 -"\





 

 





 





 





them off the edge—Henry R. Zelley.





t.‘

REHABLE P0 LIRY em I; HATCHEBV.





MIMI. MM!» R.





DAY OLD CHICKS





from 8 proven breeds: heed 81 years for hi or "

production at wholesale prices from intro—brill!h stoeclgrn

Direct from the farm to your door. Prices for March.

April until May 16 deliveries:





 





0

Per 25 30 1

magnon Strain S. C. White 800 .000

_ ‘3 ms ..... $3.75 $7.50 $111.00 $07.50 5.00

o . , Tom Barron & Hollywood Strain S. 0. White» $13 .

. . Legimms ..... 3.50 7.00 13.60 82.90 ”0.00

W ,> Reliable & Beam Stzrgin S. C. White

. Leghorns ..... 3. 0.50 12.00 cm 111m

Imam Slain S. O. luconss, Special Mating ..... . .............. 3:50 7.09 13.99 «am 1mg};

Shannan! Strain s C. Ancenas. Utility Mating. ................ .... .315 6.50 12.00 um um.»

Rose Comb White Wyn-mm. Evergreen Strain ...... . .......... . ....... 4.75 9.00 17.00 80.00

Broilers or Mixed (Hunks ............................................. 2.75 4.75 9.00 45.00 at“ m

A special discount or 9% on all orders remived. 30 days or more in advance 1 N-nt- nm- vhh-k withmu --

Bill. 10 days helm chldks are to be shipped. 100% live 8W guaranteed. l'U-‘Hmid- W'lte “’1' "'4'

1928 Plum. I s free and instructive. Reference. Roland Stale Be ‘





nli.

I. Box 4;}. The home of quality.
FORE HOLLYWOOD WHITE lEOIIOIlIIS .

Get Our Egg Bred From Nationally Known Blood Lines Che!“

1928 MICHIGAN ACCREDITED. 1926 Contest Pen Averaged 2:9 588‘

FREE Eggs each. Customers profit $3.00 per bird. Pallets

Catalog We Also Breed Anconas and Barred Rocks H°n‘

WYNGARDEN FARMS & HATCHERY, Box M, Iceland, Mich.





 





 





 





 

 

 





It. will pay you to investigate one of Michigan's oldest and best; hatcherias. Twenty

years' experiences. Every chick hatched from rugged free range breeders officially

accredited by inspectors supervised by Michigan State Poultry lmprovemmt Associa-

Lion. Large percentage of business to satisfied old customers. White Leghorns {Eng-

lish type and American). Barred Rooks. Anconas.





“Never a Bum Lot In Sixteen Consecutive Years”

to writes a. custmner who has been purchasing chicks from us for sixteen con-

sequive years. Some record, you'll agree. Your Michigan Accredited (hitks '

bought of this old reliable concern with an established reputation for square dealing are sure to please.

Get our Free catalog that. bells all.





Holland Hatchery & Poultry Farm V“ have” 3"“ Holland, Mich.





 





._ Hollywood and Tancred Strains 331:: English

Type, S. C. White Leghorns





Also Bmwn Leghorns. Anconas, and Barred Rocks. All large type Production Bred birds.

Bred for 15 years for heavy commercial egg production. Every bird individually banded

and inspected by an authorized Inspector. In breeding up the Famous Townline Egg

Laying Strain. we hare bred. not for a. few high record hens only but for HIGH FLOCK

AVERAGES Our Direct from Farm to You Method sates you 5 to 10 cents per chick on this High Quality

Stock. FREE (ATAI 0G tells how We hatch, breerL cull. inspect. and raise our stock Tells what to

feed and how to be successful. Full instructionson the Care of Baby Chicks. A genuine Poultry Guide.

Write us.





TOWNLINE POULTRY FARM, Route 1, Box 207, Zeeland, Michigan





HIGHLAND LE GHORNS





Every breeder carefully selected for size. t.ypd and

egg production. Muted to males of 200 to 300 on

pedigreed amestry.





CHICKS SHIPPED C.O.D.





Sue your chicks before you pay for them. We

know you will be pleased and we are willing to

take all the risk. This assures you of 100% live

delivery and shipment exm-tly when you specify.





SPECIAL DISCOUNT NOW!





On all orders for chicks booked this month we give a big discount. Get our new

valuable catalog which gives complete details. Write fort copy today.





   

 





 





 





 





DILIGENT CHICKS DID IT





and will do it for you.





Your Dll. IGENT (HICKS berame DII IGENT L'ZAIIRS and beat them all

in our neighborhood enter order for 500 March delivery, a IIISIOIIIOI‘ just wrote

us. Do not hesitate to send your order. You will be satisfied. Thirteen

Years of honest dealing behind us. l’ullcts after May first. Please note our





NEW LOW postpaid prices: -



. 50 ' No 200 500

Single (.‘omb White Leghorns .............. $5.75 $11.00 $21.50 $52.50

Barred Plymouth Rovks ........ 14.00 27.50 67. 5)

S. C. Rhoda Island Reds ........ 14.00 27.50 07. 50





 





Mixed (Heavies 0:1in .................... ‘I 12.00 23.50 57.50





DILIGENT HATCHERY AND POULTRY FARM

Harm .I. Knoll, R. R. No. 4 HOLLAND, MICHIGAN





 





 





   

   

 

   

 

 

 





CHICKS C. 0. D. SEND ONLY $1.00





Our chicks are from leg-banded Itock selected by expert poultryman. You can

feel rate for you know every chick is up to highest standard for egg production

and breed type. Get our special wholesale price on hrooder stoves when bought

with chicks. SEND FOR OUR BIG CATALOG. It tells all about our podi-

greed males and special pen matings. Alto give: details about our high

producing utility birds. Valuable book free with each order. Price: remn-

able. Write today.



WOLF HATCHING 8. BREEDING CO. BOX 42 GIBSONBURG. OHIO





ACCREDITED WHITE LEGHORN CHICKS





Hollywood and Hollywood sired from 200 to 290 egsg otock aorad comrrgercial stock





 





 





00 LOW

Star Matings ................................................... $7.75 $15. 00 $72.50 $140.00

Utility Marinas .......... . ................................... ... 0.75 13.00 02.50 120.00

t'ommeircial )latings ............................................ 5 :25 10. 00 47.50 90.00

Left Overs $8.00 pir 100. Order dirt-IL from athwerrtistmtnt Send 10% with order. balam-e one week





We guarantee 100% live delivery by prepaid I’aI'HLtl Post. Prompt. shipment on date





R. 4, Box 40 ZEELAND, MICH.





he! ore shipment.

desired.





M. D. WYNGARDEN

w PURE BRED BABY CHICKS QUALITY





100% Live Delivery Guaranteed. Send for Free Catalog and Price List

Prepaid Prices for 25 50 100 200 500 1000



White Leghoms, Black Minorcaa . . . . . $3.50 $6.50 $12.00 $23.50 $57.50 $110.00



- . . . 3.75 7.25 14.00 27.50 67.50 130.00





While, Barred and Buff Rocks



Single and Rose Comb Reds

Member A. B. C. P. A. Our 22nd Year

BOX D TIFFIN. OHIO





 





 





White Wyandottes, Buff Orpingtons

S. S. Hamburgs. 16c. Assorted Breeds, 106.





THE LANTZ HATCHERY





MICHIGAN ACCREDITED CHICKS





Buy your chicks from heavy laying flocks that are officially accredited by in-

ectors supervised by Michigan State College and of prize winners at the



I-Ib Iland Poultry Show. having the best display on Barred Rocks in the re.



duction class. White and Brown Leghorns, Anconas, Barred Rocks, S. C. 13. I.



Reds. 100% live delivery. Postpaid. Send at once for free catalogue. Full



particulars and detailed prices.



HILLVIEW HATCHERY, C. BOVEN, Prop., HOLLAND, Mich, R. 8, Box M





'I'IIAOE MARK OF QUALITY OHIIIKS





 





 





 





     





naOWHEA

R OOULTRyo





FA RM Wh. and Br. Leghoms. Bl Minorcas ........... ...... .... .......... $12. 00 per turn.

Barred and Wh. Rooks, S.(‘ ,. and R. (‘ Rd. 1. Beds ..................... $14. 00 per hun.

Wh Wyandottes and Butt Oruingtons .................................... $15 00 per mm.





Ten per cent discount on orders of 500 or more. Three weeks old chicks add ten dollars

per hun. Baby Wh. I’ekin. DuI-.lrs Geese and Turkeys $1. 00 per huh. holds nipping

date, bnlam-e C. O. I). Order dim-t from ad. or write for folder.





ARROWHEAD POULTRY FARM





HatohorIoo at Montrooo, Birch Run and Lapoor, Mlohlgon





 





.THE' MICHIGAN FARME‘R'





MARCH 17, 1928





March Poultry Notes





By R. G. Kz'réy





'OME poultrymen seem to have suc-

cess in preventing toe-picking by

suspending colored buttons from



the ceiling of the colony house so

they will dangle near the edge of the

brooder canopy. The chicks pick at

the buttons and it has a tendency to

take their attention from each other’s

feet. When a chick becomes bloody

on the toes or around the tail it often

helps to paint a. little engine oil over

the wound. The chicks do not like

the taste of the oil and stop picking

at the wound.



Irregular feeding and hunger some-

times start toe-picking. If the chicks

are used to receiving scratch grain at

a. certain hour they learn to expect

it. If they are hungry and the feed

does not arrive they turn their atten-

tion to other things and if one chick

has its feet picked until blood shows,

other members of the flock. may drag

it around the brooder house while

I‘avenously fighting for the blood.



Keeping mash before the chicks at

all times seems to help in preventing

the toe-picking habit. Plenty of water

or milk to drink at all times is another

help. The problem is to keep the

chick’s appetite satisfied and keep it

interested in the right kind of feed.

Then there will be few chicks with

bloody feet. If any chicks are badly

injured it pays to isolate them from

the flock as their removal will aid in

stopping the habit.



Ooal Burning Brooder Stoves



We have the best success with coal

burning brooder stoves by purchasing

the large sized stoves often listed as

the 1,000-Chick size. Then place about

300 chicks around the canopy of such

a stove and you have a good combina-

tion. The 1,000-Chick size bI-rooder

will furnish enough heat for 1,000

chicks or more but that is too large

a. flock for most poultrymen to handle

in one lot and often results in a high

mortality rate and a lot of Chicks

stunted and weakened by crowding.



\V‘e find that in cold weather it pays

to empty the ashes twice each day.

This helps to prevent clogging of the

grates and the poultryman can always

be sure that the stove contains plenty

of live coals and fresh fuel. Too often

a. beginner finds that the stove burns

very nicely the first week. Then the

ashes are not thoroughly shaken down

and gradually they bank up around

the edges of the stove and reduce the

heat as well as the surface of live

coals. Some night the fire dies down

and it results in a lot of chilled chicks.



If small sized coal burning brooder

stoves are used they must be given

very careful attention as they clog

more rapidly with ashes and burn out

more quickly than the stove with

ample fuel capacity.



Care of Stoves



It is safest to shake down the

ashes and then leave them in the pan

until the next time the stove is given

attention. By that time the ashes

have cooled and no small red coals





will be apt to drop out of the grates

and roll into the brooder house litter.

Then the ashes can be emptied with-

out the danger of spilling hot ashes

and the pan can be returned and the

stove given another careful shaking.





After a stove has been operated a.

few days the ashes will gather in back

of the pan and around the edges. it

pays to keep a small shovel handy

to gather up these ashes or the pan

is gradually shoved forward until it

prevents the secure closing of the ash

pan door.



The most danger from overheating

a coal burning brooder stove occurs

when the fire is first built with wood

and papers. Then the pipe may be-

come very hot for a few minutes.

After the coal is added to the fire the

pipe will become baIely warm and

the coal fire will only heat the area

near the floor around the broader can-

opy. Be sure to watch the fires care

fully when they are first; started as

the wood kindling seems to make a

much hotter and more dangerous fire

than the coal.





Hoppers for Chicks



Feed hoppers five Ieet long and

open on both sides will give ten feet

of feeding space and that is about

right for a brood of 200 chicks. A

foot of space to each 20 chicks seems

to give plenty of space to preventing

overcrowding. The strong chicks do

not waste their energy in walking all

over each other and the weaker chicks

are not crowded and under'fed 01'

forced to fill up on sand and litter in

an attempt to satisfy their appetites.



According to our experience the

commercial metal hoppers which pre-

vent the chicks from walking in the

mash will give the best results. \Ve-

have tried open hoppers with a piece

of hardware cloth 01' one-half inch

mesh gravel screen laid over the mash

to keep the chicks from scratching out

the feed. They do nor scratch out

the feed and they can see it. readily

but the wire screen soon becomes

caked with droppings and forms a

rather unsanitary feed hopper.





Home-Made Hoppers



If home-made chick feeders are

used, I think they should be con

structed along the lines of the gal-

vanized iron commercial hoppers. The

chicks can take the feed from between

upright slats but no droppings will

then fall in the mash and possibly

spread disease. If the chicks do not

readily eat from such hoppers for the

first few days, the mash can be scat-

tered on newspapers or magazines

and a. clean sheet used for each feed-

ing.





At the Ohio Experiment Station

legume hay chopped or recut to 1,; or

1/2 inch lengths seemed to produce the

best results. Such hay prepared in

this way could be fed in the mash I'a-

tion or could be offered to hens in

wire netting feeders.





 





SUCCESS.





 





 





Succeed with Chicks





by learning chick raising essentials from





Michigan Farmer Chick Bulletin





Describes short practical method of raising chicks which assures





Has been approved by poultry experts and practical poultrynien.

Contains unique labor-saving feeding method, suggestions on dis-





ease prevention, and many practical hints in care and management

which make a big difference in results.



Send Serf—addressed Stamped Envelope to

Poultry Dept., Michigan Farmer, Detroit,'Mich.





For Your‘ Copy
MARCH 17. 1928





Common Poultry, Disascs

' III—Chicken Pox





HERE has been considerable confusion'concerning the symptoms of



some chicken diseases. Formerly, colds were thought difierent from



roup, and diphtheria was classed as roup. Certain other symptoms given

as of roup are now called indications of chicken pox. Now roup includes

colds, and chicken pox includes diphtheria, the latter being classed as a form

of the chicken pox disease.



Chicken pox is an infectious disease often resultingiin serious losses.

Filth or improper feeding are not factors in its cause. It is found in many

kinds of fowl including turkeys, pigeons, geese, ducks, guinea fowls, wild

pheasants and quail. It may be spread by direct contact with diseased birds

or by discharges from affected individuals into feeds, water, etc. Exhibition

birds often bring the disease into the flocks, or people may carry it from

one flock to another. Even animals such as cats, dogs, and wild birds are

means of dissemination.



Symptoms—The disease mayvappear in three forms: (1) A skin trouble

with wart-like tumors or scabs appearing on combs, wattles, ears or skin of

the head, and sometimes on other parts of the body. These scabs first

appear as whitish spots or elevations which gradually grow larger, get

yellow and finally nearly turn black. It often takes three weeks for the

scabs to develop.



(2) It may be a pure mucous membrane development .in which grayish

or yellowish-white cheesy masses develop in the mouth and throat as well

as the eyes. In some cases, the eye infection is only present and in others

only the throat is troubled. The mouth and throat patches vary from the

size of a pin head to covering almost the entire oral cavity and are symptoms

of what is often called diphtheria. The eye infection starts with a thin dis-

charge which thickens and accumulates under the eye lids, gluing them shut

and producing a bulging of the eye.



