” \\\\\\\\\\\\\





/

{Km/{7y ' ”42747,!”





\ ‘

S

\

\\

{Se

\

\





W





@ /

glam/£559,955





P631415





/

HED





 





 

 

 

 





The Only Weekly Agricultural, Horticultural, and Live Stock Journal in the State.





 





VOL. cxuv. No. 11

Whole Number 3826





The Field Peain





ORTY years ago field peas were



a. common crop in Michigan,



clear down. to the Ohio-Indiana

line. I remember having seen large

fields of them in VVashtenaw, Hills-

dale and Calhoun counties in 1872-3,

and they seemed to be as good as any

crops We have ever grown in north‘

eastern Michigan. I have also seen

some fine pea fields in southern Penn-

sylvania, and have personally grown

very ‘fine peas from seed that came

from India, Abyssinia and Spain. The

idea that peas can be grown only in

northern, cool, moist climates is en-

tirely erroneous. Certainly they will

not stand hot, dry weather, particu~

larly with. high winds, during their





period of growth. On that basis you '





can grow good peas in any state east

of the Mississippi, clear down to the

Gulf. Many varieties attain maximum

growth in 60 to 70 days. The Gulf

states have longer periods of ideal

pea Weather than that. Weather bu-

recf tables of temperature and rain—

fall show that some parts of the

southern states have longer periods of

good pea Weather than any part of the

lower peninsula. of Michigan. I do not

mean that our best peas are ready to

harvest in 60 or 70 days, but they

reach their full growth in that time,

and are ripe (dry) and ready to bar-

vest in seven to 15 days more, depend-

ing upon the variety and Weather. The

great difliculty here, as at the south.

is to get farmers to sow peas early, as

soon as it is safe to sow oats. One

will stand as much frost as the other,

with the advantage in hardiness

slightly in favor of the pea. I have

known thousands of acres sown in

June. If such crops make a good yield

it is not due to good judgment or good

farming.

Insect Pests.



The growing of peas as a money

crop has occupied a very large acreage

in Michigan for more than half a cen’

tury, but the appearance of the pea

weevil in the southern counties for

many years forced the growing area

northward, until at present the forty-

i‘ourth parallel of latitude may be con—

sidered the southern limit of the real

pea district of Michigan, where peas





 





DETROIT, h41CH.,fSATURDAY, lVIgARQH 13, 1915.





 





iChiganAgricultu re





By EDW. E; EVANS.





IHHlilllllll||IIHIHHHlIIHIIHHHHHIHllllllllllllllllilillllllllllilllllllllillliliiIIHHHHHlllllilllllll HilllililillllllllllllllHHHHHHIHillli'Hliiul‘itillIiiili‘ii.‘iiiililiiiillililiilinst:iiiiiiiiliIlllllillllillllillllllllilllllllllliiil





are grown for market. In all the north-

eastern couniies, from Iosco, Ogemaw

and Roscommon northward, there

have been sporadic appearances of the

weevil, but never in sufficient num-

bers to prove a serious menace to the

industry. I do not recall a time in 18

years when Ogemaw county was en-

tirely free from the weevil, nor a





time when one-tenth of one per cent

of the crop contained “bugs.”



The green pea louse, which first ap-

peared here eight or nine years ago,

and is easily the most deadly insect

enemy of the pea, has made but one

serious attack, in 1914, when it ap~

peared simultaneously in the pea. fields

of Wisconsin, Michigan and Ontario.





 





 





 





Growing “Stock Seed" of -Field Peas of Selected Varieties.





 





Harvesting “Khaba” Field Peas in Ogemaw County in 1914.





1 L0 (‘EN'l‘S A YEAR.

‘in FOR 5 YEARS.





 





Its presence here was first noticed on

July 3, and during the ensuing six

days it damaged the crop about 40 per

cent. li‘ortun'ately the lice were prac-

tically exterminated by the general

rain of July 9-10. In some fields they

did not appear; in others only in

spots, generally where the vine

growth was most luxuriant, while in

some the damage was at least 70 per

cent. Fortunately the serious attacks

of this insect appear like those of the.

army worm and grasshopper, to- de—

pend la 'gely upon favorable weather

conditions or causes unknown. On

July 4 l dusted a Filehll plot in my

trial grounds with a mixture 01’ gyp-

sum and ashes. ()n this plot no lice.

appeared and the yield of peas \‘as

phenomenal. This season I shall heav-

ily limc all ground intended for peas.

Climatic Influences.



The most serious setback evcr rc-

ceivcd by the pea industry of this dis-

trict began with the 1910 crop, con-

tinuing during the two succeeding

years. during which the annual crop

of the district was reduced 75 per

cent or more, a. loss that could not be,

attributed to either insect posts or dis-

ease. Some farmers said their land

had “gone sour,” but the litmus paper

said emphatically, “no.” Some said

their land was “pea sick,” but those

who still had "sum” enough to plant

peas in 19123 were rewarded by normal

crops, while the yield in 1914, in fields

not damaged by lice, was above the

average. You could not blame any de-

cent soil if it did “get sick” of grow-

ing tour to six crops of peas, beans,

clover or corn in ten years.



This same district. beginning about

1900, performed some or the most re-

markable feats in clover seed ever re—

corded. Yields of six to eight bushels

were so common as to cause no com-

ment. Yields of 10 to 14 bushels of

seed per acre are matters of record.

The whole. district went clover crazy

~—talkcd, thought and dreamed clover

seed. And then, I guess, the land was

affected by clover artophy. Our rock-

ct was a burned-out stick. A man said

to me last fall: “I don’t know what

is the matter with the clover crop. i

have a field of alsike that I have cut





 





Field of “Kaiser" Peas Grown in Ogemaw County in 1914.
THE MICHIGAN FARMERC





MARCH 13. 1915.





 





 





"1! “NH“

”H” :: l





I ;~ I':

“ml",wl! ’1





l

. m,





 





 





. Success with CLOVER,

4:20,; ALFALFLPmBomvw

and all other Legumes.

I A “oath” — bigger yield -

greatest feeding value—fiche

soil for succeeding crops.





Inoculote all Legumes with





_ me unnoveo own son. uncommon T

none-muses mom





   

   

   

 





 





‘ DU 9 E CU LTU F! E

I "I 'THE S'MPLEB‘I‘ SAFEST AND SURE? MY“

Inoculated Not or son. mocuumon roe Au. LmUMES

ALFALFA “0‘9 menu cow neon-1.. sr LOUISJOO‘





 





   





For success with legumes you must have

air nitrogen. Each can of“NlTRAGlN"

Pure Culture contains bil-

'.... ‘‘‘‘‘‘ lions of germs, without

' ’ " "Which legumes cannot take

. up air nitrogen. Vitality

y and virulence ofgerms guar-

anteed for six months.





   

 





 

 

 

 





 

   

   

 

   





‘ Packed in ventilated



cans. Nothing to break or

spill. Harmless, easy to use. An invest-

ment—not an expense. Don ’t buy imita-

tions. Look for the Armour oval label.





See you need dealer or write

' for free booklet





ARMOUR rmnuzm wonxs, Dept. 79

Git-go, Ill. Baltimore. Md. Atlanta, Ga.

Grandma. N. C. Julian-vile, Fla lashing Tm.





MAKE YOUR

- HOGS YIELD

BIGGER PROFITS





Clean, healthy Hogs become the

; fattest, and yield the best profits.

1 Keep your Hogs healthy—make

~ them produce bigger profits by

. ;‘ using Meyer's Hog Lubricator.





Hogs

Like

It





 

   

   

   

 

 

 

 

 

 

 

 





 





 





.egé‘fin‘

1 -





Meyer's

Hog Lubricator





Newestand best way tooil Hogs.

orks on new principle. No Valves.

Springs. Wheels or Gears. Nothing

to get out of order. The most simple,

durable and; efficient device of the kind

made. Requires no attention except to

fill OlI tank occasionally.

Cures and prevents Lice. Nits. Mange and

other Vermin—caused Skin Diseases. Prevents

Worms through ”Hogs eating our r iall

repared Antiseptic-Disinfectant Wm .

ends to prevent Cholera, as well” 00!

and Mouth Disease.

Price low. Write at once for pet-

tmulars of 30 Day Free TrIaI

, and on- 510.000.”

Guarantee Bond.





Aunts Hamil





 

   

 





 

 

   

   

   

   

   

   

   

   

   

   

 

 





Trial





 

 





The Meyer Corporation

lafiflain Sh, Morton, III.





 





 





Lighr— Run 1'





Silbeir ”$511





$0 strong—so durable—so de-

pendable—so simple—so abso-

lutely superior to all others ‘is the

“Light Running Silbermhn" that it

has been pronounced





“The King of





Ensilage Cutters"





Has strongest built frame, throat and

blowerthat mcrclog, positive safety device;

and with its accurate knife adjustment pro—

duces that fine uniform cut ensilace you are

looking for. _. Speed of blower can be regu-

lated according to height of silo. Thousands

in nor-Ask the man who ownes one—he'll

say "By all me an 8 get a Silberzahn".

Write for catalog and nun}.



GEHL BROS. MFG. CO.. 4

1542 8. Water Street ,.A ' ~

West '





   

 





   

   

   

   

   

 

   

   

   

   

     

 





   

 

 

 





 





B“-y|‘1|XERF°"°"’r 5-

Thls Only ‘

The Van Duzen mixer save.

an?“ samurai:

better-mix Whack-break-

withshoe.





h; labor



A Mix a Minute



mmuafn mmmor’gé.’



chm-mm oonmto lam ranger.



FREE Booklet on “What To Use and score



I1! and La, Controls." Wflb today.



um VAN bum-nova oo ‘



m Hartman Bldg. Columbus. 3n.





   

 





 





 





 

 





 





 





 





 





 





, 1 ‘ for seed nine' years and it never fail-

I, l ed me before." Oh, well! ’





As a matter of fact, the shortness

of the pea crops of 1910-12 was due to

the fact that during the blooming pe-

rlaod each year we had coninued dry,

hot southwesterly winds, which caus-

ed the blossoms to fall, or to form

very short or half filled pods. There

were a few normal yields in those

years, nearly all on early sown fields,

that were past bloom when the hot

winds came. The same conditions

will knock out a pea crop, anywhere

any any time.



Present war prices for field peas

will stimulate the sowing of a larger

acreage this season, as Will be the

case with beans. This will be all

right—if the war still continues and

we can still get the goods to the war

zone.



It is to be hoped that peas, beans

and clever will each take their proper

place in orderly crop rotation, in place

of the jumping-jack style of farming

so frequently followed in the past.



Varieties.



l have grown experimentally or as

field crops more than one hundred v'a-

rieties of field peas from many lands,

including nearly all the countries of

Europe, India, China, Japan, Abyssin-

ia Chile and New Zealand, but have

found only one variety that, under our

conditions, could compete with the

French June (Russian, Kovaleff),

which I placed on the American mar-

ket in 1900. This latter variety raised

the output of Ogemaw county from

less than 10 to more than one hundred

thousand bushels per annum in six

years. A small blackeyed pea which

one of our agricultural explorers

brought from China, and which I have

named Chang (in honor of China’s

greatest statesman, Marquis Li Hung





Chang), is probably a week earlier

than ~the June, and its vine growth

perhaps six inches 'longer. The peas

are small, about the same size as the

old Golden Vine. This variety will not

be in the market for two or three

years. The Kaiser, an introduction by

the U. 8. Bureau of Plant Industry, is

a midseason variety, with rather

heavy foliage, colored blossoms and

wrinkled gray seeds. Under extended

trials in several states it has proven

remarkably resistant to heat. It has

done very well in field culture in Oge-

maw. I experimented with the Rus—

sian Khaba for eight years, finally in-

troducing to the American trade in

1909. This is a long, heavy vined va-

riety, rather late. The peas are an

exact counterpart of the Scotch Beau-

ty green pea, except in color, which is

a golden waxy yellow. It is in the

first rank of soup peas or "cookers.”

Canadian breeders have produced

some fine cross-breds of the Marrow—

fat type, of which Nelson and Gregdry

(white) and Paragon (a blackeye),

have made the best showing in my

trials. All three are superior in yield

to the old White and Blackeye Mar-

rowfats. I will say here that none of

the large seeded peas, though requir-

ing much heavier seeding, have been

able to compare in yield with the best

of the smaller seeded type. The old

Golden Vine, so ancient that its his‘

tory is lost, was brought to America

by the early English settlers of Vir-

ginia and Massachusetts. Prior to the

days of French June it was the most

common variety in the United States.

and is still grown in the Upper Penin-

sula, though rapidly disappearing be-

fore its smaller and earlier relative.

(The nineteenth of 52 special arti-

cles to be published in consecutive is-

sues of the Michigan Farmer.—Eds.)





l||||lbflflllfllfllllllllllflllllfllllillIll!lINIIImlllllllllllllllllllflllIIHIHIHHillIlllllllllllllllllilHllfllIllllllllllllllllflllill[llllIlllllllllllIllUHl[llllllllllllilllllllllllllllIll|llllllllmmlllllllHUIIIIIHIIIIIHIIIUIIIHUIIHHHII





Planning for Increased Profits





 





T this time when plans are being

made for the coming season’s

’ work it is well to plan especial-

,ly for abundant yields of all crops

fgrown on the farm this year. Too

gmany farmers, in our Opinion, plan for

la large acreage of the various crops

.but they neglect to seek ways and

'means of increasing the productive-

gness of their fields as compared with

’the yields secured in preceding sea-

'sons. The price of all farming lands

has increased rapidly, farm wages are





 





. jhigher and nearly all raw materials





2which enter into the production of

Efarm crops and animals cost more

fnow than they did a few years back.

fiThese facts should inspire farmers to

fmake their land more productive in

,order that a fair rate of interest may

:be secured on the investment.