(3) This is a combination of both the skin and oral cavity forms.

The skin trouble alone often causes the birds little discomfort, but with

the oral cavity affections, distress is more evident. When the mucous, or

inner membranes, become troubled, there is often a clear mucous discharge

from the mouth or one or both eyes. This is accompanied by difficulty in

breathing which grows worse as the patches in the mouth and throat. increase

in size. There is often a rattling sound in the throats of the affected birds

Some sneezing and so-called bird cough may be present. Dullness, emacia-

tion, cessation of egg production and diarrhea are often accompanying

symptoms.



The disease may be acute or chronic. The acute cases die quickly,

almost without Warning, due to the throat patches cutting off the breath.

Chronic cases may run for weeks. In some cases, eighty per cent of the

birds in a flock may get the disease while in others, ten per cent is about

the limit of infection. The death rate may run as high as fifty per cent.



Diagnosis—It is important to make correct diagnosis. Scabs in combs,

wattles, and skin may be due to mechanical injury. Canker in the eye

and cheesy masses in the mouth may be due to foreign material. The

swelling of the eyes in roup may be taken as a symptom of chicken pox.

However, in roup, on opening the eyes, one will find that the eye is without

accumulations of matter, the swelling coming from the nasal cavities.



Treatment—Isolation of affected. fowls some distance from the healthy

ones is the first step. Care must be taken not to carry infection from the

diseased birds. A pair of rubbers and overalls should be kept handy for

work among the diseased fowls and should be taken off when through. The

hands should be thoroughly washed, also, after working in the sick pen.



Birds too sick to justify treatment should be killed and burned, or

buried very deeply. Enough potassium permanganate should be added to

the drinking water to color it a purple or wine color. Cleaning of the coop,

burning of the litter, and a spraying of the walls and floors with a three

per cent creosol solution, is advisable. Reduce the use of meat scraps to

a minimum, but use buttermilk freely. The birds should be encouraged to

eat by giving a wet mash at noon, plenty of green feed, and all the grain

they want. Good appetites give birds a greater resistance to the disease.

Some advise the giving of epsom salts at the rate of one pound to a hundred

birds. For this, the drinking fountains should be emptied at night and no

water furnished until ten-thirty A. M. Then they should be given the epsom

salts dissolved at the rate of one pound to twelve quarts of water. After

an hour or hour and a half, the water should be removed and fresh, clean

water given.



Individual Treatment—W'hen symptoms appear, dip the heads of affected

individuals in a two per cent solution of potassium permanganate, or a

three per cent solution of boric acid, once or twice daily for thirty seconds.

In dipping the head, the mouth should be opened and the beak elevated so

the air therein will escape and be replaed by the solution. It is not neces-

sary to remove the scabs on the head as that lowers the vitality of the

individual. The cheesy matter in the eyes should be carefully removed and

the eyes washed with a three per cent boric acid solution, after which two



. drops of a twenty per cent argyrol solution should be dropped into the eye.

The cheesy membranes in the throat and mouth should be carefully removed

and if raw places are left, they should be touched by a mixture of equal

parts of tincture of iodine and glycerine.



Tuberculosis will be discussed next week.





I“





g . - . ' that are bred from proton blood l"1~.:.

H K5 Michigan Accredited Chick? Every breeder wears a sealed leg banduiii-

F / mcafing official approval by authorlzed state inspectors. immediate shipment.





 





 





 





 





 





 





BIG DISCOUNT NOW! PAY $1.00 DOWN—BALANCE c. 0. 0.

Pay for your chicks when you get them. Send $1.00 and we will ship





l





 





 





   





\.





$250.00 First Prize and 32 other Gold Prizes!

Every boy and girl under twenty years of age in

invited to write a. letter. Just a short, plain letter

. . . in pen or pencil, just so it can be road. No

“strings" tied to this contest in any way. All we

want is your reasons—AND THE BEST

REASONS WIN. Contest closes June lst.





W// //





You will get more eggs with Reef Brand because if



is clean, pure. dustless and odorless and is digestible



four hours faster than any other calcium carbonate



content. Last year the prominent international cham-



pions,“‘Lady Skyline” and Rucker’s famous pen that



laid 2,702 eggs, used Reef Brand. Reef Brand can

help your hens too.





eef Bran

Pure Crushed. Oyster Shell





ass





ssh





\

s

s

s





No “fancy” writing necessary.



We want your reasons . . .



AND THE BEST REASONS



WlN. Tell us: (1) Why you



think oyster shell is more I";

necessary for poultry in the W

Summer months. (2) Why you ’71.

prefer oyster shell as an egg-



shell builder. (3) Why you in-



sist on REEF BRAND for ‘~~.





your hens.

for P0ultry~ [/7 /«-.__.,,;;: .1,.

GULF causumc COMPANY -~ " s... ' ’





   

 

 

   

 

   

 

   

   

   

   

   

 

 

 





New Orleans, La. l" -’;’ /" 1!!

__—_—-———_——-—__-—- ’f I ‘ Va! 1"





F E E Send for a copy of the J? ‘ . '7 ‘ 1

l2 ! 20%|“ ‘iTHou; To Get “£1” [/2/ [pk/Ml %/' '_ A

885 or ce t ." _/ ‘

Name n s J~/ \ ”@WRY/

Address > MI.-3 ;' 096‘ "V..- I!

Dealer’s Nama-





 





WOLVERINE S.C.WHITE LEGHonN

°°’ BABY CHICKS





BLOOD SAFE ARRIVAL

WILL GUARANTEED MICHIGAN -‘ "ACCREDITED





FOR WINTER EGG PRODUCERS





‘ " Get our Large Leghorns, the birds with large combs

that produce the Large Chalk White Eggs





SEND FOR OUR 1928 CATALOG





Tells all about our (‘llll'h’S and breeding Stork. Egg Bred Since I9I0.

For 18 years we have specialize-d in the production of S. t‘. White Lea—

horns. and breed no other variety. All our time. thought. and energy in

selecting and mating has been devoted to our Iwghoms. You are assured

of very desirable stat-k. We can deliver chit-ks to most points in from

eight to ten hours.



Pulletn. We are now bookim.r ()l‘leS for S. 10, 12 Week old Pullets for

delivery in May and June. ()l‘lll'l‘ yours NOW!

I00% LIVE ARRIVAL GUARANTEED





WOLVERINE HATCHERY AND FARMS





H. P. WIERSMA, Owner and Breeder. Dept. 3, Zeeiand. Mich.





 





 





 

 





 





 





 

 





Royll Leghorn: are known as the strain backed by contest

winning blood lines. Winners of the Michigan Contest in 1925.

Record of 303 eggl in the American Contest 1926 and already

this year making excellent records at Bergen. NJ. and Quincy,

Ill. You can rest assured that this strain is bred of high pro-

duction individuals.

75% of Our Business is from Old Customers



The strongest endorsement we have is from our old cusromcrl

who have tried our chicks and know what they will do. Royal

strain can be depended upon for a high average flock produc—

tion. Our new catalog is free to you and will help you,





ROYAL HATCHERY a. FARMS S. P. Wiersma, Prop.

R. 2 Box M Zeeland, Michigan





, Contest Record

' k 303 Egg)





if; a





 





WORLD’S RECORD BLOOD LINES

Foreman’s Official Champion Layers are again setting

the pace for Michigan Breeders in many State Laying

Contests. Twelve important contest winnings in 1927

by Foreman bred and selected stock. Breeder of

Champion Layers and Contest Winners since 1918.



The only breeder in America using blood lines of



World’s recognized greatest Leghorn (351 eggs) and



Barred Rock 1326 eggs. hens. Write for Free Educa-



tional Catalog, the last word in successful poultry farm



management. 1



FOREMAN POULTRY FARM, Box 323-C, Lowell, Michigan

Prof. E. C. Foreman, Owner and Manager





L Blood Tested

FOUR wars of blood<lcsting for bm'illnry WHITE DIARILHEA. Three years of ACCREDITATION

and ion yuan- of hatchery experience coupled with consistent culling and breeding has given





us good strong livable. chinks. that grow into profitable layers. Two distim'livo brmds:

Barred Plymouth Rocks and S. c. White Leghorns





 





 





 





 





 





 





 





 





GH/ 0 o D Get b' l ' -

LEI EDS cwpgfigéngsvthree prbtlllltabllg himsmtioll‘iib lllelgclggf-y glfarghlltlsodlld‘pflaighes :23; 5| Write Idr free catalog and prices

R. ‘ ’ Bauuuén FREDRICKSON POULTRY FARM. Box 20. Holland. Mich. LER HATOHERY BOX A DUNDEE’ MICHIG‘N

. —-SELECTED CHICKS MICHIGAN

"Wu" 0" r Pure Bloo -BIG EARLY ORDER D U N D EE ACCREDITED C H I C K S

o This a ! ma “D'SCOUNTS‘IS VANET‘ES STOCK ALL BLOOD-TESTED FORIWHITE DIARRHEA FOR THE PAST FOUR YEARS.

1 O m 31: «rmgmuglmtc‘l flmnwgrmzfigfum‘;wzfimmfircrm Infill?“ “9 You can save money by ordering Dundee Pure—Bred. Mich. Accredited and

' O bloodtestcd. trapneated pedigree White Leghorn matings. 220 to 313 eaflmfcrords. Egoold-TestedNChlclés. “roe hatch B' E Books, R' -I Reds,.and -S' 0' “7h“?

‘ E Winner. of many prim. Every bird standard quled. Get mum circular of . g o_rns. ”“9 or 1.9“8 Catalog 31W": all details ofou1 matings and full

.MM- chinks hatching e885, and bmtxiers before buying elsewhere, cm...s 9,. m, (librfitilons (1mI how to raise baby CthkS for greater profits. We guarantee

0 r ve (e ivery.





 





 





_’:‘“'"“_‘ ° _ Beckman Hatchery, Box 57, Grand Rapids, Mich.





1» .3 ,. ’.





 





   





DUNDEE HATCHERY & POULTRY FARMS —- DUNDEE. MICHIGAN
896—80





 





THE ‘MICHIGA'N'FARME'R





The Modern Youth





Some T I'zoug/m Prompted by Mm. A. B. C’r. Crz’t‘z’czirm





ELIEVING you were inviting

B comment, when you published

the almost unbelievable letter of

Mrs. A. B. C., I have taken into con-

sideration many families I know per-

sonally, three of which I am to speak.

It seems to me Mrs. A. B. C. needs

awakening.

My first observation is a family

whose parents were of foreign birth.





 





 





Jim Miliigan’s Steer Won $197 and

Grand Championship at the Fair





There were eight children. The father

was boss. Everybody worked. When

employed away from home, he either

took their money or they paid board.

Generally speaking, lights were out at

9:30 P. M. Young company was not

encouraged. Today they are all away,

self-reliant, sober, and industrious

citizens. This is one extreme perhaps.



The second family was a Christian

home, so to speak, parents and two

dear good daughters. Fear of the

modern ways of young folks was con-

stantly in this mother’s heart. So she

and her husband both worked very

hard to furnish a nice home, buy a

large car and give these girls every

opportunity possible. Many a mid-

night after a hard day’s work found

Dad patiently bringing these girls

home from some social gathering,

mostly the society of their church.

These girls are fine specimens of

American womanhood but father has

passed on to the other land, and they

will never recover from their remorse.



The third example is that of a

friend who never had time for plea-

sure in youth. She was married young,

and brought seven children into the

world through illness and poverty.

She seems to live only for them and

their happiness. All the old traditions

of home seem to have been placed in

the background, and her home is a

veritable club house for young folks.

What of her children—selfish, unre-

liable, pleasure-seekers. Were mother

to abruptly be taken from them, I

doubt if they would pause long to

honor her memory. Therefore, Mrs.

A. B. C., you can see you are gaining

nothing and your children are losing

their souls.



A robin pushes her young from the

nest after she has done all she can

to make them fit to face the world.

If your home was founded on a last-

ing love before their birth, and you

have carefully instructed each on their

moral duty to mankind, shove out

those eighteen and twenty year olds

and I’ll miss my guess if they don’t

return even as the prodigal son of

old, and you will kill the fatted calf

and thank God for his goodness.—

Mother of Five.





 





Perhaps I am wrong but I never

can get away from the conviction that

if our children are disobedient, saucy,





 





deceitful, etc., there must have been

something amiss in the parental train-

ing. “Yes,” you will say, “blame it

all on the parents,” but is it not true

to a very great extent?



I am the mother of two~girls and

two boys ranging in age from six to

nineteen years and have had some

worries, heartaches, and doubtful mo-

ments, and yet, after each particular

storm has blown over I can always

see how I could have been a. little

more patient, more tolerant, and more

discerning. So many of us are prone

to forget our own youth.



I have tried to instill in the minds

of my daughters, nineteen and sixteen,

What a. “good time” really means and

that joyous, wholesome fun of all

kinds in good company is their due.



They are not told that they must

not smoke, drink, keep late hours and

I wish them to learn to discriminate

between good and evil and that the

choice must rest with them, knowing

that everything has its price.



We, too, have a good home and our

children are encouraged to bring their

friend to our home at any time, or to

go to the homes of friends, the only

requisite being that they must inform

their parents of their whereabouts

and to try to keep good associates. So





 





 





far, they have given us no trouble in

that way. .



We find, too, that the children of

today, due, I believe, to the modern

school training, exact the same respect

for their wishes that the parents do

of their children. For instance, my

husband and I enjoy an occasional

evening of bridge with our friends,

and a few nights ago our sixteen-year-

old daughter remarked, “Mother, you

went to a bridge party last night with-

out telling me where you were going.

You wouldn’t like it if I did that.”



Our Children often criticize our

ways, but. still we have the very great

consolation of Seeing how they enjoy

getting back to father and mother and





the shelter of home after a particular-





ly hard or trying day at school or

when oppressed by other woes; Then,

indeed, it is sweet to be a mother and

hold the confidence and respect of

two grown daughters. ,



The boys are still under the age

when “the children know it all and

the parents are back numbers." Have

often heard that boys are harder to

discipline than girls, so can only con-

jecture what may be our experience

later.



The joy and satisfaction of living in

a comfortable farm home with a good

man and four healthy, happy. “modern

day,” and, yes—quarrelsome—children

is enough recompense for all it may

have cost in work, worry, or even

tears.——“Birdie.”





 





 





DUR LETTER BDX





 





 





 





Dear Uncle Frank & Cousins:



I thank you very much for my pin

and membership card that I received

a few days ago. I felt very proud of

it and I am sure my friends will think

it grand. Anna Gossen said she was





 





GOLDEN CIRCLE MONTH





 





AST year we designated



March as the Golden Circle



month during which messages

from Golden Circlers were out-

standing features. This year has

been so crowded with interesting

Merry Circle happenings that the

Golden Circler event has been de-

layed. Perhaps, if the Golden

Circlers will respond quickly, we

can make April the Golden Circle

month. Please let me have a mes-

sage of inspiration, good thought,

or interesting personal news, from

all Golden Circlers, without spe-

cial invitation. This request is

meant for every Golden Circler. I

hope that you will help me by re-

sponding immediately. — U n c l e

Frank.





 





 





 





the happiest girl in Michigan when

she received her membership. I’m sure

I am just as happy as she was.



Say, Uncle Frank, why do they

make such funny pictures of you? Do

they do it to tease you or to make

us cousins laugh?



With best wishes to you and the

cousins, I am your niece, Delia Al-

berta.



I’m glad your pin brought happiness.

I guess the funny pictures are to tease

and bring fun both. I think “they are

good.”





 





Dear Uncle and Cousins:



I have been a silent M. C. and read-

er of Our Page for several years. You

have probably never heard from me

before, but I’m going to make up for

it this time so you won’t want me

to write again for some time.



I quite agree with “Michigan Boy”

and his views on education. Webster

says, “Education is the sum of the

qualities acquired through individual

instruction and social training.” When

a person becomes so well trained that

he can learn no more, he is, in my

opinion at least, a misfit. If a man

cannot grow with the many new things

which life is unfolding before our as~





 

 





tonished gaze, he is not a just com-

panion for us who live in this expand-

ing century. We, while young, do not

realize the worth of an education.

Later, we often wish we had more

true knowledge. An education should

make us see new beauties in nature

and it should make us better able to

appreciate the best things in life.



I am anxious to see what other

Merry Circlers think of “Michigan

Boy’s” views on education.——“Toe.”





You give an educated View of edu-

cation. The one who stands still now-

adays is missing much, and there are

thousands standing still.





 





Dear Uncle Frank:



As we all know an election of offi-

cers to the Merry Circle Club has al-

ways met with a disapproval, but here

is something different along that line.

I, as a member of this club, think

that past and present club members

such as Harold Cole, Rex Ellis, and

many others of the truly and greatest

members have a right of honor far

greater than the G. C. That right I

feel could be bestowed on them by an

election through Our Page.



The names of some of the most or

all of the most talked about members

should be printed in the Michigan

Farmer and voted upon first choice,

second, third and to be awarded dandy

certificates, the size depending on the

position the candidate has won. It

could be dOne through the M. 0. fund.

I mean the cost.



I disapprove of the letters printed,

not bearing the real name and ad-

dress. It does not show faith in our

club. I ,will now close giving you

time on other letters. Clinton Van

Duine, Route 1, Dorr, Michigan.



You have a thought for the M. C.’s

consideration. Such an election would

place one above another in honors and

may spoil the democracy of our Circle.

What do you think?





 





Hello Unc:



I suppose when you open this and

get through reading it, you’ll think

you opened a box full of mischief.

Well, maybe it won’t be as bad as you

may think it to be.



There’s a girl in our neighborhood

that's one of those high-toned fiappers.

She's afraid to wash dishes for fear

of spoiling her hands or breaking off

her, nails. We call her a house plant





 

 





T? We. .9





4





’fi'» men 17,, 1928"





a





 





 





 





because she sits inside all the time

when the rest of us kids go out to

play snowball, tag. or sliding down

hill. She’s afraid she’d get a cold and

is very pale. She has to color her

face so it will look like something.



The rest of us kids join together

and have a lot of fun. If we don’t go

skiing we play ball or soccer, and get

a lot of exercise which- they say is

good for growing kids. She’s afraid

to run for fear of breaking off her

high heels. She always says the kids

don’t care for her. We told her if

she’d play with the rest of us, she

would have some fun and still she

thinks she can’t be without her fancy

clothes. It takes a sport to have real

fun.



Now, Uncle Frank, don’t'you think

we are far better off than those who

try to be pretty? It takes health and

happiness to have rosy cheeks and be

pretty. Ha ha.-——Peggy.



That girl does not know what she

is missing in life by putting herself

in a show case. I feel sorry for her.





Fun is what makes life worth living.





 





MY DAD





 





A true friend, is my Dad,

To me he is most dear;

And when at night, from work he

comes

He fills our hearts with cheer.





He never is inactive,



He always works with zeal;



He’ll do the dishes for Mother

Or a pan of potatoes, peel.





He’ll do anything to amuse us,

He advises us more play.



He’ll help to rig up amusements,

Or cause a swing to sway.





When Mother politely refuses

A game of my boyish desire,

Dad will come to my rescue,

and “helps me through the mire.”





Though Dad isn’t always perfect,

He means a lot to me;

And that he is about the best of Dads,

You will almost have to agree.

mLester Hewitt.





THE WORK I LIKE AND WHY





 





Out in the beautiful summer night,

I gaze at the starlit sky,

Dreaming many hour’s away

Of the work I like and why.





I couldn’t be a nurse, although,

What a helpful person I’d be;



I couldn’t be a dancing actress gay,

I’m too shy, and homely, you see.





Stenography doesn’t strike very well,

Or office work of any kind,

Teaching out in a country school

Is a thought left far behind.





I wouldn’t think of being a parlor





maid, .

Nor dishwasher 1n a cafe.





 





Marguerite Foster Has Plenty of: Pete





I’d rather stay on the farm and work,

Dig spuds, and help with the hay;





There’s just one thing in all the world

That's my only great ambition,



To be a successful artist medsy

Is a long ago *msde'doozliou'éwtfi” .





 

 





9%?





 





 





 





 





«:31.





’sWWN-«a M». s
t

l





MARCH 17, 1928





By a roaring ocean side,

And beautiful scenery here and there,

To success would help me slide. ,





The stars have left the azures deep,

Another day is nigh,



To draw and paint is the work I like

It’s my dream and ambition that’s

, why—Martha E. Kolhmainen.





 





‘ MORE GOLDEN CIRCLERS





 





, T' has been some time since we



awarded the Golden Circler honor,

therefore, it is time that we did so.

The fellowing have been selected from





. theiSsues since October 22 when the





last..honors were given:



Opal Brauber, Box 194, Sterling,

Michigan, for her comments on “White

Amaranth” in the December 24, 1927,

issue... i. ,



_ Eitri'Bowen, Route 1, Lapeer, Mich-

igan, for his article on “Indecision”

which appeared January 7, 1928.



Grace Cramer, Box 2, Comstock,

Michigan, for her article on “Hope,”

printed January 7.



“Michigan Boy,” for his excellent

letters on education in January 21,

issue. »



Agnes Arthur, Route No. 4, Midland,

Michigan, for her artlcle on life, pub-

lished January 28.



“Patty” for article on character in

January 28 issue.



“Copper Penny” for letter on errors

in punctuation printed February 4.



“Sammy” for her defense of mod-

ern youth in February 18 issue.



The “Critic” for poem on “Snow”

which appeared in March 3 issue.



MarthaKolhmainen, Chassell, Mich-

iga’n‘,‘for her poem entitled “The work

I Like and' Why” which appears in

this issue. -



Lester Hewitt, 160 Oak St., Hills-

dale, Michigan, for his poem on My

Da ,”/ published in this issue.



Clinton Van Duine, Route 1, Dorr,

Michigan, for his many good letters

and suggestions.



Zola M. Marsh, Box 313, Kingsley,

Michigan, for her many good essays.



Lilly ‘Tervo, Chassell, Michigan, for

her good suggestions and pers1stency

in answering contests.



We need the names and addresses

of those whose pen names are only

given above. Please mark “Golden

Circle” on your envelope when letting

us know if yours is one of the names

above. I wish to compliment the above

for their good work and hope they will

enjoy the Golden Circle pin which will

be sent them—Uncle Frank.





 





WORLD’S CHAMPION BEAN

GROWER





 





BY CHARLES B. PARK





ROLAND MYERS, a seventeen-year-

, old Smith-Hughes High School

student of St. Louis became the world

champion bean grower at this year’s

International Hay and Grain Show.

He produced his beans on a Smith-

Hughes High School project. He is

one of two sons and lives on an eighty





acre farm with his parents where to





gether they carry on diversified farm-

ing.



In producing his champion beans,

Roland used seed of the Robust vari-

ety which is an excellent yielder and

very disease-resistant. '



The soil of his field was clay loam

nearly level but affording good drain-

age. Manure was applied early in the

spring after which the plat was

plowed to a depth of about eight

inches. Rolling and harrowing fol-

lowed, until a very fine porous seed

bed was formed. This careful soil

for less cultivation later on.



The seed beans planted on June the

eighth, with the drill set at forty-five





 





 





THE MICHIGAN FARME'R





pounds per acre with rows twenty





inches apart. Twenty per cent acid.





phosphate was broadcast on the piece

at the rate of one hundred pounds per

acre.



In a few days the tiny shoots came

through the ground and as soon as the

rows could be followed, cultivation

was begun. Cultivating was done deep-

ly at first, gradually growing more

shallow as the plants matured.



As frequently is the case, the long

looked for,rains came at about harv-

est time, and Roland began to worry

about further vine growth and harv-

esting trouble. However, the weather

cleared and the beans were soon

pulled and bunched. After a few days

they were drawn to the barn for stor-

age to await threshing. The threshed

beans picked one pound per hundred

and the yield was twenty bushels per

acre.



Roland prepared his show sample by

first running them over the fanning

mill to remove all small beans and

foreign material. This process gave

an uniform sample which was next run

over the bean picker to remove off~

colored and ill-shaped beans. The

sample was completed by polishing

and again hand picking.



On November twenty-first the sam-

ple was sent by registered parcel post

to the International Hay and Grain

Show at Chicago, where it was placed

first above all entries in its class, giv-

ing Roland the honor of being the

world’s greatest bean producer.





RADlO CONTEST





- E would like to know what

young folks think of the radio.

Therefore, this contest on “What

Benefits I get from the Radio.” Please





tell this in two hundred and fifty





words or less. Don’t forget your name





and address in the upper left band i





corner of your paper, and M. C. after

your name if you are a Merry Circler.

The writers of the ten best essays





will be given prizes; the first two,‘

fountain pens; the next three, handy _

school dictionaries; the‘ next five ,





clutch pencils. All not Merry Circlers





who send in good papers will be given ,





M. C. pins and membership cards.

Thousands of young folks have op-

portunities to listen to a radio. Let





us know what radio features you hear "





are of greatest value to you in educa-

tion or entertainment.





Send your papers to Uncle Frank,





Michigan Farmer, ‘Detroit, Michigan,

before March 23 as the contest closes

then.





CONTEST WleNER‘S





 





HIS Contest Contest showed a big

majority for the essay type of con-

test. This was hardly fair as those

who liked that kind took part in this

which was of the essay type. There

is no doubt but that the essay is the

hardest type of contest we can have,

and I am glad that the contestants

this week have recognized that fact.

Story Books

Zola M. Marsh, Box 313, Kingsley.

Herbert Estes, Webberville.

Clutch Pencils

Dorothy Munn, Rapid River, Mich.

Clinton Van Duine, R. 1, Dorr, Mich.

Alma Erickson, Chatham, Mich.

Knife

Menno G. Martin, Brutus, Mich.

Beads

Helen Piper, Shiloh, Mich.

Mildred Merritt, R. 1, Ypsilanti.

Lilly Tervo, ‘Chassell, Mich.

. Bracelet

Mmda Kangos, R. 1, Rudyard.





 





 





 





 

 

 





' , Heavy Mixed CiTIIIIififiii .

m “Junk! 1m «filler—100% use delivery prepaid. Get our {in cmloc.

to order your pullcis now. Get our latest in'lrcs.





ZEELAND. MlCl-l. ’4





100cm. muted grades, Write for it. It is time

MWNZWERS. R. ’R. 3. 30x50





‘3.





LI.





. unnERMAN





0m Chicks are Hatched from Free Farm Range Breeders

Every chick is Michigan Accredited which means it is from breeders that have 1 '

passed the omcial inspection of poultry specialists in

Michigan State Poultry Improvement assodat





w—F





CHICKS





-.¢





   





Saving ank. Order from this ad. ~ 500 I.0 _

(Enulifli Type) S. c. White Leghorn: ....... $3.25 $6.00 $ll.00 $52.00 ”00.00 “ '

8. 0. Brown Leghorn: (Heavy Type) ........ 3.25 6.00 “.00 52.00 l00.00

Bax-rod Rooks (Laying Type) ......... . ....... 4.00 7.75 l5.“ 72.00 I40.“



\ S. 0. am ................................. .25 7.150 “:00 67.50 I30.“





................. 2 50 4.00 7.90

................. 3 25 6.1!) H 00





a s o





B BY CHICK





-der the supervision .0: A.

ion.26 Refersoyou in State Commercial . .





fun. all about our





 

 

   

 

 





r7;(’MODER1\I

(Fe/’10 01’ like,

MODERN firmer





- HE modem farmer diversities and demands good fence for this



purpose. That’s why he always chooses PIONEER. Here are a few ‘

reasons Why farmers who are making large profits agree that PIONEER

can’t be equalled for farm and poultry uses:



The only knot that tightens under the same strain that loosens the

knot on ordinary fencing; made from copper content rust-resisting wire;

every inch of wire is LEAD ANNEALED and heavily galvanized with

99% percent pure zinc coating which protects the fence AT THE KNOT

as well as elsewhere; coiled line wires that become LIVE wires when

stretched and provide perfectly for

expansion and contraction.





KOKOMO STEEL & WIRE CO., Div.

CONTINENTAL STEEL CORPORATION

Dept K, Kokomo. lnd.. U. S. A.





Get this

FREE book





This FREE hand book on diversi-

fied fanning was prepared for

YOU. It is chock full of valuable

information that you should have.

There's no obligation—just send

your name and addrcr, Write

todayl





DEMON RUST

CAN'T ENTER

, AT THIS KNOI





 

 

 

 

 

 

 

 

 





 





 





FARM





IO. EEngRYFE ce





Chicks! Chicks!





CAN SHIP A'l' ONCE A'I' REDUCED PRICES



BIG. STURDY. FLDFFY chicks from free range. pure—bred flocks that have been culled and

selected for egg production and standard qualities. lust what you want for foundation stock: or

to improve your laying pens. 100% live delivery mm-ran’wed. Send this adv. with order and

get 4 FREE chicks with every hundred. White, Brown. Buff Leahorm. Ancomu. and Heavy Broilers.

ill/2c. Bmod, White, Buff Rocks, Single and Rose Comb R. l. Neda. Black Minorcas. l3'/gc.'

White and Silver Laced Wyanllot‘tes, Bufi and White Orpinotons. White Wyandottcs. l50. White

and Buff Minorcas. Light Brahman. White and Black Lanuxham. Silver Spangled Hamburgx, law ,

Light Mixed 9c. GRADE AA CHICKS. 5c nor chick extra.



WE GUARANTEE THESE CHICKS TO SA'l‘lSF‘Y YOU IN EVERY WAY

Send for out beautifully illustrated catalog of baby elm-ks and breeding stock from our R. 0. P.

Mala matings up to 316 egg records. BABY CHICKS— -il.-VP1‘H‘ING lims—BlmDhM—PUILW

COOKERELS. LAWRENCE HATCHERY. Tel. 72525. Ora-ml Rapids. Hickman.





CARLETON’S means. CHICKS





Miro—bred hcan' layers from Michigan Accredited flocks. under supenls’lon of Michigxui

Siam t‘ollegc. Your success depends upon the quality of chicks you buy. Order today





 





 





......,. .





 





 





 





 





 





._ at the following prices. 100 per cent IiVe delivery. Write for catalog.

“£3 ; 3 For too 509 1 coo

, B. P. Rosita & s. c. Reds .................................. $45.00 $72.50 $440.00

~ ‘ s. C. Wmte Leghorn: ..................................... 13.00 62.50 120.00





Carleton Hatchery, Carleton, Mich.