3 Of course, weather conditions over

gwhich farmers have no control always

iinfluence the yield of crops to a cer~

ftain extent, and there will be seasons

when unfavorable weather conditions

will make it impossible to secure large

yields, even though the best efforts be

directed to that end. But in starting

work in the spring we usually assume

that the weather will be favorable for

the season’s crops, and since in a nor-

mal season yields can be greatly in-

creased if a little efiort is made along

that line, it is well not to neglect this

phase of the farm work. The use of

improved machinery, better prepara-

tion of the seed bed, better seeds and

the use of fertilizers, and more inten-

sive tillage of the growing crops will

in nearly every instance very mate-

rially increase the yield; and an in-

crease in yield of one or more bushels

per acre means just that much more

profit money, minus the extra expense

of seed and labor required to produce

the additional yield. But since the

necessary field expenses of producing

a crop are about the same whether

the yield be heavy or light, by using

better seeds and fertilizers the ex

p'e'nse' of produCi'ng a cr'Op is put great-

ly increased but the net returns from





 





 





the crop may be increased several

fold.



There is a. vast army of earnest,

well-equipped workers and experi-

menters working all over the land

with the object in view of making

farming lands more productive—no

other occupation has such forces op-

erating for it as those that operate for

the farmer. But these men can ac-

complish no permanent results unless

farmers will accept and apply the in-

formation that is secured for their

benefit.



Ambition vs. Disease.



The ambition to own and cultivate

broad acres is undoubtedly a. laudable

ambition, though it issometlmes term-

ed a disease. This “disease” is per

haps not so much a sordid desire to

add to worldly possessions as it is for

a gratification of the desire of domin-

ion. The man who owns only a small

farm or the renter is often tempted

to rent adjoining acres with the hope

of increasing his income so that he,

too, may become the owner of broad

acres. But it is a lamentable‘fact that

many ambitious farmers who try to





farm all their neighbors’ lands learn.





at the end of the season that their

additional acres have not returned

any profit, but rather, that they have

been the'cause of a. serious loss at

home. Good advice for any farmer to

heed is: Don’t go a distance from

home to rent land unless you have a

surplus of help, teams, tools, etc., that

cannot profitably be employed on the

home farm. In other words, don’t

“bite off more than you can chew.”

The farmer who is short of help is

usually behind with his work during

the entire season, for in the last few

years the problem of securing good

help has been a diflicult one to solve

in many sections when the busy sea-

son ls on us.

Better Work Means Increased Profits.

The most practical way of increas-

ing one’s acres is to do better work as

outlined above on the acres you al-

ready control. When an acre is made





to double its product, the acres are





doubled, but the investment and care

have not increased in the same ratio.

A farmer may, by hard work and

economy, make a living by raising ten

bushels of wheat, twenty-five bushels

of corn and fifty bushels of potatoes

to the acre. Twice the number of

acres with the same production will

not much increase his profit, but will

double his work and worry and invest-

ment. But twice the yield to the acre

will mean more than five times the

other profit, with but little more work

and investment. The love of domain

may not have been gratified in in-

creasing the production of the land,

but the spirit of conquest has; the

primitive reaching out for more land

has grown to the keen intellectual

pleasure of having made better land.

Make preparations this spring to

provide an abundance of pasture for

stock, and then raise more cattle and

hogs. Taking one year with another,

cattle and hog feeders make money,

but they realize their greatest net

profits only when grain is fed in con-

nection with good pasturege. In trav-

eling through the country I have ob-

served that many of the pig pastures

are not pastures in fact, but simply

small runs. This means that the pigs

get a little grass or clover while it is

at its best early in the spring, and go

without the rest of the season. It also

means that before fall the soil will be

rooted over and over again unless the

pigs are rung frequently. Those farm-

crs who have tried the plan testify to

the fact that it pays exceedingly well

to give the growing pigs a good big

pasture where they will have more

range and all the grass, clover panic-,-

ularly, they will eat and some to

spare.

is very much cheaper feed for pigs

than grain; that fattening hogs will

make the same gains on at least 25

per cent less grain where they have

access to good clover pasture. If this

be true, why not arrange to give the

pigs all the clover they will eat in or«

der to increase the margin of profit in

pork production? _ W. F. PURDUE.





 





SPRING CLEARING OF NEW LAND.





 





The task of clearing new land of

stumps is usually delayed becaus'e.il:

has been thought necessary to do. it

during the active summer campaign

on the farm. It has been generally

considered impracticable to do any-

thing at land clearing in March be-

fore the frost is all out of the ground

or even in November after the ground

commences to freeze in the fall. The

introduction of new low freezing ex-

plosives for blasting stumps, however,





has made it possible to do this work ,





much earlier in the season and much

later in the fall than was formerly

practicable, in fact, this kind of work

can be carried on in any weather

when it is possible to bore the holes

under the stumps, it not being neces-

sary to thaw these modern explosives

in order to use them successfully.

There is a. better prospect than usual

for high prices for farm products

grown during the present season and

a great many farmers could increase

their area of cash crops by clearing

areas of cut-over land before the ac-

tive spring season commences, thus

enabling them to utilize the ground

for crops during the present season.

This advantage, together with the ad-

vantage of getting this kind of work

out of the way before the rush of

spring work comes is a strong argu-

ment in favor of the use of this meth-

od of clearing stump land at the pres-

ent time. The longer the European

war continues the greater will be the

demand for American products, not

alone during its progress but after it

is finished. The American farmer is

assured of a market for every product

which he can grow this year. and on

this account should increase his pro-

duction to the maximum of his ability.



Wayne Co. C. A. H. ,





It has been found that clover-
' MARCH 13, 1915.





LIVE STOCK AND SPECIAL CROPS.





 





The fight against hog cholera and

foot-and-mouth disease Will continue

until these plagues are stamped out——

for a time. But the risk and anxiety

will remain and sooner or later anoth-

er outbreak will bring further loss to

stockmen. This makes the tiller of

the soil wonder if he may not reap

better returns by selling his crops

than by feeding them.



A clearer understanding of this

problem will be had when the farmer

realizes that if he feeds his crops to

live stock he is running two separate

enterprises. As a cropper he sells

grain and hay to himself as a feeder.

The stock must be charged for what

they eat at market prices, no matter

who grows their feed. The advantage

in raising stock where their feed was

grown is the saving in hauling of the

crop to market, and the return to the

soil of the resultant manures. There

are thousands of cattle and hog men

who admit that the manure is their

only profit.



Investigations made by the Depart-

ment of Agriculture (reported in Bul-

letin No. 41), show that the average

yield of crops on grain farms is but

slightly less than on the live stock

farms. As a matter of fact, animals

are not made from nothing. Manure

is only a more “available” form of hay

and grain. The same amount of straw,

stubble, cornstalks, etc., returned to

the land will supply as much fertility

as if fed to animals and the manure

scattered where the crops were grown.



Live stock alone can not maintain

the fertility of the soil. No land ever

was or ever will be made rich from

manures from animals fed exclusively

by the crops grown on the land.



Under a system of grain farming,

nothing but the grain and seed are

sold. All roughage is put back on the

land, even the clover haulni after the

seed is hulled out. Phosphorous must

be applied in the form of purchased

fertilizers and crops of clover or other

legumes must be ployed under; but

these elements must be added also in

the case of live stock farming.



Whether exclusive grain farming

can be made profitable or not will

depend upon the relation of yield to

price. If a farmer can grow a heavy

yield per acre with small expense for

the increase above the average, and

average yields hold prices up to a

fair level, he can make a goodly profit

on his labor and investment.



- World competition in grain growing

keeps prices at a low level because

the growers do not set the price on

their own product—they blindly ac-

cept the “quotation” which is govern-

ed by the law of supply and demand.

The law does not operate naturally,

but unscrupulous speculators manipu-

late the visible supply and thus con-

trol the price.



No radical change is recommended

but the grain grower and the farmer

who diversities and the live stock

farmer might as well raise something

else besides staples. The writer has

heard hundreds of farmers say they

made no money in oats. If so, why

raise oats? Others declare there is no

profit in wheat at current prices.

Some extensive experiments in the

Red River valley demonstrated that it

costs over a dollar a bushel to grow

wheat. To sell hay extensively means

soil exhaustion. To feed it involves

grave risks and questionable returns,

even if all the manure were applied to

the land. As a matter of fact, a large,

per cent of the manure is wasted.





The salvation of the average farmer

is along the line of mixed farming, es-.

tablishing a self-supporting home, pro-

ducing everything that can be done

economically for home consumption,





and specializing in one or. more men:





ey crops in which can be put both

skill and experience; -

Illinois. H. A. BEREMAN.





 





THE, MICHIGAN FARMER





TRY-A-BAG—TRY-A- BAG—TRY- A- BAG





3—315





 





Give Every Stalk





 





 





——





a Square Meal





T PAYS. Just as it pays to put steers in prime condition by supple-

menting pasturage with grain, just so it pays to treat your crops; to

give them the quickly available kind of plant food in addition to the





slowly available plant food already in the soil.





No matter how





splendid your pastures may be, yet prime beef demands concentrates, and

no matter how rich your soil may be, bumper crops demand active, sol-

uble, fertilizers which are plant concentrates. The actual feeding period

(about 60 days for most crops) is not long enough to allow abundant

absorption from usual sources, and just as sure as it pays to feed con-

centrates to stock, it pays to feed concentrates to crops. It’s a matter of

give and take. Don’t be satisfied with less than a 75 bushel corn crop.

You can probably get more, by supplementing good cultivation, green





crops, liming, etc., with





A. A. Brand Fertilizers





Get a big increase this season, at a good profit on the investment. it’s

just a plain business proposition of “give a little and get much.”





u n - .- t - 4

TrY'a'bag $2.00 to $4.00 north “ill .hou }ou on an





acre. Prove to your satisfaction at this

small expense, that if you “feed the plant it will feed you.” You’ll

find your experiment crop has more vigor, matures earlier and is

better quality. You can plant later yet harvest earlier, thereby in-

suring against early frosts. Our effort in making A. A. Fertilizers

superior is to make their Nitrogen, Phosphorus and Potash mest

highly available. We’ve succeeded—as thousands of farmers will

testify. Yet there is no loss from contact with air and leaching in

A. A. Brands. A. A. Fertilizers for corn are especially successful.

They contain every element required for quick, heavy growth. We

have a spendid agency proposition to make you—also a carload order

inducement. Our two books “Plant Food” and ”The Problem of

Fertility in the Middle West”, are free. \Vi'ite for them today-—

at the nearest branch, and don’t forget to "Try-a-bag”. 0





THE $1000 CORN-

GROWING CONTEST





for lndiana and Ohio last season showed

yields of 82.5 bu. to 115 bu. per acre.

A. A. Fertilizers did it. "Tn-A-Bag”

yourself.





 





The American Agricultural Chemical Company





Cincinnati, Cleveland, Detroit, Buffalo, Baltimore, New York





 





 





 





GET your engine from an Engine Specialist, on

‘ any suitable reasonable terms, at a fair price.





LOOK 51' THESE NEW PRICES!





2 fl-P. 834 95; 4 H-P. $69 75' 6 B P

. . . - , 897.75; 8 114’, 139.65;

Viv: H-P.t8219.90: f 16 H-P, $298.80; 22 H-P. $399.65. Portable Englnes Proportlonally low

y pay wo prices or any good engine, or take You can a in th ' can' go;

who? 15),!) a pgor (ii- ‘ln unknown engine whenthe better engiiie-xgil'iie figfiin‘fiifi?’ l'lll‘lia ’(isuwhattmy

cos so itt e and saves you all the risk? thousands of customers say and they ought to know.





Ker s ,D' '

WITTE ENGINEs,G.:o.?.:‘: mastitis

LIBERAL S-VEAR GUARAITV. DIRECT FROM F1010" 1'0 USERS EVERYWHERE.





Styles - Stamina , Skidded, Mounted and kinds of work, in all arts of the

Special Sawrtg. housands in use in all is today better thanpever, while gig-138::

parts of the world. Standard for 27 years is lower. My manufacturing advantages

—-almo_at ever pincethere have been any make this possible. I am simply sharing

gasoline or m] engines. “ my advantages with engine buyers. Let

In all those years the WITTE" has me write you more about it and

proved its high-quality value at all post you on engine buying. '





, Send Your Address mix:

name and address so I can send you

my New Book with my latest and

Best Offer by return mail.





Ed. H. mm. With Iron Works no.





2192 Oakland Avenue.

KANIAB CITY.

MO.





 





 





 





 





 





When erting to advertisers lease state that

you saw thelr ad. in The





ichlgan Farmer.





 





 





’ .

Don I: Stop Sprayin

It is easier to keep up than catch up. t

takes two ears for trees to bear after the

. folinzetl estmi'ed. Remember.too.thnt

dormant; spraying la Important. and In

some n a Spraying is compulsory.

fiprayed fruit is good fruit, and good fruit





 

 

 

 

 

 





wnya brings a good price In my seaaom





. 112mm





Bucket. Barrel Power

utd Traction Sprayers

include ’10 combina-





fleld, garden. poultry

house nndhomeuaes.

Our' '8 ray' ' booklet.

shown ow you can

buy barrel or bucket





write us for' ‘Spny

booklet and oursiirly



end-r. both tee.

‘ Bahamfl’f'g Co.

Box 244





 





 





I Use in any wagon.





ALFALFA





Our AMERICAN NORTHERN BROWN

Fall Book tells how to succeed wing Alfalfa 0

any soil or climate east of the M tssourigllilover: how to sown:

how to harvest; what. to do to retain a. perfect meadow.

We refuse to handle Turkestan or " Dwarf Alfalfa," our

one“? "it? t‘v‘Ee’mi‘gmgt‘meM durum” “6 “d

o . can u e . on or Dako

and 11mm seed at very moderate prices. ta.

GRIMM ALFALFA rearrange-"- am

n's

Siberian varieties. Also "Dakota 30" and Noni-glib seednewi

A sure and economical way of

refill“ PLANTS beginning the new hardy va-





CLOVER a’hd GRASSES





Northerngrownandofatro estvltalt .

mmmmlmblelm'anngfloflfl. W wemmm





,WIRG’S BARBER and FLOWER SEEDS

Are = u. do-





of hishest unlit that‘can be prod tied—fully

embed In our gee coining. Writer for it today.





 





 





'wmo seen co.. no; 24': amt-mum. o.
316—4





 





THE MICHIGAN FARMER





MARCH 13, 1915..





 





ourWh





_.,.

00D seed, rich soil and favor-

G able Weather count for little if

your corn crop is carelessly

planted. Planting lsjwta: important

as seed. soil and weather. It is the

one thing over which you have com-

plete control—the one thing you can

regulate to insure a biggeryiela'.





The Hayes Four Wheel is guaran-

teed. It must be all we claim and all you

expect. 180,000 users verify that Hayes

Four Wheels regulate depth of planting

to the fraction of an inch. Corn all comes

up at the same time. allows earlier cul.

tivation. an earlier harvest, a better qual-

ity and bzgger quanlz'ty.





Hayes Four Wheels guarantee surer

germination and quicker growl/z. \Vheels

pack the dirt around the corn to hold the

moisture and leave a ridge of loose soil on

top. Ridge over corn prevents washouts

in hilly fields and gives greater surface

for sun's heat.





Covers where all ordinary open wheels

fail‘even in wet and sticky ground.

Guaranteed not to clog. Short coupled.

light draft and turns in shortest space.

Checks with absolute accuracy. regardless

of team’s speed. Cross rows straighter

than the way you drive.





   





The Hayes Drop never mils-3e: a hill

Simple. reliable and most emcient. Few

er parts. less breakage and delays. Has





no clutch to miss and give trouble.

Never crack: orgrr'ud: the seed. Will drop

accurately sun size or shape kernel. No

bare spot: in ms planted fields. No

replanting necessary. Increased yields

soon pay for it.



Thousands in use for years'with prac-

tically no repair expense and every one

giving hme-samug, money-making service.



0 complicated parts to get out of fix.

Strong construction, practically exempt

from breakage. N o expensive and aggra-

vating delays in the busy planting sea-

son. Easy and simple to operate and

can be trusted to unskilled help.



Can be furnished with perfect working

Fertilizer or Cow Pea Attachments, Stub

Runners or Disks.





2000 dealers. Ask your dealer or let

us prove how this planter prevents corn

field waste and increases corn yields.

Don't make a mistake. Buy the planter

that guarantee: results.



Free book AC of Planter Facts tells

all about the. Hayes. Write for it today

-a postal. or it you wish a letter. asking

any questions on planting problem 3.





HAYES PUMP & PLANTER 60., Galva, Ill.





 





 





 





Your Crop Yi





tions your yields will

be larger if you use a





No other disk barrow of any make or

style approaches the CUTAWAY(CLARI§



Double Action for pulverizing the so: .

for saving time or for saving horses.

The rear disks always out just midway

between where the fore disks cut.

Every inch of the soil is pulverized and

aerated. With the CUTAWAY (CLARK)

Double Action Harrow you can save





 





You Can Increase





elds





1 S '- LUTAW

Regard e s of mud: .. ,





Curawy 1%,ng "





Ask your dealer to show you the CUTAWA'! (Cunt) Double Action

Harrow. If he doesn't handle Cornwar (Cunt) tools. write us at once.

We ship direct where we have no agent. Send for m m





THE CUTAWAY HARROW COMPANY, 992 Main St, HIGGANUM. CONN.

Maker of the original CLARK dink borrow. and plow





 





' ' .Rialdnainfimo





   





 

 

 

 

 





sin le barrow it does



wit the same horse pOWer. It is made

in sizes to meet the needs of every

farmer. The disks are of a special stee

rolled to our own analysis and forged

sharp. The bearings aredust— oofod-

soaked hardwood, perfectly l outed.





25 to 33% % in time. Corggafiremdovgtgvznrz





 





 





 





Look for the Red Ball





The reasons why you should look for the Red Ball on rubber

footwear are the easy fit that you get in “Baleand” and the

longer wear you get from it.





“BALL?





 





Figure the cost of“BaIl-Band" RubberFootwear'on what it costs





£4;pr wear. and you will be Wat





howhttleitcosmto





yonrfeetandleesdryandcomtorm

write hr rm Ilium Bullet. “Ion Dan lea"

lttellshowtomakernbberfootwearulonger—telkwhatis

good andwhatisnot.





for rubber





50.” stores sell “Ball-Band" ‘Rubber Footwear





mmmfiemmt'sm





andwe will one that you are fitted.

.BHAWAKA WOOLII' MI.- 00.

street





31. “I”





Minimise. Ind.





“TRHMMPQOM.~W”





 





“H .





The dairy stands out peculiarly as

an instance of a bacteriological labor-

atory in practice, for there is scarcely

an act which is not more or less sub-

ject to the influence exerted by micro-

organisms.



At the start the cow becomes a sus-

picious creature lest she harbor the

germs of some disease. Some of the

bovine diseases, as tuberculosis, are

transmissible to man; accordingly ev-

ery effort on the part of man to pro-

tect himself is exerted. Laws are

enacted and inspection established to

curtail the dangers. Each year con-

tributes to the exactness of the knowl-

edge and to the deflniteness of con-

trol work, both of which redound to

the benefit of the producer and con-

sumer.



Even after the milk leaves the cow,

further possibilities of disease finding

its way into milk exist. The milker,

or those having to do with the milk,

the water supply and other agents,

may furnish contaminations which

will produce disease in the consumers.

Typhoid fever as an illustration has

been known to infect milk through

the milker and also through the water

employed in cleansing the utensils,

thus carrying to the unsuspecting pub-

lic a. dreaded disease.



Besides the diseases which are as-

sociated with milk, are troubles aris-

ing from the changes produced caused

by the entrance of filth organisms.

These are borne on the dirt, hairs,

dust, straws and other vehicles which

center in the pail and milk during

milking. At this stage the producer

finds his daily trials. Like an army

the micro-organisms sweep down up-

on the milk as if it werea fortress to

ibe captured. To hold this army of

'micro-organisms in check is the duty

of the milker. The avenues of attack

are so many that few producers suc-

ceed; consequently there are found in

some milk only a few hundreds of

micro-organisms, while in those milks

which are not handled so effectively,

there may be millions per cubic centi«

meter. No one but the producer can

fully undertand what it means to

keep micro-organisms out of milk dur-

ing the milking of a cow.





Once in it, there is a struggle to get

rid of them or stay their activities.

Accordingly, straining, cooling, pas-

teurlzing and other methods are re-

sorted to. Of these, perhaps cooling

and pasteurizing are the most val-

uable.



For some reason people have learn-

ed to prefer butter made from sour

cream, and cheeses which have been

treated in various ways with different

micro-organisms. Of late years, too,

Americans have been following the

customs of eastern Europe and west-

ern Asia by using fermented milk

drinks, as koumiss, kephir, yoghurt,

maroon, and have grown more fond

of their own buttermilk.





Sanitation and Diseases.



No branch of bacteriology has made

greater strides or done more for hu-

manity than sanitary, hygienic, and

medical. Health is concerned, which

means happiness and ability to do.

The farmer is as much and vitally in-

volved in this as any class. While the

good of man alone is the ultimate pur-

pose of workers in this phase of bee-

teriology, the farmer is additionally

economically aifected, because what

applies to man in disease sanitation

and hygiene may in a modified sense

apply to animals. It may further be

said that all men, whether farmers,

business or professional men. are in-

terested in the conservation of food

animals. From this we may conclude

that the farmer has his own health to

preserve for individual usefulness, and

the health of his animals for financial





 





reasons and for the good of the world





Bacteriology in Relation to Agriculture.





By DR. CHARLES E. MARSHALL

(Continued from last week.)





at large, because he has a responsibil-

ity in the production of food.



in 1850 very little was known about

infectious or contagious diseases.

Plagues visited countries and decimat-

ed the population, and as an unseen

force laid 10W thousands of animals

and ruined many husbandmen. Asiatic

cholera and the pest traveled where

they would without interference other

than the obstacles they placed in their

own way. Tuberculosis was not known

to man, but it caused greater ravages

than even now, through its subtle ap-

proach and its persistent and uncon-

trolled destruction. Typhoid fever

came as a thief in the night, and no

one knew the entry way. Diphtheria

produced panic and men armed them-

selves for guard duty as if war waged.





Rabies brought horror and dread for.





it was certain death. Anthrax had no

check but swept away thousands of

live stock. Biackleg aroused suspicion

as if there were some friend about

who would poison. Hog cholera had

to its credit millions and millions of

hogs and dollars. These are only a

few of the suggested accomplishments

in this field, for cannot man point to

the practical control of these diseases

provided the managerial conditions

are present which will enable him to

execute his purpose?



In other directions, the work of the

bacteriologist has gone. Through him

there has been traced the organisms

of malaria and yellow fever in the

mosquito and thus he has established

their distributions. By his work Pan-

ama has been made a safe abode for

man in the construction of the canal.

He has found that some animals carry

micro-organisms without injury to

themselves, as the organisms of

“Sleeping Sickness” in Africa, or the

Texas fever organism in the cattle

tick, or even the typhoid or cholera.

carriers. By his knowledge water sup-

plies have been made safe, food ren-

dered free from harm through inspec-

tion and control, and sewage efl’ective-

1y disposed of. Definite facts of this

character have made man’s acts intel-

ligent and resultful. He can move

straight to his goal.



General. .



Agircultural micrology or bacteriol-

ogy may be summed up by saying that

the final task in the application of this

branch of science consists in fostering

those micro-organisms which are fav-

orable to man and checking or de-

stroying those which are injurious, as

directed through the accumulated

knowledge made available by investi-

gations.



Let me say in concluding this dis-

cussion that while I have centered my

attention upon one branch of science,

seemingly but not intentionally, by

the elimination of other branches.

science as a whole is so intricately in-

terwoven, so interdependent, so close-

ly bound together that one branch

cannot be fairly treated without in-

volving others. One branch of science

cannot grow without the help of oth-

ers; they must all develop together in

the interpretation of any industry as

agriculture.



L.___.





BIGGER CROPS ON THE FARM.





 





While proper soil and the right kind

of cultivation mean a great deal, Good

Seeds really play the most important

part as to whether the Farm is a Suc~

cess or Failure.



Every farmer in Michigan should

secure a copy of the Alfred J. Brown

Seed Company’s Seed Catalog, “Thir-

teenth Year Edition.” It contains in.

formation worth reading. “It is free.”

If you have not received a copy write

for one today, and please mention the

Michigan Farmer. Simply address

Brown “Seed 00., Grand Rapids, Mich.

——Adv.





 





rm... ‘p——~





.7
MARCHJB, 1915.





JOINING THE BETTER SEED

MOVEMENT. _~ “





 





A movement new- to the writer’s lo-l

cality, was launched recently, follow-1

ing an address delivered by Prof. Cox,

of the M. A. C., to ”a large and atten-I

tive audience of farmers.

address was on “Farm Crops from the ‘5

Standpoint of the Experiment Sta-

tion.” The discourse dealt with the

selection and improvement of strains

of grain ascarried out at the experi-

ment station at M. A. 0., Following

the interesting and instructive talk in

this work, the farmers were informed

in what way they could come in touch

with the experiment station and reap:

the benefits from the work done there.





Although a large state association

of farmers has been in existence for

some time, and local associations are

constantly being formed, comparative-

ly few farmers in Michigan are as yet,

in touch with the better seed move—

ment. In this section, which will com-

pare favorably in up-to-date methods

with the average farming communi-

ties of the state, the idea was a new

one. so favorable an impression did





the address make on.the farmers 'as-w . "





sembled, that a strong local experi:

ment association was organized on the

spot. Officers were elected, and seeds

from the state experiment station will;

be planted by these farmers this

spring.



In its reasonableness and fairness,

the proposition made by the state ex-

periment station appeals to the farm-

ers. It is true that most prosperous

farmers have. about reached the limit

of what may be done for crops

through cultivation. It is also true

that these same farmers have long

been in possession of the knowledge

concerning the most effective meth-

ods of fertilization. But in the mat-

ter of seed selection, these same farm-

ers have, as a rule, gone no farther

than the selection of the best from

their own or from their neighbors'

crops. To be able to get pedigreed

seed that'has been scientifically se—

lected and improved, is a new thing,

and looks reasonable and good. This

also appeals to the farmer as being

not only the cheapest, but also the

easiest method of increasing the yield

per acre of a given crop.