From Our 100% Pure Hansen

White Leghorn Mating





500 W. Leghorns now under the trahnost, on our form. 300 under Michigan R. 0. P. now makin wonder!

records. Rmm‘ds as high as 103 eggs for 4 cold winter months. Also Tans-red 4!: Barron fougdntiou Vltl"

1.,9ghmg; large type [may Laying Barred Rocks and Sheppard strain Anconas. All Michigan State

Amnedlted. You can't {Ml With our stock. They are brad and haunted n'zlit. Don‘t place your order

until you have secured our large catalogue and price list free. We flhlp u. 0. 1).





Michigan Poultry Farm, Box 2 Holland, Mich.





Chicks “l," Future





We offer BETTER CHICKS because WE SPECIALIZE in Barred Plymouth Rocks and 5. c.

Whitofl Leohorns ONLY. All parent stock. Michigan Accredited, Blood Tented and STATE

lNSPhCTED. twinge Poultry Manual with each order. Write for Catalog.





RICHARDSON HATCHERY, DUNDEE, MICH.





 





 





 





 





Trapnested Mating; add 3c; Blue Ribbon Pens add 4c Each. 1





 





100% Live Delivery guaranteed and Postage paid on 50 ")0 500



'wmm, Brown and Buff Mghorns ........................ $3.50 $0.50 $12.00 $68.00



Brit. Wh. a Bf. Rooks. Minorcas. Anconas. Wh. W

. _ dottes. and Reds .................................... 4.00 7.50 14.00 68.00

- Silver Wyandottcs and Orplngtous ............. .......... 4.75 8.50 16.00 7800



Mixed or heavy Broilers, No Gulls .............. 3.26 5.50 11.00 68200

. BABION’S FRUIT AND POULTRY FARMS Lock Box 354-0 Flint. um





 





TOM BARRON STRAIN 8. C. E

LEGHOBNS—Biohlcan Accredited.



Lam type birds. with hm. low-d combs.

tho kind that by the lame. white on Muted

for six years to males with pedigrees of 260

to 300 eggs» v.



We ship only mans. vim-us (this. that

winnve.mxw.hlvmdw. Wannabe

100% live Misery mid to you.



Send My tor our 1028

Mil-£8"!!! HATCH“!

Box M 1m one.
398— 32





 

 

   





World _ \

Champion U 0

Drawing made

from action pic-

ture of Gap and

King, breaking the

world’s pulling rec~ -

(mi in a. set of the .

BOYT Harness.





   





Strength

through quality of leather

Strength in harnessleather

aiming for





demands special

three urposes— _

1. p resist friction (rub-

bin against horse’s leg.





   

   

   

   

   

   

   

   

   

   

   

   

   

   

 





e .



2. To withstandl years of

exposure“: weather.



8. To. retain, during a

entire hie of the bar-

ness. the great tensile

Strength needed to take

the hardest pull of your

strongest team. .



Without such tanning. har-



ness leather cannot stand up.

From the tannenes, capable of





 





 





Isa





   





Endurance





ivitb Rustless hardware



Bust on harness metal rots

leather. That is why rustless

bronze hardware from a special

formula, is used at more than

80 points in the BOYT Har-

ncss.



Rustless bronze hardware

goes hand in hand with super-

tanned leather in giving long

life to the BOYT Harness.

Through twenty—seven seasons.

BOYT Harness has proved

itself the most economical har<

ness for farm Work. Years after

other harness is worn out and





"Y:





.. HARNES

Tfie Standard %rk Harness ofAmerica"





. ,4? . . .





A 27-year record proves it, is





UNEQUALLED





Economy





through finer workmanship



The Boyt Company builds

more sets of standardized work

harness than any other harness

manufacturer in America.

Each process in building the

Boyt Harness is handled by

men who specialize in that

particular job. As a result they

do it better, and at lower cost.

And you get not only quality

Workmanship, but quality ma-

terial straight through. Stitch-

ing with toughest waxed thread

——1aps caught with rust-proof

rivets—close inspection at





groduci such leather, our

era s set the heav1est hides

a out one out of every ten).





   

   





f these choice hides, only the

back, the strongest part, is

used for the BOYT Harness.





1hr





 





r--





   

   

   

   

   

 





 





 





See for yourself. Send for our big free harness





BREEDERS’ DIRECTORY





Change Copy or Cancellations must reach us

Twelve Days before date of publication.





CATTLE.

GUERNSEYS 82:]: r ogiarhfescgirfiigeif (1:.ng





109.10 milk. 778.80 fat. 19,400.50 milk, 909.05 fat.

T. V. HICKS, Battle Creek. Mich.. R. I.





Dairy Heifer Calves. practically

Guernsey pure bred $25.00 each. We ship

C. 0. D. Write L. Terwilliger. Wauwatosa. Wis.



“Reg. Guernsey cows and a few bull

For sale calves. sire by imp. ('oro Honor.

JOHN EBELS. Holland. Mich., R. 2.





 





FOR practically pure—bred GUERNSEY or HOL-

BTEIN calves. from heavy. rich mllkers,

write EDGEWOOD DAIRY FARMS. Whitewater. Wis.





FOR ‘ SALE $33.??? Tm‘ii‘l’ilfiuafiuffl‘fii





to sell. S. W. SOMMER. Dryden. Mich.





SERVI CEABLE AGE





REGISTERED HOLSTEIN



Bull Calves at prices the owner ofa

small herd can afford to pay. The

sire of many of these calves is a Son

of the highest record (30 lb.) two-

year—old daughter of Creator. His

sire is King Segis Alcartra Prilly, an

undefeated Show bull with 70 A. R.

daughters. Others sired by a 5 times

1200 lb. Champion Bull, the famous

K. P. O. P. breeding.



Bred cows and heifers served by

these sires are available for founda-

tion stock.





RED ROSE FARMS DAIRY





Northville, Michigan

Telephone: 344

Referonce: Northville State Savings Bank

Registered Holstein Bull. old





For sale enough for spring service. Also

one old enough for heavy service. Also my herd

sire, 4 yrs. old. son of a 32 1b. 4-year-old heifer.

Also a few females of milking ago. some with semi-

ofilcial records. Vernon E. Clough, Parma, Mich.. R.2.



buys five head of Holsteins, four





$250- 00 high grade heifers nicely marked.





from four to eight months old and one registered bull

nine months old not. akin to heifers. B. B.

REAVEY, Akron. Michigan.





FOR SALE A yearling. registered 1101-



stoin bull. Dam has an» 18

lb. A. R. 0. record and he is sired by a -5 lb. bull.

Also bull calves sired by 30 1b. bull and from sped

record dams. BEN L. SMITH. Rives Junction. Mien.





88 Hereford (lows





Bic wide back kind. dark reds. dehorued. Bred to

extra good Hereford bulls to calm about April lst.

Will sell you choice car load. Also 22 Hereford

own and calves and 24 heavy swingers. Also other

bunches. All '1‘. . tested. Also yearling and 2

yr. old slackers and feeding steers sorted even in

size and quality.





“I 8. BALDWIN,





 





gone, the BOYT Harness is

still going strong. giving you

many extra years of service

without extra cost.





More harness for your money

because sold by your dealer





Through authorized Boy’t dealers, Boyt-Made Harnesscomes from factory

to you at a. smaller margin over the actual manufacturing cost than would

otherwise be possible. And you don’t have to add freight to the price.

That’s why your Boyt dealer can give you more harness for your money.





THE BOYT COMPANY, 236 Court Avenue, Des Moines, Iowa.





every step in making what.

thousands of farmers have

found to be "the World’s

strongest harness."





BEE-aim is1 Is“! ""‘

flirt anus-Lav Priced—Bay: Bum





Boyt quality leather, plus Boyt workmanship ‘ve

you the BREADWINNER, an unusuallv powerfulglar-

ness at a low price, made possible only b large

standardized production. Look if: over. it less

than $70. there’s no harness can touch it.





,7





 





 

 





 





catalog. WRITE TODAY.





l/III/lll/I/Illl/I/I/IZl





ROSS METAL SILO

Lifetime Satisfaction





ADE of copper-content Rossmetal gal-



vanized. No shrinkage or swelling.

Can be increased in height. Movable. Safe

against fire and wind. No freeze troubles.

Send for remarkable book-

let—“What: Users Say."





Easy terms—buy now,





 





 

   

   

 

   





   

 





   

 

       

 

 





‘.

I‘l

7





i: It, pay later.

It ‘4‘ Check below items in

' Ir \ which you are interested

R@. s and we will send illus-

". Inv tra ted folders.

‘ 5 Agents wanted in territory





where we are not repre-

suited.



Tlachas Csuttgr & Silggouo

' ar or L. p ' d. -

“62 Establishedrto





I





   

   





use





 

 





 





'Il’is ii Q”





~—

—;__





59"”.





’ Makers of

Silos D Cutters (3 Cribs [J

Brooder Housesfj Hog Houseslj MillsD





 





 





NATCO





GLAIED TILE

SI LOS





WRITTEN guarantee with

(very Nalco Silo. Silos

are permanent, perfect cnsilsge

preserves-s, vermin-proof, mist

freezing, never need painting

or repairs. Cos! no more than

wood, give absolute satisfaction.

investigate — gel free booklel.





Natco Corn Cribs are as good

as (he silos. Ask for (older.





NATIONAL FIRE - PRCDFING

COMPANY





Department 3

Fulton Bldg. Pittsburgh, Pa.





   





 





 





 





 





 

 





 

 

 

 





“r ‘ Your Own

1‘ ‘te Guarantee 3

Put down in black and white whiz:





YOU want your Silo to be. Then

t at stand as OUR Guarantee of the





h



“II" II n s a”. I

'lii....-||l|l..l||lWillirlllii

METAL 811.0

Most Modern Most Practical Silo.

c o P P E 3-1 h E D Metal throughout.

Many exclusive features. Backed b

23 earl of Experience and Respons -

bil ty. loll Is on! sin sir you use! so no

so. sous lung-fry“ prises. Special 6

counts on on y orders.





The Thomas G. Armstrong Co.





 





 





 





 

 





 

 

 





 

 





 





 

 

   





 





Eldon. Iowa)





 

 





 

 





sun 0 Lou... on m. use

sum luau sum. cm egos. Irsio Ill





#





     

   





CLOVERLAND COW HOLDS STATE

RECORDS ’





HEN Jay B. Deutsch was run-

ning his Guernsey herd at Big

Bay, Michigan, he made a world’s

record for the Guernsey breed in class

DD on Rilma of Bay ' Cliffs 93480.

That was four years ago, and even at

this time only one other cow has éx-

ceeded her performance in that class,

so she still holds second place. The

herd, including this big cow, is now

owned by L. G. and M. Y. Kaufman,

at Marquette, Michigan, where Rilma

has just completed another high re-

cord of--15,575.5 pounds of milk and





:M'ARCH 17, 1928 .





 





the protest of feeders against the de-

cline in prices from mid-January to

mid-February. An upturn of fifty

cents to one dollar in' the market for

fed steers with weight and a. little im-

provement in the market for light

kinds was the result.





 





FEWER CATTLE SLAUGHTERED





 





URING January, 711,000 head of



cattle were slaughtered under

federal inspection compared with 786,-

000 head a. year previous. With two

exceptions, this was the smallest num-

ber for the corresponding month since

1916. Slaughter during February prob-





 





 





891.7 pounds of butter-fat, which

makes her the Michigan state cham-

pion in class A. Altogether, she has

made four records, as follows: 9348.9

lbs. milk, 490.2 lbs. butter—fat, class

G (Junior two year old); 15,6847 lbs.

milk, 821.7 lbs. butter-fat, class DD

(Senior three year old); 14,8756 lbs.

milk, 767.9 lbs. butter-fat, class AA

(mature age), and 15,5755 lbs. milk,

891.7 lbs. butter-fat, class A (mature

age).





 





HARD TO KEEP UP BEEF

DEMAND





UPPLIES of beef are not likely to



average much smaller through the

next four months than they have been

in the last two months. Packers still

complain of unsatisfactory dressed

beef trade conditions. ‘Continuation

of extremely short supplies will be

necessary to hold the market on this

high level.





 





 





FEEDERS ARE SKEPTICAL





 





FEEDER cattle prices have not re-

covered much from their recent de-

cline. Skepticism as to the fed steer

market checked interest in fleshy

steers suitable for a quick turn and

muddy feed lots, scarcity of corn, ris-

ing feed costs and tax-paying time are

other influences tending to keep buy-

ers out of the market. Shipments of

stocker and feeder cattle from public

stockyards in January were fifteen per

cent greater than a year previous and

practically equal to the five—year aver-

age for that month.





 





LIGHT RECEIPTS CAUSE STEER

PRICE RALLY





 





ECEIPTS of cattle have fallen off

sharply in the last two weeks to

the smallest value of the year and

the smallest at this season since 1915.





 





 

 





The shrinkage probably represented





 





 





Rilma, Own-ed by Lorna Farms, Marquette, Holds Three Michigan Records





ably will make a similar showing,





giving added confirmation to the belief

that total slaughter for 1928 may fall

as much as a million head below 1927.





 





SHE STOCK TAKES SHARP

DECLINE





 





RICE‘S of cows and heifers recently

__ declined sharply. They are not

likely to lose much further ground in

the next three months, however, owing

to the seasonal shortage of butcher

stock. Veal calf prices have dropped

sharply from the February high point,

due to larger receipts and lower

prices for hides. After another strong

rally, a decided downward trend can

be expected.





 





HORSE MARKET ACTIVE





 





THE expanding activity in horse

market circles which started sev-

eral months ago is still in progress.

During January, receipts of horses

and mules at public stockyards were

seventy-seven per cent larger than a

year previous and twenty—seven per

cent over the average for that month

in the last five years.



Buyers have been ready to take all

the good animals, but thin, poorly con-

ditions, light weight, and overgrown

sorts are not wanted. Top sales at

Chicago are around $260 with bulk- at

$100 to $150. Range of quotations at

that market are as follows: Draft

horses, over 1,700 lbs., $140 to $260;

good chunks, 1,600 to 1,700 lbs, $140

to $250; common chunks, 1,500 to

1,700 lbs., $75 to $135; wagon horses,

1,300 to 1,500 lbs., $125 to $175; good

farm chunks, $60 to $110; common

farm chunks $20 to $50; good mules

$125 to $200. '





 





A high-producing cow finds it diffi-

cult to eat enough grass in summer

time to maintain her how of milk. This

makes necessary supplemfiflrmdped-

in; in case of asbestmsu’ ‘





 





 





- ‘ :f‘n‘f—‘m . ' ‘
flrV-r-rr-rp-t





UV





(Hi-9w;





- ‘=m_.~. _ -





 

 





   

   

   

 

   

   

   

   

   

   

   

 





V'LENAWEE FARMERS LIKE TEST-

ING WORK





OTING to continue the testing

association after having completed

two years of this type of herd im-

provement work, Lenawee County

dairymen laid the plans for further;

development and improvement of

Lenawee County dairy cattle. \Villard

, Syers, tester for this association durr

ing the past two years, reported a

gain in butter-aft production by the

average herd in the Lenawee D. H. I.

association.



J. B. Smith of Adrian, owner of the

high herd and high cow, feels that

he has been well paid for his invest-

ment in the herd improvement organi-

zation. The figures in his herd book

show that thus far this year the re-

turn for a dollar expended for feed

has improved material-1y over that

realized in 1927. His herd average





Ornamental Lawn Fences

add greatly to the appear-

ance and value of any home.

My New Catalog shows big variety of styles.

and atprices that will save you a lot of money. My

DIRECT from FACTORY

plan of dealing makes my prices-lower .. .’

-—vmy customers get the benefit—and '

I also pay the freight. Catalog also -

contains descriptions and factory - '

prices on Farm Fence, Steel Posts,

Barb Wire, Gates. Metal .and Roll

ltoofing, Paints. etc. This money

saving Catalog is free—get; it be

fore you buy.-.l 1M BROWN, Pres.

The Brown fence & Wire Co.

Dept. 1025 Cleveland, OhIe





f—s





 

 





 





 

   





 





 





‘ ' “spa-awe" for Dog





 





this year was 498 pounds butter-fat

and 12,340 pounds milk against 409

pounds butter-fat in 1927.



A. C. Baltzer, in charge of dairy

herd improvement associations in

Michigan, was present and explained

the new Holstein herd test and its

~ value in the future dairy development.





 





“Swan's" KEEPS «-





gosed to weatheror disease. ml





 





SELLS PRODUCTS ON OPEN





it.

Give “spasms" for figs" ts M AR K ET

drug stores. Write for {roe klet.

SPO“! MBDIOII. c D ‘ ‘



‘ (Continued from page 369)





 





 





 





 





370d Ellen-zoo Glued Tile you put an added cash was Into following COI'II III the rotation. Cer'





llalamazoo Tank 8. Silo Co. Dept. 0 Kalamexon. fllch.





four 'or five times after planting.

About ten acres of the corn are used

for silage and the remainder is picked

for grain. The stalks on the portion

Where the grain is secured are plowed

under for fertilizer.



Oats supplement the corn in the

grain ration for the cows. About

thirty acres of this cereal are grown,

numb ' s—nt no extra cost to yourself. Permanent-fire-nfe





ntmazmciazeeme tified Wolverine seed is used. The

”“m‘u‘mmu’m‘m‘mm“t""uwii'dmm "”39“°‘*$“'b"t corn ground is plowed and fitted with





it oflern many more ., at. er. nrmer



inwinter,cooler|nsummer. Valuablebuildinghook—vtree. Write float and ha1‘1‘0\\‘, the object aIVVayS

being to make the soil as firm as pos-



sible. About one hundred and fifty



pounds of superphosphate (acid phos-



phate) is applied. Last year the cropl



yielded seventy-five bushels per acre1





 





 





 





WE WANT FARMER-AGENTS





Get our proposition on

the celebrated





 

 

 

 

   

   

   

   

   

   

   

   





as





A

A





 





   

 

 





THE MICHIGAN FARMER





Never Drench,





 





33- 399





 





~ Its.-





)





9





W





 

 

 

 

 





 





Prescription

that SAVED





w





—.—-





A





3.;





A





“DR. DAVID ROBERTS. Waukesha. Wis.

Dear Dr. Roberts:





v





-A





paralysis. That has been proven





A:





   

 

 

   

   

 

   





HOLSTEINS





« Are III/111;;





‘* For 2000 years

Holsteine have been bred for

ruggedness. They thrive in all

climates and sections without ex-

pert care and produce profitably

under varied conditions.





   





 





Write for literature





“the Who Sam.

HOLiTOEEflE-‘SFARIESIAN





230 East Ohio Street Chicago, Illinois





   





 





and the average yield of oats on this.

farm for the past five years has been‘

around sixty—five bushels. The straw

goes in the stables for bedding.



Mr. Bristow’s only cash crop is





B. V. T.

SILO





Made of vitrified lire clay by one

of the In est established silo oom-





anlea. on mm b purchasing

it DBMS 008%. Write tor





 





 





 





 





 





 





detelll._ wheat. On an average he grows about

ML IIGIMIW BRICK ltwenty acres. This cereal follows

AND TILE “WWW either oats or silage corn in the rota-

”“ll’h‘u‘n‘ tion. W'hen oat ground is used, it is



L plowed, whereas the corn ground is

' disked after the corn is put into the

PERCHERONS silo. About two hundred pounds of

superpho-sphate is applied to help this



3* .LI; ’ ~ crop along. Also. the field is usually,





 





top-dressed during the winter with

manure from the cow barns. The crop

is threshed from the field. Last year

his Wheat yielded thirty-five bushels

per acre. The five-year average is

thirty bushels.



As stated before, twenty acres of

the farm is given over to pasture for

summer feed. June grass and sweet

clover provide the pasture crops.

These crops are improved by the use

of top dressing and the application of

commmercial fertilizers.





-—- The home is comniodious, well ar-

GUARANTEED ranged, and supplied with modern con-

temilkaseffectivelyasanymilkermade,rega.rdlessof veniences— These consist of furnace;





price. Finest materials and construction throughout, running water plectlvipity refrigerator

' y ’ 4 i ’





ried and proven by thousands of farmers. Sales doub-

ling yearly. Cowslike its gentle,soothing action.Saves vacuum cleaner, bath room, power





hours of drudgery. Delivers clean top-price milk. Easy . - ~ .

to operate and keep clean. Many’styles and sizes. “ a8131ng machuie, 59“ age SyStemy and

D Sendforinstmtive baaklet No.40 FREE. septic tank.

istributors Wanted—Fine opportunity or mer- . .- . - -

chants andfarmers.'Askfor details. .Although Ml- BUSH)“ and 'hlS one

Y hired man are kept busy With the





MYERS-SHERMAN COMPAN

2 13 NtDesplaines Street. ChscnsO. Ill. duties upon this farm, the family





, ” . takes regular vacations and an active





f g

.43"





 





. If you want a stallion or a pair of mares

write us. We will help youfind them. Send for

the 1928 Percheron Review. Free. Address





PERCNERON SOCIETY OF AMERICA

Ellis McFarland. Sony. Union Stock Yards. Chicago





 





 





 





 





 





 





l

I

l

l





Sill/£133? :





' Use Moore Bros. PURPUL medicated





 

 

 

 





After operating, when sore or con—

gested, for reducing spiders insert this

wonderful healing dilator. Avoi

expensive troubles, lost quarters.





Package Sent FREE





dozen;5 dozen $1, or mailed postpaid.





)‘V, DlL T

"' A OR Moore Bros..Dept HAIbanv.N.Y.





NSERTED





Medicated Wax Dilators For Sale--Reg. 0. l. C. April & May gigs

has FRE





 





. "elves. Coughs. Oendmon-

er. Worms. Mosl for cost.

Two cons satisfactory for

Heaves or money back. $1.25

pet can. Dealers or by mail.

The Newton Remedy Go.

Toledo. Ohlo.





WTON'S





   

 





1' NE





 





.—





CATTLE





AUCTION SALE

MARCH 22, 1928

30 Head High Grade Guernsey Heifers





will begin to freshen April first, bred to a registered

Guernsey bull. These heifers were raised in \Vaiiko»

Slllit (‘o.. “'is‘i-Olisin. Seven miles northeast of Men-

don on gravel road.





ZACK BEARD, Prop.





‘ ' for sale. valves. and

Registered Holsteins ..,,u,.,,,m mam. 89d

females. good breeding. 2 bull. about. ready ‘lor

seriii-e. Prices reasonable. Orr Bros., Decatur. Mich.





BUTTER BRED

CRYSTAL SPRING: STOCK FARM.

Silver Creek. Allegzin County, Michigan





FINANCIAL KING JERSEYS





We have for sale a, most excellent selection of bull

calves ranging in ages from 4 mos. to one year old.

Those calves are sired by Financial King Sensation

and Financial Ford and out of Register of lllfl'lt

Stork. Prices reasonable. COLDWATER JERSEY





FARM. Goldwater. Mich.





JERS EY BULLS

FOR SALE





the $50,000 Bul

And Here’s What the





LaX0t0niC Owner Himself Says:





”R. 2, Waupaca, Wis.. April 16. 1911.





“I thought you would be interested to know that my Holstein sire Sir Pietert'e Ormsb



Mercedes 37th, has fully recovered from his attack of para] ysis of the bowe a: J y



You may not know that this bull went about ten days without an action of the bowels in

spite ot the fact that we had given him ten pounds 0

eii’ect. Of course we thought it was constipation and treated him for that, never thinking of paraly-

sis of_the bowels until you arrived and examined him and pronounced it that. Your statements at

that timedecided me to always treat stoppage of the bowels as though it were paralysis and not

constipation for as you say the treatment for paralysis will overcome both constipation and





to me.



. hen I think of your little 500 box of Laxotonic saving this $50,000 bull I cannot hel but feel

that it is too bad that all cattle owners and breeders do not know of your valuable preparations, as

well ss_yourwonderful skill in the treatment of cattle which you so clearly demonstrated in saving

this animal. I want you to know that I appreciate the prompt attention that en gave this bull in

spite of the fact that the weather was below zero and the roads were drifte and be was 150 miles

from you. You Will please find enclosed my check to cover your services.



Yours very truly, (Signed) John Erickson.”

FOR SALE BY DEALERS OR POSTPAID 50 CENTS

Ask for FREE copy of The Cattle Specialist and how to at The Practical Home Veterinarian

Without cost. Veterinary vice FREE.





DB. DAVID ROBERTS VETERINARY CO» INC» 124Grand Ave., Waukelhl. Wll.





.’ \___.‘ ‘_. I \__’ ‘._f \AA





satisfaction.





Wax Dilators to heal without closing. l





Write us dealer’s name and we will mail r

generous package free. At dealers 25c. ~





 





l





l

l

!





I





 





l





f salts and two quarts of raw linseed oil without





, tigez'ous‘





 

 

   

   





‘.





 

 

 





 

   

   

   

 





 

 





—' “





2...





 





HOGS





0R SAl.l£~—I)urov Gills of type and quality. bred



to High Orion No. 265227. Also a, row spring

boars at right prices. Shipped (I. O. D. on ap-

proval. W. E. BARTLEY, Alma. Mich.





DUROC SOWS





Sold at. a. sacrifice. Never a. better time to start in

the hog business. The longer the market stays down.

the higher and faster the come back. “'9 guarantee

LAKEFIELD FARMS. Clarkslon, Mich.





DUROC BRED GILTS





bred by and to State Fair Winners. good type and

quality, sold at a sacrifice and satisfaction guai‘iiir

teed. . P. HELLNER. R. 5. Ann Arbor. Mich.





" l. e '. '

‘n u R a c s blind 1'l‘hti' illflf‘wfafmfdlg.





I mind to sell.





Correspondence or inspection invited.

NORRIS STOCK FARMS. Casnovia. Mich.





Auction Sale, March 27





35 thoroughbred (‘licstei‘ Vl'liite gills, 8 boars. ADAM

STUECK. Pigeon. Mich.





I , '

O-l-C- HOGS on hme llit‘tszft

Originators and most exteusive breeders.

THE L. B. SILVER 00., Box l96. Salem. Ohio





Registered 0. I. C. Fall Pigs

best of breeding from prolific sows. Shipped on

approval. J HUDSON. R. 2. Romulus. Mich.





I C’s Good last spring pics. not akin

‘ ' ' also fall pigs, recorded free.





OTTO SCHULZE &. SONS. Nalhville. Mich.





t of breeding. Shipped on approval.

KENNEDY 8:. SONS. R. l. Chelsea. Mich.





Registered 0.l.C. Gills 1&2? ,EW‘WK, ”W?

MANN, Dansville. Mich.





.

Large Type Poland Chmas

Full pics rendi' lo ship, sin-d by nu two great herd

boars. L's. Big Wonder. by Sit-vor's Smooth Wonder

and Big Slrartoii by The lledl'omt-r, and from my

host sows. Priced reasonable. W. E. LIVINGSTON.

Pai'ma. Mich.





F O R S A L E Poland t‘liinzi boars of I‘lal‘t'll



and April furrow. Also some)

choice bred gills, due to furrow in March and April.

Every one iminuncd for cholera. WESLEY HILE.

Ionia. Mich.





LARGE TYPE .1;





G. TAYLOR. Balding. Michigan.



A FEW good 'Hamtnfhire spring boars at e.

. argaJn. are your order for bred.

mlts. JOHN W. SNYDER. St. Johns. Mich. R. 4.





SHEEP

FOR SALE 20" Yomllnlt ewoe bro: (on





land) aft“ M. '

HAYES, Muir. Mich. H In 1“





HORSES

Bol'niau Stallion (‘01. Eril' N,

Eagerandstaile S 101:53'1 light sorrel With( ‘Wlll‘tll

av . ure 0:: getter. weight 2,000 lb.

WM. BRANNAN. Williamston. Mich. a

A few young Rog. Percheron





F0 R S A L E stallions. also some Reg.





mares. all ages, and at tho rilit )I‘"“. i

ROHLFS, Akron. Michigan. g I“ ‘





0R SALE—Matched team. 7 & 8 \‘1‘8. old e' I

3.800 lbs. Sound. E. H ‘ ' 'm“





 





 





 





 





 





 





 

 





, part in community affairs. They par-

M ticipate in church and social activities

$10 and are leaders in the local grange.



. > _ Mr. Brist-ow has been master of the

sétflilii‘é‘ Flat Rock grange for several terms,

————-—~ is a member of the local farm bureau,





 

   

   

 

 





 

   

   

 





the milk producers associatiou, and.

the local board of commerce. They

have two children, Alice Mary, nine;

years; and Allen William, four years.

AliceMary is in the fifth grade of the;





 





local school.





i

l

- - . ROWE. , . _

Attractive IW‘PS (ml R. l. Portland phone 335 2 L 2 3. Ln" men





 





FAIRFIELD Slllllllllflllll m... “a...





for

service bulls. sired by Wilkinliolm Monarch. H. 8. Erin; good blank mg. Percheron

Peter: 0. Son. Elsie. Mich. FOR SALE Stallion, 20 mo. old. a ton pros.





pout. L. B. STRUBLE 8:. SON. Muir. Mich.

lleglelered





 





Brown Swiss for sale, rows 10 and l

11 yrs. old due in Feb. 2 bred





 





 





 





letters. Also bulls of serviceable us. A. A. ’ MULE

.FELD‘KAMP. Manchester. Mich. S

w ANTED m. .... mm» mm m

Michigan. Prefer mares.





Milking Shorthorns 3““ ”‘d “m“ '°' “

pale. all ease. Some Must be young. sound, gentle, and honest pullers

elfers. Best Clay breeding.‘ 18VlN’ Weight aroun lads apiece or more. m





 





extra line bred II I! 1.

BOA" t 80MB. Onemll. Mloh. Box “I. Mlohlun Farmer. Detrolt.





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

   

   

   





"M" . A. ”3... an"... ,.
GRAIN QUOTATIONS.

Monday, March 12

Wheat.

Detroit—No. 2 red at $1.61; No. 2

white $1.60; No. 2 mixed at $1.60.





Chicago —~» 31 a 1' ch 331.36%: Al :1 y

511.36%; Jul y $13494; September

$133334.





Toledo—\Vheat, No. 2 red at $16113

@$1.621,§.

Corn.

Detroit—No. 2 yellow $1.04;

yellow $1.01: No. 4 yellow 99c.

Cliicago—AMarch 9-lilgc: May 97390;

July $1.00‘,’; September $1.011/2.

Oats.

Detroit—No. 2 Michigan 631/20; No.

3 white 620; heavy oats 20 premium.