In past years it has been the atti-

tude of many farmers to treat lightly

the work of experiment stations and

of scientific methods of selection and

improvement. But at the meeting al-

ready mentioned, there was but little

if any of this spirit. The farmer has

come to realize that the experiment

station is doing a valuable work, and

a work which he, the farmer," can not

do. To select and improve to its

highest efficiency, any strain of grain,

is a painstaking, laborious process

which would be impracticable for the

Ordinary farmer to undertake. But

when the grain has once been improv-

ed and made pure by the scientific

methods at the experiment station,

thefarmer has an opportunity to reap

all the benefits. He can procure the

pedigreed grain at a comparatively

low figure, and can sell his crop for

seed purposes, at a price much higher

than he realizes ordinarily on the

market, for his products. Not only is

the farmer who joins the better seed

movement helping to spread the bet-

ter strains throughout Michigan, thus

increasing the average yield; he is

also making his individual farming op-

erations more profitable and efficient.

Thus the better seed movement ap-

peals to the intelligent farmer from a

two-fold standpoint. In the writer’s

section the idea has "been taken up

with enthusiasm, and good results are

promised in the years to come.



, Hillsdale Co. ,J., A. KAISER.





 





 





The Storm & Harrison 00., Paines-

vill'e’, Ohio, send, a. spring seed catalog

of 192 pages describing and profusely

illustrating theirline of seeds, plants,

shrubs and fruit and ornamental trees.

Mention the Michigan Farmer when

writing for a catalog. * -





 





 





Prof. Cox’s'; .





‘h





THE MICHIGAN FARMER





 

   





 





 





The Chilled Plows with Perfect‘Fitting Parts





Perfect fitting shares—proper suction and penetration.



Parts are made right in the factory at the start—over

forty years of careful study have been devoted to the

manufacture of these plows by the Syracuse Chilled Plow

Company. I ' '





Write us for information on Syracuse Combination Plowa

Nos. 61 and 62. .hese are splendid plows for use in sandy'

loam fairly free from grit, or in sticky soils where good clean-

lng qualities are desired. Work well in tame sod or old





ground. Therein 3 Syracuse Chilled Plow made for your soil.





 





and”...





John Deere Corn Planters





John Deere No. 999. The full variable, accurate drop

planter. Plants two, three or four kernels as desired—all

you do to change number in the hill is to move foot lever.

Drilling distances varied and changed from hilling to drill-

ing made just as easily.



Accurate—because it; has the “Oblique Selection” or

natural drop,——an improvement; over previous methods,

kernels do not have to be tipped on edge to enter the cells.

Surface of hopper bottom and openings to seed cells are

oblique, or sloping, and the kernels naturally move toward

and fill the cells rapidly.





Many Improvements Make it the

Most Accurate Planter





All corn plates for this planter have 16 cells. Therefore,

the same drilling distances are obtained with one plate as

can be secured on other planters that use 8, 12 and 16 cell

plates, and without change of plates.



Easily detachable runners

enable you to use other fur-

row openers, if ever desired.



Simplified check heads,

disc marker without rope,



' and underhung reel are also

improvements you will ap-

preciate. Fertilizer attach-

ment can also be furnished



- for this planter.



Write us for free booklet “More and Better Corn." It

tells how to select: and test. your seed corn. how to pre—





pare the seed bed and the gain in dollars and cents by

using an accurate corn planter.





 





 

 





 





plements Illustrates and de-

4 FREE BOOK scribes the most:

complete line of farm implements. Tells

how to adjust and use farm tools under

varying conditions. It is a practical encyclo-

pedia of farm implements worth dollars to

you—o. 168 page text book.



It tells about John Deere Implements: Steel

. plows cultivators and barrows; corn planters,



discs barrows and beet tools; farm and mountain





 

 

 

 

 

 

 

 

 





John Deere Syracuse Chilled Plows ‘





Better Farm Implements and How to Use Them





John Deere, Publicity Department, Moline, Illinois





John Deere Disc Harrow





Model .“B”—the disc with third lever —-—an exclusive

feature.



You can put heavy or light pressure on the inner ends of

the gangs and cut out dead furrows or disc ridges without

burying the harrow. Cuts even depth entire width of gangs.





The Flexible Harrow. only that part passing over an ob- '





struction is raised out of the ground.

Independent Gangs. A separate lever for each gang.





Write for free booklet, “Bigger Crops from Better Seed

Beds. Tells all about Discing and Disc Ilarrpws.





 





 





John Deere Spreader

The Spreader with the Beater on the Axle





The beater—the business part of a spreader—and all its

driving parts, is mounted on the rear axle. This is a

patented feature. You cannot get. it on any other spreader.

Here is what the beater on the axle means to you:





It means: No clutches to give trouble—all

taken off.





It means: No chains to break or get out of

line—~all thrown away.





It means: Less than half the parts heretofore

used on the simplest spreader—some two hun-

dred parts are done away with.





It means: Manure is not thrown on the axle—

straw and trash cannot Wlnd around it.





You get big drive wheels and a low

axles—that





It means:

down spreader, without stub

means traction and strength.





It means: Drive wheels back out of way when

loading—you see where you place each fork-





The John Deere Only Hip- High





The top of the box is only as high as your hips. The

John Deere Spreader is easy to load. You see where you

place each forkful.



To start spreading, you pull back the lever at. the driver’s

right—that’s all. A boy can operate it.



Call on nearest John Deere dealer and see. the spreader





with the beater on the axle. Write for “Farm Manures

and Fertilizers". a valuable text book free.





 

 

 

 

 





wagons; manure spreaders; portable and station-

ary grain elevators and corn shellers; hay loaders,

attackers, sweep rakes, mowers and side-delivery ‘

rakes, motor hay presses; grain drills and seeders;

full line of chilled plows; grain binders and com

binders: hit-and-miss and volume-governing

gasolene engines.



To get this book, free, state what special

implements you are interested in and ask for the

book as Package N o. X-5.





   





THE TRADE MARK or

cumin MADE FAMOUS





BY coon lMPLEMElNTS

*





   

   

   





 





\





\





Yes waiting for every farmer or farmer's s i '



‘ o I o n on_ -

dustnous Amencan who is anxwus to establish fgrmhi‘mn- 1” M” “g ”woman

_ _ Canada’s heart invi-

tation this year is more attractive than ever. eat

. but‘ her farm land Just as cheap and in

the provmces of Manitoba, Saskatchewan and Alberta





160 here Homestead: are Actually Free to Settlers and

Other land at From $15 to $20 per Acre

The people of European countries as well as the American continent must be fed -— thus an





even greater demand for Canadian Wheat will keverp‘up the price. Any farmer who can buy





eat and ra' 0

Is bound to make money—that's what you can expect in laye;etrgificb‘ISheIS to the acre





self a happy home and prosperity.

is higher





land at $15.00 to $30.00 per acre— get a dollar for

yields also of Outs. Barley and Flax. Mixed F

either for beef or dairy purposes. Good

Milita

* farm la

Canad





M. v. MQINNES,





176 Jefferson Avenue, -





@‘stAITING FOR You





anada. Wonderful





ermine is fully as profitable an industry





as grain raising. The excellent grasses full of nutrition. are the only food required

8e . i t l i Cschogmbmarkets convenient. climate excellent.



rvnce 3 no compu sory' I: am a ut there is an unusu d

.r to replace the many Young‘men who have volunteered for se'rviacle ifir'ifigdwg’ri

Write sproyaroturoud particulars sstoreduced railway rates to Superintendent Immigration. Ottawa,





- Detroit, Mich.

' L ‘ .Cnnsdisnflovermnent .-





 





WHITE SWEET s ' oo





VER For





B i

II o

BIBGEST MONEY-MAKER KNOWN-JHVI IOA‘I’I V



The greatest forage plant that grows. Superior to all

as a fertilizer. Equal o Alfalfa for hay. Excels for pas-

ture. Build. up worn-out soil quickly and produces im-

mense crops, worth from 850 to ”anger acre. Easy to get

started. grows everywhere, on all lnds of soil. Don’t

delay wrltm for our Big ”wage free cataloc and circu—



s can save on none on

has tested guaranteed seed. Sample Free}: Write toil“.

L’A. BERRY SEED 60.. Box 93]; CLARINDA. IOWA





. Grow More OATS





Grow the choicest procursblel Grow the oats that

broke all records for yield per acre and weight per

bushel. Grow the out that. is bred especially to

suit your soil conditions, grow





CORN BELT OATS (Cartons No. 5)





Of earliest maturity. with strongest straw and

thinnest hull. The large berries carry pure white

grain of richest. quality. Write for





FREE Samples and musmm Catalan





Learn all about our 100 as pure outs and money-

buck guarantee. Write a postcard-today.





Emu-Cum lull 0m. In 120 {our Bron. Illinois





Adoption, the Michigan Int-mot

when Writing to advertisers.
318—6 .





 





THE'MICHI‘GAN4 FARME'R





-

.....





 





 





Bad Habits

Cured





 

 





ing horses. who ‘"

answer this advertisement immediately, I

will positively send my introductory course

in Horse Training and Colt Breaking AB-

SOLUTELY FREE.





World’s Greatest S stem





of Horsemansh p





Twenty-five thousand FARMERS and horse-owners have

taken my regular course and found that it does the work.

Even if you have only one horse. it will pa you to master

my wonderful system. The Beery Course s the result of a

lifetime's work as a tamer and trainer of horses. As one of

my students has said. "The horse has never been foaled

that Prof. Beery cannot handle." My record proves it.





 

   

   

 





 





   

 

 





URING the next three months



the pig crop which will, to a



large extent, constitute the crop

of market hogs ,to be fed on the

farms for next fall’s market, will be

farrowed. Although conditions have

been disappointing in many ways,

which have lowered _. prices to an un-

thought point, it will not be wise to

neglect the brood sows at farrowing

time, which, if indulged in, will mean





' heavy losses when the pigs arrive.





Save all the pigs that can possibly be

saved at farrowing time, and give

them a good start toward market hogs

for next season. -

Market Contingencies.

Things were moving along in fine

shape as market and prices for meats

were concerned, until unexpected in-

terruptions sprang up from several

sources. Impaired industrial condi‘

tions were bad enough during the

spring and midsummer before the

breaking out of the European war.

many working men were thrown out

of employment, and unemployed men

are not good purchasers of meat pro-





MARCH 13. 1915.





’The Coming Pig Crop.





young, which will make it possible for

the pigs to eat more of the coarse

feeds while young, and hasten them

along to popular market weights much

earlier than would be possible if they

were not started along while young.

By starting the pigs along while

young one does not have little pigs

but a short period of time. They are

soon large enough to be counted of

some importance. Skillful pig raisers

make their pigs weigh 80, 90 and 100

pounds when 100 days old. With pigs

thus started it is an easy matter to

make market hogs of them in a short

period of time. The weights are made

cheaply and the chances for profits

are better than would be possible if

they Were neglected while young.

Wayne Co. N. A. CLAPP.





FEEDERS’ PROBLEMS.





 





 





 





Oats vs. Barley as a Stock Food.



Please state in your paper which

has the most feed value, per pound,

for horses or other stock, oats or

barley.



Lapeer Co. SUBSCRIBER.





 





ducts; they have not the money with

which to buy the necessary food for According t0 HGDTY’S feeding tables.

their families. When the war broke 100 1108- of oats contain 9-2 lbs. of pro-

out the monied men waited to get tein, 47.3 lbs. of carbohydrates and 4.2

their bearings before they ventured. lbs. of ether extract or fat, while 100

Before conditions became settled, like IbS- of barley contains 8.7 lbs. of pro-

a thunder clap from a clear sky, the tein, 65-5 lbs. 0f carbohydrates and 1.6

most devastating condition caused by 1133- Of fat. Reducing these two foods

the spread of the foot—and-mouth dis- t0 their respective nutritive ratios we

ease was precipitated on the county. find that oats has a nutritive ratio of

Quarantine regulations were estab- approximately 1:6.22, while barley

lished and the farmers were actually has a nutritive .ratio approximating

barred from sending their stock to 1:8. The nutritive ratio of oats is

market.





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 





By Beer-y System





Refusing to lead.

Running away when hal-

ter or bridle is removed.

Getting fast in the stall.

Paving in the stable.

Paving while hitched.

Crowdm in the stall.

Fighting ulterorbridle.

Tender bitted.

Pulling on one rein.

Lngginx on the bit.

Longing and plan;

Refusing to stand.

Refusing to back.

Sbyi .. Bulking.

Ai'rai of automobiles.

Afraid of robes.

Afraid of clmheson line.

Afraid of cars.

Afraid of sound of a gun.

Afraid of band playing.

Afraid of steam an no.

Al'rnid of the tone of





Master Any Horse Break a Colt In

The Beery Course gives Double—Quick Time!

you the priceless secrets of You can do it by my simple,

a lifetime—enables you to fracticalJiumane system.’l‘here



s a lot of money in colt training.



Make 81,200 to 88,000

a Year



Many of my graduates are



making big- money as protes-



slonal horse trainers at home or





master any horse—to tell the

disposition of any horse at

sight—to add many dollars to

the value of every horse you

handle—and m y students are

all good traders.





 





 





 





arm

TRAIN-





ickmg.





Hard to shoe.

Bad to groom.

Refusing to





along 9





wagon.





 





lilting. Striking.





Breaking stru a.

old book

Swhile going; down hill.

curing at manor 08!

tb road.





Tail switchers.

Lolling the tongue.

Jumping fences

Bud to bitch to be“: or





shafts or humane.

Running away.





 

 





 





   





BEFORE TRAINING





My Graduates Are

Doing \Vonders





A. L. Dickinson. of Friendship

N. Y.. says: “I am workinsn pair of

horses that cleaned out several men.

I got them for 8110, gave them a few

lessons. and ve been ottered 5400



, ' Fred Bowden. R. B.

No. & eokuk. Iowa writes: "It's

worth many times its cost."

have many similar letters from

ates over the world.





ING





traveling. I made a fortune trav-

eling and giving exhibitions.You

have the same opportunity.





Send the Coupon





and get the Introductoifi Course In

Horse Training 1" R E. This—

special ofl'er may never be re-

peated. Act now. Tell me about

I your horse. -





PROF. JESSE BEERY

Dept. 42. Pleasant Hill. Ohio





 

 

 

 

 

 

 





 

 





 

 





 

 





 





 

 

 

 





 





 





 

 





 





\\

m \‘

' \





\

w _\\\\\\\\‘





 





\\\\\\\\\\\ \.x\\ .





 





V . \\

. \' \

‘x‘ \





more money in the Live Stock business by

using this great preventative.





Used 1g Endorsed by _5_Q Agricultural Colleges

Our m: u Zenoleum is not all that YOU think It ought to





\‘.\\\ . \\‘.\‘ \\





A Standardized coal - tar disinfectant,

insecticide. animal dip; always the some.

Use Zenoleum; get more milk from your

cows; more pork from your hogs; more wool





from your sheep; more eggs from your hens;

more work from your horses. In short. make





you an have yourmouey

back; no letters, no talk,

just money back.

Prices: postpaid—s 02.

25c; qt. 50c; gal. 81.50.

Ask for our free 1915 Live

Stock Life Insurance Polky.

The learner Disinfectant Company

"Claw! hm. Molt, lid.

,Use Zenoleum Lice hwderfor fiultry. .' .





 





 





 





{X





-— If a horse could tank or a sheep





“manhyonhosalfeel

fmeafterthxthaircut“





‘l’ve just had ‘

marewodoff

me thanever ,,

before‘P "I.

93*... 559° £23.!

II .l‘ If

a: engages“ are

shop you cheer wig?





.~ y‘-





     

 





 

 

 

 

 





 





 

 





   





 





 





wm Writm to advertisers plan nation The llohian I'm.





lifted in some places it was retained

in others, which hampered shipments

to a great extent, and speculators

have been taking advantage of the

conditions to lower prices. The hind-

rances to the business have lasted

longer than even the most pronounced

pessimists had looked for and planned

to meet.

Reasons for Optimism



With all that is discouraging that

can be said, there is a ray of hope for

better times to come. Depressed pe-

riods are always followed by a revival

of interest in any meat product which

has been selling at a comparatively





3 ’low figure. When pork prices rule un-





satisfactory, large numbers of the

breeding stock are sent to market.

The numbers of pork hogs that will

be fed for the market next summer

will not be as large as they would

have been if this period of depression





1 in prices had not come upon us.





For the pig raisers who will be cau-

tious and careful so as to save a large

percentage of their pigs,,and will

crowd them along on a. variety of

feeds, there is a chance to make some

profits on the pigs at present prices.

The fact should be kept in mind that

the increase in weights can be made

at about one-half the expense that it

is possible to secure them if only

corn alone is fed. A variety of‘ feeds

adds a relish which can not be se-

cured with only one feed, and when

feed is relished it is digested and as-

similated to much better advantage,

than when the feeds are not especial-

ly palatable.



Pasture an important Factor.

Grasses and clover should be util-

ized to a great extent where one de-

sires to get the most from the grain

feeds. Grasses and clovers not only

bulk up the feed in the stomacn,

which enables the gastric juices to

permeate it more thoroughly and get

more of the nutrients out of it, but

they add greatly to the sum of the

nutrients in the feeds and make the

increased weights at much less cost

than is possible without them.



Begin to, feed the pigs as soon as

they can be ceaxed to take feeds oth-

er than that supplied by the mother.

Extra good feeds will promote the





 





growth and expand the stomach while





When the quarantine was about right for horses doing medium





to heavy work, consequently if the

grain is to be fed alone, oats would

have a higher food value, pound for

pound, for horses, than would barley

when these grains are fed with mixed

hay. Barley is a grain which is more

comparable with corn in its nutritive

ratio and place in the ration of horses

and other animals. For the idle horse

or the horse at light work, where fed

clever or alfalfa hay, barley would

have a somewhat higher feeding value

pound for pound on account of its

greater fat-producing qualities. When

fed to other stock, the same basis of

figuring relative values may still pre-

vail,‘except that for horses cats are

generally conceded to have a. tonic

value not possessed to so great a de-

gree by other grains. For fattening

cattle or pigs barley would, on this

basis, have a higher feeding value

than oats, while for cows in connec.

tion with corn, the oats would be

more valuable.



As a source of protein for live stock

other than horses, oats are relatively

more costly than other protein con-

centrates, so’that in the feeding of

such live stock barley is deemed to be

a more valuable feed than oats by

many experienced feeders, and it

would have a slightly higher theoreti9

cal value in proper combination with

other grains. It is quite difficult, if

not impossible, however, to fix an ab-

solute value on the different food nu-

trients, since such value is constant-

ly shifting, due to the change in mar‘

ket values of different grains which

may be used in compounding a ration

for any kind of animals. This varia-

tion in costs is a factor which every

feeder can well afford to consider,

since practically the same results can

very often be gotten at very much less

cost by a judicious combination of

grains. This is true in feeding horses

as well as other live stock. At pres-

ent values, for instance, a combina-

tion of corn, oil meal and a little

wheat bran or cats would be a much

cheaper horse feed than oats alone.

Many other suitable combinations of

grains might also be used to the same

end, although oats will doubtless re-

main in high favor as a horse feed.

owing to their peculiar adaptability to

this use.





-4~ut...,._. . . ....
Awm«~...h.. , ....





 





 





MARCH 13. 1915.





 





 





THE MICH





 





 





IGAN FARMER





'77/l

///// --





 

 





7-319





 





J





 





 





it!





AVA ——‘j‘uiu._=.=





3/,- \l

‘. . l) x 225 It! / \





.V ‘1 [y

72 :‘hg/Z/W /





m





AVA





w Flag —a- - - M” m 7

§ seemMam-awemammamas2“ V4 $12

W i ‘ 4V

\





//..///





 





IQ ° fr} / -~

W n )7]; 2?” Lightness Can Be Combined

M 424/ _ With Strength





\





 





 





 





 





HUDSON PROVED IT





When light steel bridges took the place of stone,

there came up the question of strength in them.



When steel buildings displaced solid masonry, the

question arose again.



So in automobiles. The early high-grade Sixes

weighed 4500 pounds. That overtax in tires and fuel

barred the Six to most men. Now it is known that over-





weight was a crudeness, a weakness in itself.





The Hudson Remedy





Howard E. Coffin, the great HUDSON engineer, long

ago decided that lightness could be combined with

strength. He displaced cast iron with aluminum. He

adopted pressed steel. He re-designed a thousand parts

to secure staunchness without weight. His hollow driv-

ing shaft illustrates one method of weight reduction.



Then he designed a small-bore, high~speed motor.

That let him lighten a hundred parts because of the

lesser shocks.



After four years of effort, the final result is this

HUDSON for $l550. lt weighs 2890 pounds, ready

for the road. As compared with old~time Sixes, it has

cut fuel and tire cost in two.





Excess Out-of—Date

The Light Six vogue started with this HUDSON.





Now crude excess is distinctly out-of—date. The leading

cars average hundreds of pounds less than last year.

But the HUDSON, because of our years of refinements.

is the lightest in its class-the lightest 7-passenger Six.





We haVe. Dealers everywhere.





MICHIGAN DEALERS





Ann Arbor—Ann Arbor Garage.

Big Rapids—C. P. Judson.

Bessemer-E. H. Ekman.



Battle Creek—American Motor Co.

Birmingham—Morris Levinson.

Bay City—Peter J. Oswald.

Chassell—Edwin E. Warner.

Durand—Durand Auto Co.





Dundee—McIntyre





Donoit—The BembRohmson Co., 288





Jefierson Ave.





Eaele River—R. L.

Flint——A. A. Farnam.

G]adstone——Holmgren Auto Co.

Grand Rapids—Reid Auto Co. _

Hillsdale—L. E. Roethlisberger.

Iron River—Lindwall & Lindstrom.

lords—«Eugene Kerstetter.

Jackson~Temple Garage Co.





This year, if you pay between $l000 and $2000. you

are pretty sure to want a Light Six.





is. "Which is the best Light Six?"





10,000 Men Say Hudson

Over l0,000 men chose the HUDSON. Half of





them bought last year's model, and have driven it two

seasons. Half bought this year's model. Together

they have driven this car, perhaps, 25 million miles.





Your sole question





They have proved it right. They have found no weal;-

ness, no shortcoming. Any owner around you will say that.





That's the all—important point. Every old-time stand-

ard has been radically revised in creating the Light Six.

And only time and tests can demonstrate the avoidance

of mistakes.





The HUDSON has met those tests.

success. lts buyers take no chances. It is, in addition,

a Howard E. Coffin model. It is a finished product,

showing the results of four years of refinement. We be-

lieve that you'll select it.





HUDSON Six-40 Seven-Passenger Phaeton, $l550. I

f. o. b. Detroit. Four other styles of bodies.





lt is a proved





The HUDSON Company never loses interest in the cars it seils.

So long as a car is in service we maintain our interest in the character

of its service. That's one great reason for HUDSON reputation.





HUDSON MOTOR CAR CO.





Detroit, Michigan

These are a few in your vicinity:





Kalamazoo—Kalamazoo Auto Sales Co.

Lansing—F. A. Roethlisberger, Jr.

Marquette—Superior Garage, Ltd.

Menominee—Auto Service Co.

Manistique—L. Yalomstein.

Owosso#Ferris Bros. & \Volaver.

Plymouth—J. R. Rauch & Son.



Port Huron—George E. Yokom.

Saginaw—Saginaw Hudson Sales Co.

Union City—F. B. Hart.

Wyandotte—A. W. Pardo.





Bros.





Blight.
sac—s





 





 





MN‘





.,i""





A saving to the dairying in-





terests of $100,000,000 a year

would result from the u'mversral

installation of the





SHARPLES





MILKE‘R





For this machine alone—now

milking 250,000 cows tw1ce daily

~—has developed the mechanical





milker to its highest known





degree of efficiency.





The Sharples Milker today is recog-

nized by dairy farmers who have gIven

sincere investigation to the milking

problem as standard dairy equ1pment.

“The Teat Cup with the Upward

Squeeze”——a device that gently mas-

sages the teats upward by means of air

pressure after drawing each squirt of

milk, keeping the most sensitive teats

healthy and pliable—is an exclusrve

feature.





It is our conviction that cows can-

not be successfully milked by a ma-

chine without the upward squeeze,

This process is covered by the broad-

est patent which our Government can

grant—a process patent—owned by

us. No other milker made in the

world today gives an upward squeeze.

We will promptly defend our custom-

ers and ourselves should any infringe-

ment be attempted.





The T'superiority of the Sharples

Tubular Cream Separator is

typical of its popular growth year

after year.





Send for literature describing in full

detail the manifold advantages accru-

ing from the every-day use of Sharples

products. Sent anywhere on request.





The Sharples Separator Company

West Chester, Pa.





Principal Branches: Chicago ' San Francisco





DISTRICT OFFICES AND AGENCIES EVERYWHERE





I ‘ >.‘ 'I

~ “can I





 





 

 

 





 

 





   





B





THE MIC'HIGA‘N’ FARMER





Testing Cows fOr Records.





MARCH 13. 1915.





 





WNERS of pure-bred dairy cows



are more and more coming to



the point reached by most own-

ers of fast horses; they want to make

records for dairy production just as

much as the horsemen do for speed.

The time was when a man who had a

phenomenal cow would save her milk,

set it to rise, and churn to see how

much butter she made in a given time.

This method was satisfactory to the

owner, but when it came to competi-

tive work among diiferent breeders,

each of whom claimed the best record

for his own animals, some more ac~

curate method of stating the results

had to be hound.



Nowadays when a cow gives prom-

ise of surprising theowner with phe-

nomenal performance at the milk pail,

he sends to Prof. A. C. Anderson at

the Agricultural. College, East Lan-

sing, Mich., or to his own state dairy

department in charge, and asks for a

man to come and test his cow.



The Cow Tester.



Soon after, a young man, likely

enough a student, if in the vacation

time, arrives at his station, armed

with a big box of baggage containing

his Babcock tested and scales. 0n

reaching the stables, he examines the

cow, and compares her description as

given in her registry certificate With

the animal herself. Having satisfied

himself as to the identity of the ani-

mal, the official next arranges with





 





the owner as to how often the animal

is to be milked.



Usually the plan is to milk every six

hours, at least in case the test is to

continue for seven days or two weeks

only; if for a year, the milking is done

twice a day, unless the cow is an un-

usual one. It is a well proven fact

that milk is produced in greater quan-

tities by milking three or four times a

day than by milking only twice. In

fact, many dairymen claim it is hard

on the cow, especially when fresh, to

compel her to go for twelve hours

without being milked.





 





 





 





 





 





 





 





, I-





Method of Keeping Records.



Having decided on what hours will

be designated for milking the animals

under test, the official next makes it

a point to see the cows milked dry at

the appointed time. He notes the ex-

act time at which the stripping is com—

pleted in his memorandum book, and

the test is then under way. One or

the rules which must be considered at

this time, however, is that the test

shall not commence sooner than six

days after the calf was born.