Chicago—March 55%.c: May 56%c;

July, old, 5214c; new 52%(2; Septem-

ber, new, 47:340.

Rye.

$1.93;





No. 3





Detroit——No. 2 Canadian $3.





Cliicago--—— M a r c h 551.1675: M a y

$11734; Jul y $11034; September

$10334.



Toledo—~$1.23.



Beans.



Detroit—Immediate and prompt





shipment $8.20 f. o. b. shipping points.



New York—»—Pea. domestic at $800617

$8.75: rcd kidneys $8.50@9.50 to the

wholesalers.



Chicago—Spot navy beans, Michigan

choice, hand-picked, in sacks at $8.50;

dark red kidneys $10.50.



Barley.



Dctroit—~»Z\lalting $1.01; Feeding 970.



Seeds.



Detroit domestic seeds:—-Cash clo-

ver $16.80: October $13.70; March

$15.45; cash alsike $15.75: March

$15.95; timothy at, $1.90; March $1.90.

Hay.



timothy at $13.00@

$14.00; standard $12.!hlfii]3.00: No. 2

timothy $10.00@1_l.00; No. 1 light

clover, mixed $134014; No. 1 clover

$11.50@12.50; wheat and oat straw

$10.00@11.00; rye. straw $11.00fi)12.00

alfalfa hay, alfalfa choice at Chicago,

$15.00@25.00.





Detroit—No. 1





Feeds.



Detroit—Winter wheat bran at $44:

spring wheat bran at $43; standard

middling at $43; fancy middling at,

$45; cracked corn at $45; coarse com

meal $43; chop $38 per ton in carlots.

Poultry feeds with grit $49.00; with-

out grit $54.00 per ton.



WHEAT.



The advantw in ulna: priCes which

started early in February and which

carried future delivvries upward about

10 cents a bushel has been checked

in the last. few days. Trade interests

appear to be more impressed at the

moment with the fact that l't‘St‘l'Vt-S of

wheat are larger than a year ago,

than with the unexpectedly large ap-

parent disappearaIICe in the last eight

months. Also, the dry area, in the

southwest has had some rain.



Not until growingr weather arrives

will it be possible, to appraise the

amount of damage to the new winter

wheat crop, but b01li oilicial and un-

official reports point to larger aban-

donment than usual east of the Missis-

sippi River. Also, the dry area. in the

southwest has been only partly re-

lieved. While the. prospective increase

in abandonment of acreage above nor-

mal may not be enough to eliminate

the gain in the area planted, reports

of damage are bound to have an ex-

'citing effect on the market.





Rye stocks are slowly increasing

but they remain below normal and





enough is being sold for export for

spring shipment to reduce pressure.

Rye prices reached a new high point

for the season early in the last week.





CORN



Corn prices have been marking time

for three weeks. ReCeipts have been

heavy in the last ten days although

they have started to taper off again

and it is probable that they will di-

minish rapidly as farmers become

busy with field work. Shipping de—

mand has been broad, so that the addi-

tion to the visible supply from,the

heavy movement. recently has not ,been

excessive. Stocks total 41,000,000

bushels compared with 47,000,000

bushels a year ago. Export trade con-

tinues disappointing and Argentina is

still clearing twice as much corn for

Europe as the United States. If im—

porting countries take as much corn

per week during the next three

months as they have been taking dur-





ing the past six months, it Will be

necessary for them to purchase freely

in the United States.





OATS.





Oats prices, have advanced to a new

high point for the season. Demand

has increased without a. corresponding

gain in receipts, resulting in the first

reduction in the visible supply of any

consequence since early in the year.

Farm reserves on March 1, according

to the official estimate, totalled 377,-

000.000 bushels compared with 422,-

000,000 bushels a year previous. This

is the smallest quantity reported





since 1912.

SEEDS.





The seed market has shown a ten-

dency to stiffen in the past week al-

though farmers have not yet started

to buy in any quantity. Dealers are

still confident that orders will come

in a rush with the first evidence of

real spring and that demand, though

later than usual, will be fully up to

normal. There is still a good-sized

carryover of most field seeds, particu-

larly sweet and red clover and timo-

thy seed, in surplus producing sections

which is taking care of much of the

local trade in those areas. Red and

alsike clover seed declined during the

week, but alfalfa, white and sweet c10-

ver remained unchanged.





FEEDS.



The mill feed market is very strong

with bran and standard middling still

advancing. Prices average from $5.00

to $6.00 a. ton higher than at the cor-

responding period a year ago. Mixed

feed manufacturers have been heavy

buyers of both bran and middlings.

Cottonseed meal has not followed the

advance in wheat byproducts.



Chicago—Bran. $36 standard mid-

dlings, $36.50; hominy feed, $37.00;





gluten feed, $38.70; old process oil

meal, 34%, $52.00; tankage, 60%, $65;

cottonseed meal, 43%, $52.50.





HAY.





The hay market was strengthened

last week by less liberal supplies and

prices for timothy averaged around

$1 a ton higher than the low point

reached in February. Dissatisfaction

with prices offered them for hay kept

farmers from loading hay and the

smaller receipts were promptly re-

flected in the stronger market. Ship-

ping inquiry for prairie hay remains

dull as a result of the abundance of

local forage and moderate require-

ments in many principal consuming





areas.

EGGS.





The downward trend in fresh egg

prices was halted last. week and

prices have been marked up over two

cents a dozen from the low point of

a week ago. The season in practically

all sections of the country is later

than a. year ago when it was unusu-

ally early. Consumption is on a. broad

scale and gives no evidence of any

curtailment. Dealers are entering the

market for good sized lots of eggs for

storage and eggs are going into ware-

houses freely. In addition, egg break-

ing plants are in operation. furnishing

an outlet for many eggs, particularly

in the central states and southwest.

Some dealers fear a heavy lay later

in the season which would permit

storing to continue late into the sum-

mer and fame prices down, but for

the immediate future, they seem fair-

ly Well pegged.



The .movement of poultry from

farms is showing the usual seasonal

decrease as the heavy laying season

gets under way. Prices generally are

steady.



28(1)





Chicago—Eggs: fresh firsts,





 





 





Live Stock Market Service ]





 





Monday, March 12





CHICAGO.

Hogs



Receipts 53.000. Market active, 10

".1150 higher than Saturday’s average;

all interests buying; stots light lights

and pigs 23c higher; tops $8.65 paid

for choice 180210-1b. weight; bulk bet-

ter grade 170-220—1b. average $8.35@

$8.50; tops 230—270»lb. largely $8.20@

$8.40: good to choice 280-340-lb. butch-

ei‘s $80040825; strictly choice 140-160—

lb. average up to $8.50: bulk medium

and good grades $7.506i835: pigs

largely $6 2507.25; choice weights up

to $7.50 and better; bulk packing

sows $ti.85@7.35.



Cattle



leCwipts 16,000. Market matured

steers 157i>25c lower; slow at decline:

bids off more on weighty kind scaling

1,300 lb. up; light yearlings fully

steady; packers and steers strong, 25c

higher; fat. cows and heifers steady;

small killers and shippers on specula-

tive account; packers moving slow,

bidding 75cw $1.00 lower on vealers;

few early vealers $12.00@12.50; light

offerings 75c lower, prospects $12.00

@$12.50; some light offerings with

better grade $13.00fll400, few $14.50;

sausage. bulls 15®25c lower, topping

$7.75@8.00 on choice medium kind.



Sheep and Lambs



Receipts 19,000. Market on lambs

withfinish. 90-lb. down, active to out-

siders strong to 25c higher; shipping

demand fairly broad; packers steady:

good handy weights to outsiders $16.25

fi7$16.50; bulk 90-96—lb. lambs $15.75“

$16.00; best 89-lb. clipped lambs

$13.75; good 79-lb. fall clipped $14.40;

light, small, choice feeding and shear-

ing lambs strong, feeding $142507"

14.75; fat and feeders to traders $16.





DETROIT

Cattle.



Receipts 925. Market active and

steady.

Fair to‘ good yearlings



dry-fed ............... $11.00@12.50

Fair to good heavy steers,



dry-fed ............... 11.00@13.00

H a n d y weight butcher



steers ................ 10.50fiir11.50

Fair to good heifers . . . 9.50@10.00

Common light butchers. . 8.006? 9.50

Best cows ........ . . . . . 8.5007) 9 00

Butcher cows . . . . . . . . . . 7.00“? 8.00

Cutters................. 5.75@ 6.25





Canners ........... .. . .. 5.00@ 5.50

Light butcher bulls ..... 3.50@ 9.75

Bologna bulls ........... 1.50@ 8.25

Stock bulls ............. 7.00m 8.25

Feeders ................ 9 00@10.00

Stockers ................ Hill/(1710.00

Milkers and springers. . . .75.00@115.00

' Calves.



Receipts 790. Market steady; very

slow on common.

Best ..... . ......... $16.50@17.00

Others .................. 8.00/@1625





Sheep and Lambs.

Receipts 587. Market steady to 250





higher.



Bulk good lambs ........ 31600191625

Best lambs ............. 16.25@16.75

Fair lambs ............. 12.50@14.25

Light lambs ............ 1000601200

Yearlings ............... 12.00@13.25

Fair to good sheep ..... 6.0060 8.75

Buck lambs ............. 7.50@12.25

Culls and common ...... 3.00@ 5.50





Hogs.

Receipts 1,465. Market mixed hogs

15c. higher; roughs 10c; pigs 50@75o





higher; others steady.



Pigs ..................... 7.25

Mixed hogs ............. 8.75

Lights .................. 8.25

Roughs ................. 6.85

lood Yorkers ........... 8.75

Stags ................... 5.50

Extreme heavies ........ 7.00@ 8.00



BUFFALO.





Hogs

Receipts 90,000. Hold over 611;





market active 25c higher: pigs and

light lights r50c@$1.00 higher; 160-





250-lb. $9.25, few $9.15: 280-300-1b. $9;

pigs mostly $8.00; 130-150-lb $8.25@

$9.00; packing sows $7.00@7.75.

Cattle



Receipts 1,200. Market slow, steady;

good 1,048—lb. steers $14.25, few $13.00

@$13.25; bulk medium grades $10.75

@$12.50; yearling heifers $12.25; few

weighty heifers $11.00; others $9.00@

$10.50; fat cows $3.00tm950; all cut-

tfigr80$5.50@6.50; bulls $6.50@8.50, few





Calves



Receipts 14. Goo-d $17.00; culls and



common $9.00@12.50.

Sheep and Lambs



Receipts 3,000. Market active, most-

ly 25c higher; good to choice lambs

$17.00;

@$9.50.





‘ continues large.





throwoffs $15.00; fat ewes $8





28%c; extras 36@36%c; ordina

firsts, 27c; dirties, 26c; checks, 251,513:

Live poultry: Hens, 26c; capons, 28??

30c. springers, 29c: roosters, 200;

ducks, 280; geese, 16c; turkeys, 280.

Detroit—Eggs: fresh receipts, best

quality, 28(13281420; dirts and checks.

251/?c. Live poultry: medium heavy

springers 25@31c; white leghom

springers, 24c: heavy hens. 260: me-

dium hens, 27c; roosters, 1860190: ;ca-

2193125, 36@37c; large white ducks,l 30

c. ‘





BUTTER.





The strength which developed in, the

butter market a week ago has been

continued and prices of 92 score

creamery in the Chicago wholesale

market have advanced steadily to the

highest point since the first of Janu-

ary and fully 4 cents a. pound higher

than the low point of a fortnightago.

Receipts have been kept. closely

cleared and in addition, the use of

storage butter has been on a larger

scale than at the corresponding period

a year ago. No further increase ofcon-

sequence in fresh butter production is

expected until close to the grass sea-

son which is six to eight weeks away.

Not all of the recent advances in

wholesale prices has been passed on

to the retail trade so that consump-

tion has not suffered as a result of

the recent firmness





Prices on 92 score creamery were:

Chicago, 491/20; New York, 510;.De-

troit, 46@49c per lb.





POTATOES.





Although farmers are shipping

rather heavily, the potato market con-

tinued firm at higher prices last week.

Prices are attractive to growers who

are bringing potatoes out of storage

and hauling as rapidly as roads per-

mit. Idaho stock is meeting a very

active demand and prices at shipping

points are steadily advancing. Many

growers are inclined to hold for higher

prices later on. Far western markets

are so well supplied that they offer no

outlet for Idaho stock, but shipments

to middlewestern, southern, an d

eastern markets are large. VV'isconsin

round whites, U. S. No. 1, are quoted

at $2.20 to $2.35 per 100 pounds,

sacked, in the (‘hicago carlot market.





BEANS.





The bean market, continues to ad-

vance with C. H. P. whites now quoted

at $8.40 per 100 pounds, sacked, f. o. b.

Michigan shipping points. Demand is

slow at the high prices, but offerings

are limited and the market seems

firmly pegged.





WOOL





Activity in the wool trade has di-

minished recently partly because of

small stocks of wool still in dealers’

hands and partly because mills have

filled enough of their nearby require-

ments so that they are willing to pay

the higher prices asked. Some. buying

is going on, including both fine and

medium grades, where particular types

of wool are nedeed and occasional

bids are being placed for additional

amounts at prices a few cents per

scoured pound below dealers’ asking

prices. Foreign markets continue firm

although no new advances have been

registered. American buyers have

been less active in Australia recently,

but England, Germany, and Japan

have bought more freely. Contracting

in the west has practically ceased al-

though some purchases of medium

wools at 33% to 35 cents in Wash-

ington have been reported recently.

Texas growers are holding for 45

cents.





DETROIT CITY MARKET





Apples, $1.80@5.00 bu; bagas, 50@

75c bu; beets 50@90c bu; cabbage,

40@75c bu; carrots, 50t’tlt750 bu; celery

local 50@65c doz; eggs wholesale,

white 29@300 doz; ‘brown 28@29c doz;

retail, 35@40c doZ; dry onions 75c@-

$1.50 bu; root parsley $1.25(_(_?;1._50 bu;

curly 35@40c doz. bchs; parsnips 50c

@$1.50 bu; potatoes 65c@$1.40 bu;

poultry—hens, wholesale, 25@300 lb;

retail 30@320 lb; broilers. wholesale,

leghorns 24@27c lb; rocks 26@32c

lb; retail 30@35c 1b; ducks 26m30c

lb; dressed poultry retail 35@380 lb;

ducks 35@40c lb; horse radish $6.00@

$8.50 bu; Hubbard squash $1.75@2.00

bu; turnips 75c@$1;75 lam-«butter 60c

lb; leeks 65@90c,doz. bchs; dressed

hogs 13@150 lb; live pigs $5.00, ea;

veal'23,@r24olb‘tw - . .....' ..,,, ‘





~ I . .

.~. 1., ‘ a”





and distribution ,





 





\m": if?





\





.zr—W .mm L; ,
to Kim





—\Uv"“





 





mesa—5:32:52; ~._. ri'r‘f . _





l

i

\

l





 





MARCH 17, 1928





VETERINARY





 





Constipation—Rabbits hold head

sideways and occasionally shake them

as if something was in their ears.

They seem a bit dizzy and are slow

to move. A stiffness then comes over

their hind parts and they walk instead

of hop. If one attempts to sit on

his haunches to wash his face it may

fall over and then will try again. They

grow worse until they lean against

something for support. Kept in out-

side enclosures and are fed oats, Icar-





 





THE MICHIGAN FARMER





rots, bred, and water. No discharge

at nose. J. R.—-I believe your rabbits

are troubled with constipation and in-

digestion. A change of feed would

be advisable. Feed a little alfalfa or

clover hay—either green or cured.