While the cows are under test, the

ofli'cials must be present. at every

milking to witness that nothing is

credited to the cow but her own milk.

He must first weigh the empty pail in

pounds and tenths of a pound, and af-

ter the milk is drawn, weigh again in

the .same manner, recording the

weight of milk in his notes. The next

step is to pour the milk from one pail

to another three times, thus thorough-

ly mixing it, and then dip out a sam-

ple of not less than one-half pint.

These samples are labeled as to cow

and milking, and tested for butter-fat,

and the result recorded.



Butter-fat Tests Made in Duplicate.



Butter-fat tests are made indupli-

cate, and if the two readings vary

more than 0.2 per cent, a second dup-

licate test must be made. Now multi-

plying the weight of milk by per cent

of butter-fat, gives the weight of but-

ter—fat. Blanks are provided for re-

cording all this data, and at the end

of the test period, the total production

must reach a certain standard, de-

pending upon the breed and age of the

animal, in order to admit of Registry

of Merit, or Advanced Registry, as

the cow-diploma honors are called.



When the papers are fully made out

they must be taken before a notary





public, and affirmed as correct by the





testing official, the Owner, milker, and

feeder. The figures are then' checked





over by the state director of such

work, and the papers sent to the breed

association secretary. He looks the

application over, checks the figuring

again, and if he finds that the cow has

met the conditiOns imposed for ad-

vanced registry, issues a certificate to

the owner.

The Cost of the Test.



The expenses of this work fall upon

the owner of the cow. The officials,

in Michigan, receive two dollars per

day, plus board and traveling expen~

ses. Agricultural College students are

usually glad to serve as testing om-

cials, for the sake of the experience

gained. The werk brings them in con-

tact with the most enterprising dairy~

men of the state, and the man who is

alert to his opportunities will find no

end of bits of information which he

can give, and take on such points as

feeding, grooming, housing, milking

the cattle.



Not more than six cows can be in-

spected at one time by one official.

Owners of large herds frequently can

enter this number of fresh cows, thus

making the cost per cow of the test-

ing work about three dollars per week,

exclusive of feeding and care. Some-

times two breeders will combine their

operations and divide the expenses of

the official between them, but many

good dairymen object to this because

they are unable to give the cow plac-

ed in a neighbor’s barn the same care

and attention which would be given at

home.



interesting Experiences of Tester.



Many interesting experiences fall to

the lot of the testing official. The

writer, who followed the work for a

year, recalls one week spent with a

family of Hollanders, and how he wore

wooden shoes at midnight when at—

tending to his duties at the barn at

that hour. Another breeder had a

habit of shutting off his alarm clock

that was within arm’s reach and set

to ring at midnight; he wanted to milk

four times daily, but did not seem re-

sponsible for his actions after falling

asleep. The official, becoming accus~

tomed to waking at the troublesome

hour, was able to come to the rescue.



Most of the questions asked the ofli-

cial center around the matter of feed-

ing. It seems natural for the‘dairy-

man to want to feed whatever will

produce the biggest yield of butter-

fat, and to think that some specific ra‘

tion will have a marked effect upon

that yield. After observing the meth-

ods of'diiferent successful feeders,

however, the writer became convinced

that there was no best ration for the

purpose. The feeder must be careful

not to change the ration suddenly, nor

to use ingredients to which the ani-

mals are unaccustomed, if he would

avoid the danger of throwing the ani-

mals “off feed.” Plenty of succulent

material, a mixed grain ration, and a

clean manger within half an hour af-

ter feeding, seem safe general sugges~

tions to make.



Care in Feeding.



Not infrequently the feeder, in his

effort to make the cow respond to the

last full measure of her ability to eat

and assimilate, will overfeed. The

writer recalls the chagrin which a cer-

tain Hollander, hired to supervise the

feeding and care of Holsteins by fan-

ciers of that breed all over the United

States, was made to feel when he

found that a cow which gave promise

of exceeding the world’s record had

gone “off feed” while under his care.

He was not feeding as much by a

wide margin as he had safely fed to

other cows giving butter-fat at her

rate, yet this particular cow had 3 lim-

iting factor of her own, and fell down

completely when asked to perform in

world’s record style as other cows had

done.



Benefits Derived from Tests.



Some. of the benefits to the breeder

of such butter-fat tests are: Better
MARCH 13, 1915.





price fOr bull calves; advertisement

to the farm; a standard established by

which to select breeding stock; great-

er insight gained into methods of_in-

tensive feeding and care;_ a greater

love for the betterment of the breed;

contact with the best professional men

and literature on the subject of dairy-

ing.‘ ' .

That the seven-day tests at calving

time are of little value for showing the

average performance of the animals

as compared with the semi-official

yearly tests is clearly shown by Prof.

Eckles in Missouri Station Bulletin

100. The cow which loses in flesh af-

ter calving generally gives a richer

milk until the normal weight of flesh

is reached. In the semi-oflicial tests,

the inspector happens around un-

known to the owner, once a month.

notes the weights of milk being re-

corded and compares with the results

obtained when he is present, takes

and tests samples, and gives the aver-

age test for the year as the multipli-

cation factor to be used with the

weights given by the owner for milk,

in obtaining the butter-fat total for

the the year. The inspector remains

on the job two days out of each month

that the cow is in lactation, thus mak-

ing the cost of the test greater than





THE MICHIGAN FARMER-





is generally better to have two silos

of mediumsize rather than one very

large as the different years bring dif-

ferent conditions. In view of these

facts, the man who puts up a silo

should in every case build it large

enough for ordinary needs as it has

been conclusively proved that ensilage

has practically as important a place

in summer feeding as in winter feed-

ing. By this it will be understood that

instead of putting up a silo 12x24 feet

or 14x24 feet, as the case might be,

that a man should build one 12x30

feet or even higher. I am fully confi-

dent he will be well repaid in the long

run.





Illinois. W. M. HARDY.





A RATION WITH POTATOES.





 





I have clover hay, cornstalks, oat

straw, corn and cob meal, bran, and

potatoes to feed my cattle. Will you

please make up a ration to feed the

milch cows and young stock? Should

I buy any other feed for them? How

much salt should cattle have? What

is the right temperature for the dairy

stall? How much skim-milk with calf

feed should a calf have when one

month old? SUBSCRIBER.





If you feed two good feeds of clover

hay a day you can get along with corn





 





when a seven-day test is conducted,

but the better result would seem to

warrant the expenditure.



Benzie Co. E. H. BROWN.





SILOS SHOULD BE DEEPER.



Of late years much publicity and ad‘

vice have been given through the ag-

ricultural press regarding the danger

of constructing silos too large. This

has probably resulted in many farm-

ers going to the other extreme and

building their silos much smaller than

they should be. Two of my neighbors

have already discovered their mistake

to their sorrow. I believe that Where

one silo is built too large one hundred

are built too small. By this I do not

mean that they are necessarily too

small in diameter, but that many silos

built from 20 to 26 or 28 feet high

should properly have been from 30 to

36 or even 40 feet high in order to

have insured sufficient capacity. The

manufacturers'of silos generally rec-

ognize more than anyone else the dis-

advantages of building silos out of

proportion and most of them have dis-

continued the manufacture of those

greater than 18 or 20 feet in diameter.



It does not follow that a silo 20 feet

in diameter is necessarily out ofpro-

portion as these things should in ev-

ery case be governed by the particu-

lar needs of the owner. For instance

while a silo 13 feet in diameter would

be too large for some farmers who

maintain only a limited amount of

stock, one 18 or 20 feet would not be

excessive for the man who has 75 or

100 head of cattle. But even then it





A Promising Young Bull.





 





and cob meal and wheat bran for

grain and have a well balanced ration.





*You can feed oat'straw or cornstalks





once a day for variety.

Mix the corn and cob meal and bran

equal parts by weight, and to your





cows feed one pound of grain for ev-é





ery three or four pounds of milk each

gives. Feed a peck of potatoes twice

a day to each cow. For the young





cattle you can feed a little more lib-





erally of the cornstalks and oat straw

and not so much grain. If you have

the potatoes to spare, feed the young

cattle a few also for an appetizer and

for succulency.



Cows should have about two ounces

of salt a day.



A cow stable ought not to get below

40 degrees nor above 70 degrees in

temperature. Of course, in summer

we cannot prevent the high tempera-

ture, but we can prevent the low tem-

perature in winter.



\Ne never feed over five pounds of

skim-milk to a feed, or 10 pounds per

day; give it other food for the balance

of the ration.





COWS LOSING FLESH.





For some time back my cows have

been losing flesh and shrinking on the

milk. I feed them a bushel of en-

silage twice each day, a good feed of

bright corn fodder, and a small feed

of hay, mostly clover, for roughage.

Their grain ration consists of one

pound of grain for every four pounds

of milk they produce, of the following

mixture: 500 lbs. bran, 300 lbs. of

buckwheat middlings, 250 lbs. ground

beans- Is this unbalanced?

beetvpulp, dry, be substituted for any





l





Could _





 





 





 





 





 





 





730 times





every year you use a

Cream Separator





0 other machine or implement used on the farm receives



anywhere near such constant use, nor is there any other

farm machine or equipment with which quality of work means

so much and first cost means so little.





If the separator runs hard, gets out of order or isn’t easy

to wash, it’s a constant. bother, and it only takes a very little

loss of cream at each separation, when multiplied 7330 times, to

run into a good deal of money, very soon more than the original

cost of the machine. But no matter how small the loss, it is





too big a handicap for any cow owner to try to work ix ith.



As a matter of fact. the men who know most about cream

separators, the creamerymcn, long ago came to the conclusion

that the De Laval was the only machine they could afford to use.

That’s why 98% of the cream sepzu'alors used in creanierics and

milk plants the world over are De Luvals.





All the more reason

Why you should {buy a





t





No matter where you go you will find the biggest and best

dairymen almost invariably are. Dc Laval users. Experience has

taught them that it is the best and most economical cream

separator.





   





You don’t. have to experiment. with cream separators any

more because the men who are best able to judge as to the merits

of the cream separator have already done that for you, and the

result of their conclusion is evidenced by the practically exclusive

use of the De Laval in cr :ameries and milk plants and the fact

that over 1,750,000 farm and dairy size De LavalS* more than

all other makes combined are in daily use.





 





The nearest De Laval agent will be glad to set up a machine

for you and arrange for payment of same as is most con-

venient. If you don’t know the local De Laval agent,

simply address the nearest main office as given below.





The De Laval Separator Co.‘





165 Broadway, NewrgYork 29 E. Madison St., Chicago





 





9—321





“Bi.





 





 





 





 





 





 





\ .





 





 





l 50,000 BRANCHES AND LOCAL AGENCIES THE WORLD OVER





 





 





it“





in





lllllfllll

' llllllmlllll





 





 

 

 

 

 

 





 





Only silo made with these com-

bined features. Doors on Hinges.

Continuous Door Frame. Refrig-

erator type of Door and Door



. Oval Door Frame to fit

" -; exact circumference. Not a bolt

. . likentirela-ldoor fame or Gracia.

‘ xtra eav 00 an

L Root Rafters 33d Ancll’isora furniaglfed

FREE. Backed up by 63 years of exper—

ience. Write for catalog which explains

fill. AGENTS WANTED.

‘ HE E. W. ROSS CO.

Springfield. Ohio





i ,

its;





=_ l

gum

dollar-saving, dollar-making ideas.

l—afa—n war on

wlimited el

ribs today 1‘ the

TH! J08. DIGK MP . .

-_ ,. T ”x 24 G CO

Fox 14





 





Canton, Ohio

hzzard Ensilage Cutters





5" Silo owners





If. you are thinking of buying an ensil-

age cutter. write for this new book—

Making Silage Pay Better.” Full of





Tells all about the Blizzard Ensll o C



e origi "blowar” cutter. Signplemgs

a tirierc-aam‘i“ enlzline runl ii:—

z: x bog?”- to {or-yearn.
International vester

Cream Separators





\'.





 





 





 





/ /





PICTURE to yourself the difference inthe amount

of actual work done, between setting milk in

any of the old-time ways and skimming it with an I H C





cream separator. What a Job 1t 15 to wash the pans or

crooks. How many handlings they need. What a lot of time it

takes to fill them and set them away, to protect .them' from d1rt,_ to

do the actual skimming, to dispose of-the cold skim milk, to purify

the crooks or pans. _ .



Now note the difference. With an I H C separator the milk .15

skimmed while still warm from the cows, the separator 1.5 washed in

a few minutes and everything is ready for the next milking.



You want the separator that will help you most. There are other

things than the saving of work to be con81dered. There IS sav1ng

of cream, value of the machine, service in case of acoldent, and

many other things to be thought of before you buy a separator.



Take time enough to buy a cream separator. The more carefully

you go about it, the more comparisons you make, the more clearly



on will see that one of the International Harvester separators—a.



airymaid, Primrose, or Lily, will serve you best. See the I H C

dealer. Get catalogues from him or write to us for them.





international Harvester Company of America





(incorporated)

CHICAGO

Champion During McCormick Milwaukee Osborne Hull





g§mlAL .





AMERICAN CREAM





SEPARATOR





iving splendid sat-

Thouma‘ In use igsfaction justifies

your investi atin our wonderful offer to

furnish a ran new well made, easy

running. easily cleans . perfect skimming

Separator for only $15.95. . Slums one



art of milk a minute. warm or cold. Makes thick or thin cream. Different from

t is picture. which illustrates our low priced large capacity machines. The bowl

is a sanitary marvel and embodies all our latest improvements. and

Our Twenty-Year Guarantee Protects You amalgam 2:2? ma

generous terms of trial will astonish you. \Vhether your dairy is large or small, or it you have an old

separator of any make you wish to exchangr, do not fail to get our great otter. Our richly illustrated

catalog, sent free oft/large on request. is the most complete, elaborate and expensive book on Cream

Separators issued by any concern in the world. Wcrttm c/a'rrs [17sz from [Vastcrn in“. Write (:0-

day for our catalog and A?! faryourulf what a big money saving proposition we will ma e you. Address,





AMERICAN SEPARATOR C0., Box 1061, Bainbridge,N.Y.





These

Seven Cows





Kept One Year On 1 Acre 0!





Eureka Corn. This seed corn yieldel

over 70 ions on one acre—enough to

feed seven cows a whole year. No other

corn has ever equalled it.





EUREKA CORN

grows tallestJaaa most



leaves—more ears



Whyplant ordinary corn that





 





 





 





   

 

 

 





Bargain





yields only 15 to ‘25 tons an

acre, when you can get 70

{Bust at} acre at same prife ?

r c or our “915 cats 01;, Just the ma h' f . -

~. 0 me or on if your herd is

quotations and “at of our small. Famous atented' Curved Disc bowl.





wonderful vu'ieties of big-

yieldlng corn and seeds.

ROSS BROS. C0.



37 Front St. Worcester. Mass.





owned exclusively )y us, skims warm or cold milk

exhaustively. Finest grade oflinwnre. Enclosed

dust—proofgenrs. Quality is guaranteed in every

particular. S lendid shop organization, factory

equipment an quantity output, accounts for low

pricesimpossible without great output. Equally

attractive prices on larger operators. Write for

descriptive Separator book.





. ASK ABOUT PAMOUS “CHM $ AND

BOY” LINE 0? GASOLINE £le 8 UP



IRES—HAD! IN ALL SIZES

ASSOCIATED MANUFACTURERS C0.





181 Mullen Avenue anuoo. iowa





 





 





 





Empire Molasses-1





l aves grain. Puts fat on stock quicker and cheaper,

rite us todafifor low prices and uarantee. .

Am 5 0 IV ‘- In '3





       

 





 





BUY FEED—CAR LOTS 5733?:





Oil Meal. Homln . Gluten etc. Save money. Ask

price. J. E. 13m ott 00.. nod Mill. Jackson. Mich.





Milk Cans





It takes amighty good milk can to stand up long under the bumps

and smashes of constant rough handling. ' The service a milk can gives

depends almost entirely upon its construction.





. Sturges 22:35:; Milk Cans





of stiff, heavy steel that stands severe shocks without denting.

0113mm “S" seam construction gives 4 thicknesses of metal where and breast

join. A heavy. half-oval sted hoop. shrunk into place —- joins the breast and body-—

give. gran strength and serves as a bum er. A 1 part: of Sturge- Cans ere tinned

end retinned after rivet holes are who end before parts are together, in

all surfaces are protected from rust md corrosion. Soldering {aide name in as

smooth as class. The weight is evenly distributed— Storm Cane mwoll Mound.





neither top-heavy nor bottom-heavy.

connecv CAPA¢ITY comments; When I Reorga- Cln ll maid 5 gallons

It holds 5 alien. to the ri in the neek~no more, no less. This is on exclusive tee-

ture too only in Sturzee ens. A red cool on every can is our mm and your

protection of correct capacity—end 1 Iran leek;.. w“ M

lnelet tor Cone. Standard for nearly mu. no names

“were 1‘: yourloeeflty who handle chem—old cot-Ion Ho. 46





Stung” & Burn Mfg. C0., 506 8. Green St. W





 





 





THE MICHIGAN; FARMER





MARCH 13. 1915.





Ofutllde" algefve 13nd getter lg, fif got wthat peck night and morning to each, cow.

0° - ” 0“ ra er no 99 cot 011' butl h ’t non h for this, one

seed and I think oil meal rather' high feed 23:21}, $313210 :erygmcely.





indfi‘égee 00. J, w, T. For grain, corn meal, ground oats or



I believe this ration is lacking in bran with a little cottonseed meal.

fat and starch. All the concentrates Mix the corn meal and bran equal‘

are protein food. Bran, the lowest, parts by WGIEht. Feed two 901111de 01'

contains 15 per cent protein, while cottonseed meal per day to each 00W-

buckwheat mlddlings contain about Then if you have Well-bred dairy cows

22 per cent and bean meal about 20 you can increase} the corn meal and

per cent. I would suggest corn meal bran until 93011 COW is getting as many

in place of bran. If I did not think pounds of feed per day as, she pm-

you were probably getting buckwheat duces pounds of butter—fat per week,

middlings quite cheap for their food 01' 0118 pound 0f feed for every three

value I would drop these out instead, 01‘ four pounds of milk produced. Bet-

or beam meal is the most undesirable ter begin With a small feed and grad-





   

 

 

   





, is hardly enough.





 

   

   

   

   

 





that Stand Abus;





warrant you in feeding it. Bran is

high, and if you drop this out and sub-

stitute corn meal the ration will cost





, no more and I think you will have





better results and the cows will stop

losing flesh.





 





CORN AND COB MEAL'NOT AS

GOOD AS CORN MEAL.





 





I wish your advice on a herd of 13

cows we have. We are milking 10

and three of those are due this spring.

We feed bran, cut cornstalks, clover

hay, corn and oats ground. Last year

our cows averaged 40 lbs. and better

all through the winter, but this winter

they are not as high. They did good

the fore part of the winter, when I was

feeding half oats and half corn meal,

cottonseed meal, clover hay twice a.

day, cornstalks once and silage twice;

one pound of grain to every four

pounds of milk. Now I am feedinsr

silage twice, clover nay twice, corn-

stalks once, corn and cob meal, bran,

potatoes and cottonseed meal and the

cows are dropping off every day.

salt them in silage night and morning.

Have one cow that gave last year as

a three-year-old, 40 to 43 lbs. at this

time. Now she is down to 32 to 35

and I cannot account for it. They

have good drinking water twice a day.



Oakland Co. C. W. R.



This ration is composed of good

foods, has plenty of variety, and also

has succulency. Cows ought to do

well. I cannot give a reason unless

C. W. R. is figuring that corn and

cob meal is equal in feeding value to

corn meal. It is not; the corn cob

has little or no food value. Some-

times it is wise to grind the cob with

the corn to make the ration a little

more bulky, but when you feed bran

also this would be a detriment rather

than a benefit. Try corn meal in place

of corn and cob meal and perhaps in-

crease the cottonseed meal a little.





 





BRAN THE ONLY CONCENTRATE.





 





. We have no regular hay, but grew

last year several loads of oat hay, cut-

ting the oats Just when in the final

milk stage, or just on the turn. We

also had three acres of poor corn ann

we did not husk about half of it. We

also had some soy bean hay but have

used that up. At present we are feed

ing the cornstalks with the small ears

on, in the morning, mangles toward

noon, oats at noon, a feed of bran in

the latter part of the afternoon, and

cornstalks again at night. Do you

think we can get results from this

feeding, that will pay? H. .

The grain ration is hardly sufficient.





While bran is a good feed, that alone





two pounds of cottonseed meal to each

cow. As your ration is, it can be crit-

icized as being too bulky.





 





WHAT GRAINS TO FEED WITH

OAT HAY AND CARROTS. '





 





I would like to know what grain ra-

tion to buy and how much to feed my

cows, which will soon be fresh. I

have an abundance of mixed hay,

mostly clover, oat hay, oats that were

out just before they were ripe, and

carrots. The grain to make a balanc-

ed food I will have to bu .



Emmet Co. UBSCRIBER.





You can figure .oat hay as good as





crease in yield.





 





REINFORCING CEMENT SILO.





 





Kindly give me some advice on oe-

ment silos. A cement man here makes

cement blocks 8x8x20 inches, with 4-

in. air space. He advises reinforcing

the silo two-third of the way up from

the bottom, with two strands of No. 6

wire, one strand the rest of the way.

Do you think a silo of this type would

stand the pressure and not crack, and

also keep silage good? SUBSCRIBER.





Without doubt this will give suffi-

cient strength. It would not cost

much more to use more wire it you

think there is any doubt, but my opin-

ion is the amount recommended will

be sufficient.



If you have a good foundation there

is little likelihood of the silo settling

and cracking. Dig down at least two

feet for your cement base. A cement

silo will keep silage well if it is plas-

tered smooth on inside with rich oe-

ment mortar. Use two parts fine sand

to one of ‘cement, then no one will

have a better silo.





 





AN 18 PER CENT DAIRY FEED.





 





Kindly give me balanced ration for

cows. How much per cow according

to the production of milk? Cows have

mixed hay and corn fodder, all they

want to eat. Would like to feed a

dairy feed, 18 per cent protein; 4%

per cent fat, and 52 per cent carbo-

hydrates, with corn and oats.



Indiana. SUBSCRIBER.





This 18 per cent dairy food is not

rich enough in protein to balance the

other foods in the ration. I should

use some cottonseed meal with it, say

two pounds per day for each'cow.

Then mix the dairy feed, corn meal

and ground oats equal parts by weight

and feed enough of this with two

pounds of cottonseed meal to furnish

one pound of grain per day for each

pound of butter-fat each cow produces

per week. This will make a. cheaper

and better ration than to feed enough

of the 18 per cent dry feed to furnish

the necessary amount of protein.





 





WHAT SIZE SILO?





 





'Would you please give me some ad-

vwe on building a silo? I am planning

to build one this summer. Our base-

ment barn is on eight-foot stone wall

and I am planning to dig down about

four feet below the basement floor.

That will make it 12 feet to the top

of the bank. Would use stone for this



feet and for the balance cement

blocks up to about 24 feet. That will

make it about 36 feet in height, but

we can’t decide whether to have the

inside 10.01‘ 12 feet in diameter. We

are keeping about 25 to 30 head of

cattle. What would you think about

white and yellow dent corn that gets

ripe in northern Michigan, is planted

three feet four inches apart. and put

in silo with ears on, for silage?



Leelanau Co. H. C. H.



With the number of cattle you keep,

a 12-foot silo will be none too large.

Your plan for building is good, but I

would not go down below the stable

floor, as water may seep in. and any-

way, it will be considerable work to

pitch the ensilage out. You can blow

the ensllage four feet higher in filling





easier than you can pitch it our four





your mixed hay, and carrots as good feet below the ground. You must plas-

as any succulent food you can get, ter the silo on the inside after it is

therefore you have a splendid rough-r finished, with rich cement mortar, to

age. Feed the mixed hay once a day make it smooth.



and the oat hay once a day. Find It you get good dairy Shorthorns,

what the cows will eat without waste. there is nothing .better as. dual—put.





If you have plenty of'oarrots, feed a pose animals.
5... »-- ..,..._ «w - -~ «4-7 ~ - V»... a; .H-..-. . .. .r. my... w,





'.MARCH13’1915' ‘ . THE MICHIGAN FARMER 11—323 .





 

 





afgzrg‘gmyarlmgmxn (any? 13;; .. f. 5.

'lila-l?;'31‘l" {: ‘ I 11).!

{Wiflig/ ‘fl‘fiif I I}!

l





1%. {Gigi 1.. ‘2 P? ‘

Ma. {trimming} W

. g.





1 .eRi ,j? 5. it





7 )2 , V ’5 , 1 — 0 i I



ll ill" * i "I I I t h ' ' ”ii" ’ fir/r " 3 1%”



.Navo t ...- , r 35”!” ' ”if ‘



ammonium. . .9 /.\'- ~. I , . i



NovoEucmu-o. _\ .1 “fl 5‘“. fl‘ 2... ‘ 0“. . a}! . a l

. (in-“ii . __ ,~ .





Human-cu "SA.





Illll l





I





 

 





 

 

 

 





 

 

 





l .

l





I





i





 





   





Novo has been thoroughly tested by concrete mixer

manufacturers. So have other makes of gasoline engines.

The resultis that 80% of all concrete mixers are now run by

Novo Engines. Think of the shaking and jarring an engine

gets when mounted on a truck with a concrete mixer.





The racking strains to which contractors have put Novo Engines prove

their ability to deliver reliable power under fearful handicaps.



You may not handle your engine as roughly as contractors handle their

pumping outfits, concrete mixers, etc, but you do want Reliable Power.



You want an engine that is ready to run anything, at any time under

any condition. You want Novo reliability and Novo convenience.





lilllllllllllllllllllllllIlll|llIlllllllllllIlllll|lllllll|l|llllllllllllllllllllllll





You want Novo simplicity, Novo lightness, Novo easy portability,



. Novo compactness. You want Novo freedom from freezing trouble. You

Novo Engines are built according to principles conceded can get these 011]); in



to be best by experienced engineers. Unlike most engines,

Novo Is of vertical type, the same as engines used in all

automobiles. The many advantages of vertical engines are

explained fully in our catalogue. There is no racking

vibration such as you usually find in horizontal types. There

are no complicated parts, cumbersome tanks or circulating

pipes. Look at the illustration above. Did you ever see

so Simple an engine? The fuel is in the base; the water is

In the frost—proof hopper around the cylinder. Any one

can start and_‘run a N ovo.





Furnished in 1-15 Horse-Power Sizes





 





ENGINES

OUTFITS





   

 





Off

and





To those who have used gasoline engines, we

do not need to impress the importance of buying

a good reliable engine.





   

 





 

 





 

 





"7-:- H





’ /if(¢?\i’

a”, A (/:r_..t.§,,li





5. u .. -- H"),

w «9.

a!)