Discontinue bread and feed a more

varied grain ration. Mix bran 1%

parts, oats ground and whole of each

1 part whole wheat and cracked corn

of each 1/2 part and hominy 14 part.

Twice a week, mix a. little fine salt

in the feed. Reduce the feed for sev-

eral days and give teaspoonful castor

oil daily until the bowels move freely.





 





consecutive insertions 7 cents a word. Count as





charge to words. .





 





CLASSIFIED ADVERTISING





This classified advertising department is established for the convenience of Michigan farmers.

Small advertisements bring best results under classified headings. Try it for want ads and for

advertising miscellaneous articles for sale or exchange. Poultry advertising will be run in this do-

partment at classified rates. or in display columns at commercial rates.



Rate 9 cents a word. each insertion, on orders for less than four insertions: for four or more





display type or illustrations admitted. Remittances must accompany order.

Live stock advertising has a separate department and is not accepted as classified. Minimum





a word each abbreviation. initial or number. No





 





 





   





One Four One Four



Words time times Words time times



10. . . . . . . 40.90 32.80 26 ........ $2.34 $7.28

1 .99 3.0 . . . 2.43 2.



12..... .. 1.08 3.36 28 ........ 2.52 7.84



.17 3.64 29 ........ 2.61 8 12



1.26 3.92 30 ........ 2.10 8.40



1.35 4.20 . 8.68



. 1.44 4.48 2. 8.96



1.53 4.16 .97 9.24



1.62 5.04 . 9.52



1.11 5.32 3.1 9.80



1.80 5.00 . 10.08



. 1.89 5.88 31 ........ 3.33 10.36



1.98 6.16 38 .. . 3.42 10.04



2.01 6.44 39. . . . . 3.51 10.92



2......” 2.16 6.72 40........360 11.20



25. . 2.25 1.00 41........ 3.69 11.48





. . All advertising re”.



SpCClal Notlce discontinuance ordan.



or change of ray in-



truded for the Clam‘flad annnunf mm! Hath lhl: ofir: 2m

day: in advance of Median data.





REAL ESTATE





FARM AND ENJOY LIFE where farming pays—~in

upper Wisconsin. the Cloverland of America. Great

dairy country—clover grows wild. Potatoes. barley,

oats. rye. hay. never failing crops. Plenty sunshine

and rain, Good natural drainage. Lake country—

fishing, hunting, trapping, Fine roads. modern

settlements. high schools. churches. cream routes.

telephones. Near biggest markets in U, S. 000

pleased settlers. 40 and 80 acre tracts $12 to $30

per acre. Lake land somewhat higher. Good terms.

small down payments, 10 years on balance. Start

now, we show you how. Our free book ':Happy

Homes and Farms That Pay in Happy Land con—

tains letters from settlers. pictures of homes ‘and

country. Write for it today, Edward Ilincs Farm

Land Co.. Room 2152. 100 W. Monroe St.. (.hicpgo,

Illinois.





IN THE SAN JOAQUIN VALLEY of. California

general farming is a paying business. feeding millions

of people in towns and cities._ Alfalfa combined With

dairying, hogs, and poultry. yields a good income. _A

small one—family farm. with little hired labor, in«

sures success. You can work outdoors all the year.

Newcomers Welcome. The Santa Fe Railway 'has no

land to sell. but offers a. free service in helping you

get right location. Write for illustrated San Joaquin

Valley folder and get our farm paper—“The Earth

free for six months. C. L. Seagrai'es, General Colon-

ization Agent. Santa. Fe Railway. 912 Railway Ex-

change. Chicago.





SPECIAL OFFERr—Federal Land Bank offers limited

number of farms at bargain prices. Write today,

for new descriptions of farms in North Dakota.

Minnesota, Wisconsin, Michigan. Deal direct With

owner. no commissions These farms are priced to

sell~-—small down payments——$200 to $1,000—easo

terms on balance. Land prices are going up. Buy

now at our low prices. Write to Federal Land

Bank, St.. Paul. Minn. Dept. 33





$800 SECURES 80 ACRES—Fully equipped, furni-

turc, crops. 0n improved road to thrivmg Village,

spring-watered pasture; pretty maple sheltered ~5-room

house, 50—ft. barn. granary. poultry. hog and tool

house. Aged owner sacrifices all for $1,000 and W111

leave team. cow‘s. flock poultry. turkeys. hogs, tools

and implements. crops and furniture; half needed.

Details pg. 42 illiis. catalog. Copy free. Strout

Agcncy, 1105—150 Kresge Bldg, DetrOit. Mich.





OME T0 EASTERN OKLAHOMA. We have bar-

gains in improved farms of all sizes, adapted for

grain, stock, and poultry raising, dairying and fruit

growing. Excellent markets. good school and church

facilities in an all year climate that makes life worth

living. Write today for free literature and price list.

National Colonization 00.. Room 122, 13 E. 3rd St..

Tulsa. Okla.





FARM BUYERS ATTENTION 40 acre clay loam

farm improved, fair house. barn 36 x 70, 5110. gra-

nary, windmill. etc. Price $2,000, down. payth

$500. No trades. U. G. Reynolds. sells farm. Glad-





wln. Mich.





.N LAUS COUNTY. California—where farmers

fifekprbssperous. Crops growing all year round. ~Land

priced low. Write free booklet. Dept. 6. Stanislaus

County Development Board '(County (bomber of

Commerce). Modesto. California.





FOR SALE—160 acre farm in Oceans. 00., clay soil,

all tillable. four miles north of Bolton. improved

roads. twelve room housa. furnaces and bath. Larg-

basemcnt barn. Price $16,000, Minnie Ayers. Mara-





thou. N. Y





LE—’—Michigan Farm Lands. Osceola and

{gr}: Cso‘Iinties. From small acreage to ranch size.

One forty at $800. one sixtyat $1,000, both good

soil. Some exceptional bargains at from $3,000 to

$7.000. M. E. Beecher. Reed City. Mich.





E IN YPSILANTI. 10 beautiful rooms. steam

{1.32, paved street. near Normal College. $10,000.

Easy terms. Address 956 W. Cross St.. Ypsilanti.





Michigan.



. C'RES, some fruit. buildings. 11.4 miles _U, s_

(3?, A$4.500. Would rent. Charles Fitch. Ludingbon,

Mich. ‘ »





FISTULA HORSES CURED 35. Pay when well.

Chemist. Barnes. Kansas.





—

L





EXCHANGE





WANTED—To exchange vacant lot near Detroit for

farm machinery in good condition. Address Earl

Smith. Pontiac. Mich., Route 4.





 





 





FLOUR AND FEED MILL to trade for Michigan

Farm. by owner. H. M. (.‘osier, Bear Lake, Mich.





GRAFTING WAX





CAN FURNISH EITHER A HAND OR BRUSH

wax. Made after Michigan State College formula.

Immediate delivery. Prices as follows: One pound.

45c: five pounds, $2.10: ten pounds. $4.00. Postage

extra. Special prices in larger quantities. M. .

Hunt 6: Son. Lansing, Mich.. Box 525





 





 





FARM MACHINERY





HUMMER-SATTLEY: 76 years in business. (at. prices

on tractor. orchard and garden disc barrows. Both

8. Bean. Jackson. Mich.





 





 





WANTED





USED MACHINERY WANTED. small .thrieshea'. com-



bine. Fordson tractor and accessories. governor; puliqv.



gee. 01State lowest price. Box 143, Michigan Farmer.

tr t.





 





 





PET AND LIVE STOCK





REGISTERED FOXES—Write for ranching offer.

100% increase guaranteed. Booklet: terms. Breeder-

Agents wanted. Clear! Bros. Empire Bldg. Seattle

Washington.





 





SALE. TWO GOOD MILK GOATS. be fresh this

month. forty dollars. 3 miles wcst. 4% miles south

Bad Axe. Joe Vairo, R. 3. Bad Axe. Mich.





RABBITS—Make Big Profits with Chinchilla Rabbits.

Real money makers. Write for facts. 892 Conrad's

Ranch. Denver, Colorado.





MINK FOR SALE: select Ontario stock. Finest

quality obtainable. Write. Head Fur Farm, London.

Ontario.



MATTRESSES





MATTRESSES made any size. low factory prices.

Catalog free. Peoria Bedding Company. Peoria. Ill.





 





 





FRUIT TREES AND NURSERY STOCK





TWO-YEAR CONCORD PLANTS from highest pro-

ducing vineyard in Michigan. three dollars hundred.

Garden collection. six each, Concord, Niagara. Dela.-

ware, dollar, prepaid. Agents wan-ted. Root 8: Son.

Paw Paw. Mich.





 





 





5 MONTMORENCY CHERRY $1, up. 20 Concord

Grapes or 5 Norway Spruce Ever-greens. 3 yrs., twice

transplanted $1 postpaid 150 miles. Gables Nurseries,

Goblcs, Mich.





 





 





PLANTS AND BULBS





TIFTON'S RELIABLE PLANTS. Frostproof Cab-

bage. Early Jersey and Charleston Wakefield. Flat

Dutch. Succession. Danish Ballhead. Copenhagen

Market and Golden Acre. Tomato Plants: Bonnie

Best. Greater Baltimore. Livingston Globe. John Bear

and Earliana. Bermuda and Prize Taker Onion

Plants. Ruby King and Bull Nose Pepper Plants.

Postpaid. 250. $1.00: 500. $1.50: 1,000, $2.50. Ex-

press Collect $1.50 per 1,000. Care used in pack-

ing. We guarantee to arrive in good condition.

Tifton Plant 00., Tlfton, Ga.





 





EARLY VEGETABLE PLANTS for early crops.

Frostpmof Cabbage Plants: Jersey Wakefield. Charle-

ston Wakefield. Golden Acre. Copenhagen Market.

Flat Dutch. Tomato Plants: Earliana, Bonny Best.

John Beer. Stone, Onion. Beet, Lettuce. Potato

Plants. Prices all above: Postpaid. 100. 50c; 500.

$1.50: 1,000. $2.75. Express collect, 1,000. $2.00:

5,000, $8.75: 10.000.315.00. Packed inmoss. de-

livery guaranteed. Pledmont Plant C0,. Albany. Ga.





 





MY FROST PROOF Cabbage Plants will make headed

cabbage three Weeks before your home grown plants.

I make prompt shipments all leading varieties. Post-

mid 500. $1.50: 1,000. $2.75, Express $2.00. 1,000.

Special prices on large quantities. Tomato and pen-

per plants same prices. First class plants. roots

wrapped in moss. P. D. Fulwood. Tifton, Ga.





 





COPENHAGEN, WAKEFIELD. FLAT DUTCH.

frostproof cabbage plants. $1.00 1.000: Bermuda

Onion $1.00: tomato $1.00: collard $1.00; Ruby King

P $2.00: Porto Rico Potato $1.75. Good plants.

,- refully packed. Prompt shipment. Quitman Plant

.5. Quitman. Ga.





 





F—Ji



MILLIONS. nice frost proof cabbage. and tomato

plants. leading varieties. 81. 1.000. Bermuda Onion

giants $1.50 1,000. Clark Plant 00.. Thomasville,

eorgia.





 





III—80 acres. clay soil, good buildings, 2 miles

21313 tovv'n. consideration $4.500. Thomas Reid.

Emmett. Mich.





‘ALE 0R RENT. 140 8(‘1'05. good land and

:33 bbuildings. Rudolph HaSSlcr. Sandusky, Mich.





4—-

L





 





 





WANTED FARMS





TED-«To hear from owner of. land for sale for

grAirlfgdelivei-y. O, Hawiey. Baldwm. Wis.





MISCELLANEOUS





NFW HOUSEHOLD DEVICE WASIIEB~~drles win-

dows. sweeps. cleans walla. scrubs. mops. Coats laps

tban brooms. Over half profit. Harper's. 173 Third

Stalwart. loan.





0





 





SEND NO MONEY. C. 0. D. Frost Proof Cab-

bage and Onion Plants. All varieties. Prompt ship-

ment. 500. 65c: 1,000. $1.00. Standard Plant 00..

Tifton. Ga.





$1.00 BARGAINS POSTPAID: 50 Mastodon: 125

Champion Eveb; 50 Cumberland: 25 Concord 2 yr.

Present with each order. Plants state certified.

George Stromer. (R. M.). New Buffalo, Mich.





C. 0. D. FROST PROOF Cabbage and Onion Plants.

Quick shipments. All varieties. 500. 05c: 1.000. 81-00.

Farmers Plant (30., Tiftnn. Ga.





GENUINE MASTODON WERBEARING World’s

largest strawberries, 100 $1.75. Catalog. Edwin

Lubke. New Buffalo. Mich.





GLADIOLUB —Ilainbow collection. sixty large bulbs

prepaid. one dollar. F. L. Wright. Stockbrldze. Mich.





 





 





 





SEEDS





CERTIFIED IMPROVED ROBUST SEED BEANS,

choice in every respect. One to nine bushels. seven

dollars bu., ten or over, six seventy-five. Bags {me

and freight prepaid Michigan on orders received before

May, Acceptance of your check insures delivery by

May 15th. No checks cashed before May. A.

Cook. Owosso. Mich.





 





 





CLOVER—~88 per bu. Home grown double recleaned.

Guaranteed to comply state seed law. Scht clover.

scarified. $3.90. Hardy northwestern alfalfa, $9.90

per bu. State certified Grimm at lowest prices. New

timothy. $1.00 per bu. Sacks included. Write for

samples and circular matter. Frank Sinn. Box 457.

Clarinda. Iowa.





 





BUY YOUR GRIMM ALFALFA direct from the



Introduces: Lyman's Genuine Grimm bears 3 to 4



crops yearly. Leaner and higher in feeding value



than other varieties. All seed scarif‘icd necessitating



loss per acre. Also ask about our No. 2 Grimm.

B. Lyman. Introduccr, Excelsior. Minn.





 





SEED CORN, 8 row large type Yankee com. nothing

better for early hogging off. Also choice selected

Pride of the North Ycllow Dcnt.. Those seeds give a.

very high germination test. We furnish thorn at

$3.00 per bushel, either shelled or cars, F. O. B.

Mention. Mich A. E. Beebe & Sons.





REGISTERED AND CERTIFIED SEED CORN-

Clement's white cap yellow dent. Picketts yellow dent

and Michigan yellow dent (a very early dent). Cer-

tified worthy oats. 2-row barley and sweet. clover

seed. Dept. A. Paul C. Clement. Britoon, Michigan.





REGISTERED k CERTIFIED Polar Dent Seed Corn

and Gilbert's Yellow Dent. the corn that made Mich-

igan's highest official record of 112 bu. shelled corn

per acre in year 1925. Ernest Gilbert. Waldron.

Michigan.





 





EVERY HOG RAISER should grow artichokes. Thw

will furnish 00 days of the highest quality of early

spring feed for hogs before clover is ready. Seed

only $3.00 per bushel, in quantities at less price

F. O. B. Mendon. Mich. A. E. Beebe dz Sons.





REGISTERED and certified Golden Glow seed corn.

germination 97%. Inspected by Michigan Crop Im-

provcment Assodation. Write for circular. P. A.

Smith, Mulliken, Mich.





SCIENCE AND PRACTICE demonstrate Improved

American Banner Wheat. Wolverine oats, Improved

Robust beans best for Michigan. A. B. Cook.

Owosso. Mich.





SWEET CLOVER SEED. white blossom. grown north-

cm Michigan. Recleancd, scariflcd. Sealed bags.

Delivered your station $6.00 bushel. Thos. Buell.

Elmira. Mich.





STATE SWEEPSTAKES SEED CORN. Wilks' Gold-

cn Dent and Polar Dent. Field. selected. fire dried.

tnstcd. shellcd and graded to fit your plantcr. Ger-

mination 95 to.98%. John C. Wilk. St. Louis, Mich.





YELLOW DENT SEED CORN. Germination high

and guaranteed every yvay. Write us before buying.

Geo. W. Needham. Saline. Mich.





SWEET CLOVER SEED, White Blossom, cleaned.

hulled, $6 bushel. Guaranteed 95% 1mm. Thomas

Monroe, Essexville. Mich.





 





CHOICE SEED. Speltz, and Certified Wisconsin six

row barley. $1.50 bii. 10 bu. or more $1.30. Harry

Box. Lansing. Mich.





CERTIFIED WOLVERINE OATS—Won premium at.

International Grain Show and Farmers' Week Show.

J. W. Kennedy 0: Sons. Orleans. Mich.





 





CERTIFIED WOLVERINE OATS. Michllm'l lawn]

variety. 0. D. Finkbuinor. Clinton. Mich.





FOR SALE—Certified Robust Seed Beans. N. A.

Gifford. R. 3. Flint, Mich.





FOR SALE—Certified Wolverine oats. Boy Griffith.

St. Louis. Mich.





TOBACCO





GUARANTEED HOMESPUN TOBACCO—Chewing. 5

pounds. $1.25: 10, $2. Smoking. 10. $1.50. Pipe

Free! Pay postman. United Farmers, Bardwell.

Kentucky.





 





BEST CHEWING 5 lbs. $1.50: ten $2.50: smoking

5 lbs. $1.25. Common chewing or smoking 5 lbs.

$1; pay when received. Kentucky Tobacco Company.

West Paducah. Kentucky.





 





35—401





ACCREDITED WHITE LEGHORN CHICKS, Holly-

wood strain. Contest pullets now average 25 ounce

eggs per dozen. 1920 contest pen averaged 230 eggs

each. Ciistomer’s profit $3.00 per bird. Also An-

conas. llor-ks. Catalogue. Wyngarden Hatchery. Box

14, Zeelnnd. Mich._





 





CHICKS. We have had eighteen years’ experience in

hatching chicks of standard varietics. We personally

inspect and cull our flocks which are good producers.

healthy, and. pure—bred, Write for prices. Special

discount on five hundrcd and one thousand lots.

Shcpard Poultry Fnrm & Hatchery. Litchfield, Mich.





 





('IIICKS! LOOK! READ! Single Comb White and

Brown chhoms and Anconas. 100, $11.00: 500.

$50.00. Barred Rocks. 100, $13.00: 500. $00.00.

Mixed Chicks for Broilers. $7.00 per 100. Shipped

postpaid. 100% Live Delivery Guaranteed. Prompt

deliveries. Order direct from this advertisement.

Black River Poultry Farm. Zeeland. Mich.





 





BUY YOUR MICHIGAN ACCREDITED CHICKS

from an established breeder. Twenty-five years breed-

mg, seven years trapnesting, now under Michigan

R._O. P, Noted as profit producers. try Strick's

Chicks this year. Circular free. \Vrito Striok's

Poultry Farm. R. 4, Hudsoniille. Michigan.





 





PERSONALLY CERTIFIED CHICKS. all leading

varieties. perfectly hatched from Indiana's largest

poultry farm~hatchcry. For low prices and. Free

Poultry Book by Judge Tormohlen. write Mary

Maude Farms. Box 208. 'Portland, Indiana.





 





WHI'I'I'AKER'S REDS, BOTH COMBS. Grade A.

R. 0. I’. Trapnested. Grade B. Michigan. Certified.

Michigan’s greatest color and egg strain. Chicks and

eggs. Catalog free. Interlakes Farm, Box 9. Law-

rence. Michigan.





 





CHICKS. genuine English White Leghorns. overlap—

ing combs and non-setters. . Barred Becks 203-233

records. See display ad. Hillside Hatchery. Hol-

land. Michigan.





 





HE’I'I‘ER BABY CHICKS from State Fair winners.



production class. Eighty per cent of our chicks go



to old customers. Eleien breeds. Booking orders.



Illiyilng prices. Write. Litchfield Hatchery. Litchficid.

IC 1.





 





RILEY’S CHICKS—Produced from selected pure

bred-to—lay and exhibition flecks of healthy, carefully

culled breeders. Reasonable prices. Folder free.

White Leghorns, Barred Rocks. White Wyandottes.

Sunnybrook Poultry Farm. Hillsdale, Mich.





 





BARRED ROCK CHICKS of the better grade our



Specialty: Michigan Accredited. Strong and husky:



Bred-To-Lay strains. Reasonably priced. Write for



ibiifognation. Howe’s Accredited Hatchery, Essexville.

ic .





 





BABY CHICKS of all standard varieties. Flock?

carefully culled for laying. seicral yours. by M. S.

C. poultry men. Baby chick prices. 10c to 140: two

weeks old chicks 25c. Clinton County Hatchery. Max-

Well and K995, Prop's.. St. Johns, Mich.





 





BABY CHICKS——From our extra large type Eng. W.

Leg. Heavy producers. Get our circular More

ordering elsewhere. Prices low. only $107.50 per

1,000. A-l chicks. Model Poultry Farm. Zeeland.

B. 4, Michigan.





MONEY IN QUALITY CHICKS. Poultry expects

and satisfied customers back .our profit making chicks.

Illustrated catalog free. Get the facts. Windmill

Pointe Hatchery. I318 Alter Road, Detroit.





 





LOOK! 100.000 chicks 9c up. 20 varieties. Using

many 200 to 312 egg record bred ROI’ cockerels.

Send for free catalog giving big carly order dis-

counts. Lawrence Hatchery. Grnnd Rapids. Mich.





 





BABY CHICKS-S. C. White Leghoms $10 per 100.

Barred and White Rocks $13 per 100. Send for

catalogue. Snowflake Poultry Farm. L. Van Schio.

Prop. Route 5. Middleville, Mich.





 





FOLKS LISTEN. We increased our capacity, im-

proved strains of chicks and never quoted such low

prices, Write for price list. Merrill & Clare Hatc -

dries, Merrill. Michigan.





 





BABY CHICKS Pure-bred. None Bcttcr. Barred

Rocks. Reds, and Loghoms. Ilntu-h cic'ry Monday.

{lobfixiins Hatchery, 704 N. Cliipman St.. Owosso.

III' .





 





BABY CHICKS and eggs for hatching from bred to

II‘VIBUR Leghorns. Hillcrest Poultry Farm. Bath.

I('I.





 





BABY CHICKS—Rocks. Reds, and Leghoms. Each

week. beginning Feb. 13. All st.0ck bloodtested and.

Michigan Accredited. Pierce Hatchery. Jerome. Mich.





 





HOMESPU’N TOBACCO: Chewing 5 lbs. $1.25.

Smoking 5 lbs. $1. Pay when received. Pipe free.

Farmers Union. A5. I‘adiicah, Ky.





BABY CHICKS $0.00 per inn. Seconds. strong.

vigorous chicks. no cripples. Robt. Christopher. R. 4.

Holland. Michigan.





 





LEAF TOBACCO—Good sweet chewing 5 lbs. $1.25:

10 $2.00. Smoking 5 lbs. 90c: 10 $1.50. United

Farmers, Mnyfleld. Ky.





POULTRY

S. C. BROWN LEGHORNS, Purdue Demonstration

Farm. Production medal winncrs. Eggs postpaid.





45 $3. 100 $5.50. 500 $25.00. Floyd Robertson.

Lexington. Indiana.





BARRED ROCKS—Light line only. Trapncstcd, ex-





‘hibition quality. Heavy egg production. Eggs. two





dollars, fifteen. White. B. 10. Battle Creek.





Mich.





8 VARIETIES Record of Performance Male Matings,

Breeding cockcrels. bullets. and chicks. Free catalog

giving big early order discounts. Beckman Hatchery.

Box 57, Grand Rapids. Mich.





STOCK. EGGS. Chlx. Ducklings, Goslings. All vari—

eties chickens. ducks. geese. turkeys, bantams,

guineas. Arthur Jarvis, Waveland. Indiana.





 





S. C. R. I. RED COCKERELSiGood size: color.

Prices reasonable. Wesley S. Hawley. Route 3,

Ludington. Michigan.





BABY CHICKS





WHITE LEGHORN CHICKS from big white eggs.

Shipped anywhere c. o. d. Guaranteed to live Low

prepaid prices. Trapnested. pedigreed foundation

st0ck. Egg contest records to 314 eggs. Hundreds of

ceckerels. pullots. hens. Bargain prices. Big 28th

annual catalog free, George B. Ferris. 934 Union,

Grand Rapids. Michigan.





MICHIGAN CERTIFIED White Leghorns Chicks and

Hatching Eggs. First Pen Michigan International

Egg Laying Contest, 1926-1921. Record 2753 eggs in

52 weeks which is the highest record ever made in

Michigan Contest. Grade A. Chicks $10.00 per

hundred. Write for circular and prices on special

matings. Harry Burns, Millington, Mich.





"EGG—BREI)" chicks pay profits. Strength. vitality,

and heavy-laying. Safe deliiery guaranteed. Single

Comb “hits and Brown Leghorns. Single and Rose

Comb Reds. Barred Rocks. Queen Hatchery. Zoe-

Ianjd. Michigan. Heavy and light mixed chicks 80

an up.





BABY CHICKS—You can buy your early hatched

Michigan Accredited chicks right here at home.

First hatch January 15. Also booking orders now

for spring delivery at special discount. Send for

catalog and prices. Brummer-Fredrickson Poultry

Farm. Box 28, Holland, Michigan.





BARRED ROCK CHICKS and Hatching Eggs.

Record at Michigan International Egg Laying Con-

test; winners heavy breeds 1927. Highest Barred

Rook pen from Michigan past three years and to

data in present contest. F. E. Foals. Okemoa. Mich-

(an.





QUALITY BARRED ROCK CHICKS. Michigan An-

creditcd. .Pinecroft Poultry Farm & Hatche'.

Owosso. Mich. Write for circular.





TURKEYS





WHITE HOLLAND TURKEYS and White Pekln



Ducks. pure-bred healthy stock. Addressed stamped



gii‘erlope for reply. Alden Whitcomb, Byron Center.

C .





 





 





TURKEY EGGS. all breeds. Strictly pure—bred.

Also toms and hens. Eastern Ohio Poultry Farm.

Bealisville. Ohio.





FOR SALE—Purebred Bourbon Red turke's. Mrs

H. o. Buggies. Milford. Mich. I '





 





 





AGENTS WANTED





TENNESSEE ‘NURSERY COMPANY. Box 204.

Cleveland. Tenn. capital $100,000.00. establilhai

1899, want reliable men to book orders for fruit

trees, vines, nuts. evergreens, etc. Pleasant profitable

outdoor work. Pay weekly. Write today.





 





 





WE PAY $100.00 monthly salary and expenses to

canvass farmers introducing our guaranteed poultry

and stock powders. Bigler 00.. lit-123. Springfield,





 





WE PAY $48.00 A WEEK. furnish auto and ex-



penses to introduce our Soap and Washing Powder.



wise-Beach Company. Dept. A163, Chippewa Falls.

iscons n.





 





WE START YOU WITHOUT A DOLLAR. Soaps.

extracts. perfumes, toilet goods. Experience unneces-

sary. Carnation Co., 530. St. Louis. Mo.





 





 





 





HELP WANTED





WANTEI)«LUI.K ROUTE SALESMAN. Must be be-

tween 25 and 35 years of age and married. $200 cash

bond required. Steady work and good future. Give

ili‘artitculfirshm application. Freeman Dairy Company,

1 III . 1C, .





 





 





EARN $5 DAY gathering evergreens. roots. herbs.

Booklet. free. Botanical 77. New Haven. Conn.





SELL your poultry, baby

chicks, hatching eggs and





real estate through a Mich-

igan Farmer classified advero,

tisement.
we“... .





 





 





 





 





 





Plant growth can be regulated





almost like a machine





WHILE plants, to prosper, require an abun-

dance of all plant foods, one element controls

the yield and quality of certain crops. Nitro-

gen is the dominant element with wheat,

phosphorus with corn, potash with potatoes

and legumes.





When you consider soil deficiencies, lack

of balance, and plant preferences, varying

proportions of plant food elements are required

in the manufacture of fertilizers for different

soils and crops.





These requirements can be supplied, how-

ever, with comparatively few grades. There

is no earthly reason for manufacturing so many

grades. Doing so increases manufacturing

costs, slows up shipments, and confuses the

buyer unnecessarily.





Several conferences have been held recently

between state agronomists and fertilizer man-

ufacturers. Their aim has been to reduce the

number of grades, to standardize plant food

proportions, to increase the demand for high

grades, and to discourage the use of low grade

goods with a cheaper-per-ton but higher-per—

pound—of—plant-food cost. These conferences

have resulted in definite agreements and

recommendations.





Fertilizer users can aid materially in this

campaign for fewer and better grades by buy-

ing the recommended ratios in the higher

analysis forms. It will save them money.

Fertilizer manufacturers will have to sacrifice

some pet grades and brands. It will be a good

thing for them in the long run.



Another foolishness about fertilizer is the

idea that odor and dark color indicate quality.

They do not. The higher grades are light in

color and practically odorless. They are purer





and better.

1 1 r





If all the fertilizer ingredients and mixed

fertilizer used in the United States were mixed





into one grade, it would analyze a shade above,





3% ammonia, 9% of available phosphoric

acid, and 3% potash—a 1-3-1 ratio. A 3-9-3,

a 4-12-4, or a 5-15—5 are all a 1-3-1 ratio. 5-15-5

furnishes plant food in the same proportions

as the lower grades, and at a cheaper cost per

pound of plant food. This ratio is an approved

one, and is very largely used for other than

truck crops.

1 r '1





Ville, from 1860 to 1876, at the French Experi-

mental Station at Vincennes, did some of the

most original and fundamental work on plant

feeding. This was before we knew anything

about bacteria. With a complete chemical

fertilizer (analyzing approximately 7% nitro—

gen, 6% phosphoric acid, 7% potash, and

without manure), he was able to grow 50

bushels of wheat per acre. On the same soil

with nitrogen alone his yield dropped to 22

bushels. When he used phosphoric acid and

potash alone his yield was 18 bushels. With-

out fertilizer he grew 12 bushels per acre. He

remarks:





“. . . by the aid of simple ,chemical products

and by the exclusion of all unknown sub—

stances, a maximum crop may be obtained

from all plants in any place and in any condi-

tion of soil; further, by varying the quantity’ of

these products, the work of vegetation may be

regulated almost like a machine, the useful-

ness of which is in proportion to the fuel it

consumes.”





Armour’s BIG CROP high analysis fertilizers

furnish plant foods in available form, properly

combined to insure quick, heavy growth, and

maturity, and maximum yields of first quality.





flux“ JIM





President





erour Erfi/izer ”’orks Chicago, Ill.





 





 





 





 





 





 





l

9"}