 

 





Fig. ”5.6 —- Novo

Jr ——(1 H. P. l or 1%

H. P. . Engine attached to

windmill pump. An inex-

pensive outrit every farmer

should have. $01) always

have water when you want I

it. Engine v.1. tie readily

detached are azed else-





 





lllllllllllllllllllllllllllllllllllllllllllllll|lIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll llllllllllllllllllllllllllllll





llllllllll|llllllllllllllllIllllllllllllllllllllllllllllllllllllllllllIlllHllllllllllllllllllllllllllllllllllllllllllllllllllilll





‘, To those who are about to buy their first

Fig.15144 --vao Portable Buzz Saw—Built for _ . .

trailer.- .5assert:assassin3:325:22: engine, we web to say most emphatically that you





“mm““emmdmw“y“"e' will find a Cheap, unreliable engine a worse in-

vestment than a cheap, unsound horse.





 

   





You owe it to yourself and those who work

with you to investigate N ovo.





 





 





L U E l ' N F' 1] —='

a... . .. . et 3 xp am ovo u y ,

' Fig.200—Novo Deep Wen Head—-This outfit is '



used for pumping from deep wells or in any well where ’ ’



the water level is more than 25 feet from thesurface. Can \Ve don I ask you to struggle through a catalog and [O ’



be furnished with air compressor attachment for pneumatic . . ' .



systems. Allgears are encased in oil.makinz it noise- buy With only pictures to gu1de you. VVe offer {0 ShOW you the ’



less and durable. , , . . .



engine itself. To explain every detail of It. All you need to O’ "F





do is to let us know that you are interested in doing your heavy I

work—pumping. sawing, grinding, hoisting, lighting—for less O N .

money than it now costs you. Send us your name and address ’ ‘OVO Engine





to—day. lepany,

_ b . . e ’ Lansmg, Michigan

Novo Engines can e furnished for operating 69’ Gentlemen z—Without





on gasoline, kerosene, alcohol 9’





b1' 1

or distillate. any 0 lganon, please tell





vs" me Why Novo is the best





' o . .

0’ engine for my requrrements.

W ENGINE CO. 0’ I use an engine for the following





I r oses :

’ pu p





 





Fig. 15137—Farmers' Handy Hoist—This outfit





is built to meet a rapidly increasing demand for a small

inexpensive hoist on the farm. This hoist will pay CLARENCE E. BEMENT. Sec'y and Manager





' . d' h ‘ ' t b it .

thithewrtrgi .2?:.“’;‘::..‘3:.§:.i“5 ‘“ 6 °' 562 Willow Street, LANSING, MICHIGAN ,0





" and require about WMMHH. P.





 





0 Name





lllllflllllllllllllllllllllllllllllllllllllllllillllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll“3' Address,





 





 





 





lliilllllllllIlllllllllllllllllllllllllllllllllIllllllllllllllllllllllllllllIll||l|Illllllll|lllllllllllllllllllllllllllllllllllllllllll
324—12





The Michigan Farmer

Established “‘43. Copyright 1914.





The Lawrence Publishlng Co.

Editors and Proprietors.



39 to 45 Congress St. “'est, Detrolt. mourn



TELEPHONE MAIN 4525.



NEW YORK OFFICE—‘41 Park Row.



CHICAGO OFFC E-604 Advertising Building.



CLEVELAND OFFICE—10114015 Oregon Ave" N. E.



PHILADELPHIA OFFICE~214~218 Twelfth St.





 





 





 

 

 





 





 





M. I. LAWRENCE. .................................... President

hi. 1.. LAWRENCE ................................ Vice—President

15. H, HOUGHTON .................................... Sagan“,

I. R. WATERBURY ...................... ‘ ..........



HUR'I‘ W'ERMU'FH- ..... ASBOICZT‘:

I". A. WILKEN ...................... Edizon

ALTA LAWSON LITTELI. ............



E. H. HOUGHTON .......................... Business Manager





 





TERMS OF SUBSCRIPTION:





One year, 52 issues”........................................ . :3

'[‘w.; years. 104 issucs................-......................... 1.00

Three years, 156 issues.......................................

Five years, 260133115... .

All sent postpaid.



Canadian subscriptions 50: a year extra for postage.



Always send money by dratt. postofficc money order.

registered letter or by express. VV'e will not be rcsponsibic

for money sent in Il'IlSI’S, Address all communication. to,

and make all drafts checks and postolhoc orders payable to.

The Lawrence Publishing Co.





 





V‘Ve never, unless through error. send The Michigan

idlrmer beyond the «late subscribed to-~our subscription price

bcinz always due in advance, and sample copies always free.

No bills will ever he sent should a subscription thromh

error be continued after expiration.





 





RATES C F ADVERTISING :





40 cents per lint: agate type measurement. or $5.60 per-





No adv‘t an

No object-'03-





inch (14 agate lilies per inch? per insertion.

sertcd for less than $1.20 mch insertion.

able advertisements inserted at any price.



Entered as second class matter at the Detroit. Michigan.

postofiicm





DETROIT, MARCH 13, 1915.

CURRENT COMMENT.





 





 





 





 





In an address deliv-

The History of ered before the U. Si

the Epidemic. Live Stock Sanitary



Association at its rc-

cent meeting in Chicago, Dr. A. D.

Melvin, of the Bureau of Animal in

dustry, U. S. Department of Agricul-

ture, commented upon the possible ori-

gin oi’ the present epidemic of foot-

and—mouth disease so far as the Bu—

reau has been able to trace it. Dr.

Melvin’s comments on this phase of

the epidemic are of interest particu-

larly because they well illustrate the

extremely contagious or (infectious na-

ture of the disease and the necessity

for the use of stringent methods in its

eradication.



In his address Dr. Melvin stated

that as a result of the investigation

made, thrcv possibilities as to the

method of infection have been devel-

oped. The first of these possibilities

is in connection with the return from

a visit to New Orleans of the wife of

the farmer in whose herd of hogs the

disease first developed. The lady’s

grand-daughter had recently been var:-

cinated against smallpox in New 0!"

leans. This possibility is rather re~

mote but nevertheless is under investi-

gation. The second possibility is in

connection with the purchase by the

farmer of merchandise from a Chicago

firm, including two pairs of gloves im-

importcd from Germany. The paper

used in v. rapping these goods was

thrown into the hog lot about ten days

before the hogs developed the disease

which subsequently proved to be the

foot—and—mourh discasc, and the possi-

bility exists that the infection was de-

rived from this source. The third pos‘

sibility is in connection with the steal-

ing of chickens from the farm a short

time before the appearance of inferL

tion among the hogs. The farmer sup-

posed that the chickens were stolen

by foreigners employed in a local tan-

nery and that possibly the disease

may have been brought to his farm by

one of these suspected men who might

have- become contaminated with the

virus from imported material used in

the tannery. It has been learned from

diligent inquiry that no importations

of hides had been made by this tan-

nery for more than eighteen months

before the outbreak. Certain tanning

materials, however, were imported in

large quantities, mainly from Argen-

tina and Japan, in both of which coun—

tries foot-and-mouth disease continu-

ally prevails. These products were

brought into the tannery in packages

covered with. matting or in small bur-





 





THE MICHIGAN





lap bags, which material is frequently

taken home by the employes for their

own use.



This investigation into the cause of

the outbreak of foot-and-mouth disease

is still being conducted but without

definite results as yet. These clues

which are thought to point toward the

only possible causes of the outbreak

show conclusively that it is an ex-

ceedingly infectious disease, and that

stringent methods are required in its

control and eradication.





There was a very good



The Round-up attendance of farmers

Institute. ‘ at the Round-up Insti~

tute, or Farmers’ W’eek,



which was held at M. A. C. March 1—6.





0 The attendance ofiladies was especial-





lygood, showing that the strong fea-

tures of the program for the women’s

congress were a drawing card for that

section of the meeting. It is imprac-

ticable to give anything like a general

report of the Round-up, since its char-

acter has been changed into what is

now practically a one-week course in

agriculture, with several sections of

the meeting in continuous session.

and with lectures in progress on var-

ious subjects related to different lines

of agriculture, so that the person at-

tending can choose such subjects as

he desires to hear discussed from the

general program. There were, how-

ever, many features of special interest

brought out which will suggest ideas

for discussion through the columns of

the Michigan Farmer during the com.

ing year, and thus the beneficial influ-

ence of the Round-up or Farmers’

Week will be indirectly extended to

a large number of Michigan farmers

who did not find it possible to attend

this meeting.

According to the pre-

liminary census of the

birds in the United

States which has just

been concluded by the government

biologists, there are sixty pairs of

English sparrows per square mile, a

larger number than of any other birds

except the robin, there having been

found to be an average of six pairs of

robins to each farm of fifty-eight

acres, while there were five pairs of

sparrows per farm. No other bird

closely approached these numbers, al-

though some are sufficiently numerous

to make their total run well into the

millions for the country. This prelim-

inary census and estimate is made for

the purpose of getting more exact

knowledge of our bird population and

as well to impress upon the people of

the country, and particularly upon the

farmers the fact that if birds were

given more co-operation and encour-

agement there would be a correspond-

ing decrease in the number of insect

pests which the birds are the greatest

single factor in keeping in check.

That birds prefer thickly inhabited

centers of population to forests is one

of the definite conclusions reached

through this bird census. In this fact

lies hope that as the human popula-

tion becomes more dense, our bird

population will increase in similar ra-

iio. The birds can be encouraged by

providing suitable nesting places and

also by discouraging the depredations

of thoughtless hunters and small boys

who are often instrumental in killing

the parent birds or breaking up the

nests containing eggs or fledglings.

Data recently releas-

ed by the U. S. De-

partment of Agricul-

ture indicates that





Encouraging

the Birds.





U. 8. Live Stock

Increasing.





the live stock on the farms of the





country is increasing for the first time

in a number of years. The estimate

of the live stock on farms January 1

showed that beef cattle had increased

3.4 per cent over the number of the

year previous, or a total increase of

1,212,000 head. Milch cows showed

an increase of 2.5 per cent, or a nu-

merical increase of 525,000. Swine

showed by far the greatest increase

of any class of live stock, 9.6





FARMER-





per cent, or a numerical increase of

5,675,000. The total numerical in-

crease of all farm animals shown on

January 1 totaled 7,712,000 head. Not

only was the number of animals larger

but the value was also‘greater, the in-

crease in the total value being $78,-

024,000, or 1.3 per cent over last year’s

total.



That this considerable increase in

the number of live stock in the coun-

try on January 1, however, has not

been a factor in recent declines in val-

ues is evidenced by the fact that the

increase is not proportionate to the

increase in population, which is esti-

mated at approximately two percent.

There is no occasion for Michigan

farmers to become alarmed at; the

prospect of an accumulation of any

surplus live stock since the present

high value of grains of all kinds will

not tend to promote an increase. In

live stock. maintained upon the farms

which will be proportionate with in-

creased demands.





HAPPENINGS OF THE WEEK.





 





Greece is anxious for war in order

to participate in the probable spoils, of

the recent Turkish activities. Both

the Allies and Germany desire her

to remain neutral.





against Turkey the reward she will

ask will be too large, while Germany

has made most solemn guarantees

that if Greece remains neutral she

will be given concessions denied her

at the close of the Balkan war. King

Constantine is also exerting every 1n-

fluence to keep his country neutral.



LaTouraine, the French liner which

was carrying a large amount of am-

munition, caught fire while‘ on her

way to Havre. After a desperate fight

the fire was confined to one part of

the boat. French papers express the

belief that the fire was started by

German spies who might have con-

cealed themselves on board.



The Allied fleets continue to bom-

bard the Turkish forts in the Darda-

nelles. They have advanced to the

narrows Where they succeeded in se-

verely damaging two of the forts and

caused an explosion in one of the most

important there. These defenses are

considered the strongest and the

greatest obstacle to the Allies in their

progress toward Constantinople. A

new development in this campaign 18

the bombardment of the Turkish .de-

fenses on the Gulf of Saros, including

those of Smyrna, in order to cut off

possible reinforcements from the

Turkish capital.



In the eastern and western theaters

nothing .of importance has developed.

Russia recaptured Stanislau and caus-

ed a retreat of the Austrian army,

which amounted virtually to a rout.

The right wing of the Austin-German

army in eastern Galicia and Bukowma.

is said to be seriously menaced. In

northern Poland the Russians have

taken"the offensive everywhere except

at Ossowety where the Germans con-

tinue a bombardment of the forts. In

the western theater there is some ac-

tivity in Champagne and Vosges, but

Without material effect.



The food problem has become a ser-

ious one in Mexico City and General

Obregon has refused to allow any re-

lief work to be done. President Wil-

son has sent sharp notes to General

Carranza, warning him that foreigners

must not be injured in rioting in the

capital or through the inability to get

food. There is friction between Gen-

erals Obregon and Carranza as a re

sult of these conditions, Carranza de-

sires to alleviate the conditions in

Mexico City.



At Sing Sing, where a corrective

and uplifting method of caring for

prisoners has been put into effect re-

cently, a training school is being or-

ganized in which the rudiments of

business is taught. Among the sub-

jects to be taken up will be stenc-

graphy, book—keeping, mathematics,

literature, law and languages. A class

of 200 convicts has been knitting muf-

flers and scarfs for the sufferers in

Poland. One of the most hardened

criminals recently finished a complete

outfit for a baby.



explosion at the Layland mines

near Hinton, W. Va... March 2, en-

tombed over 160 miners. Forty-seven

have been rescued and will survive af-

ter being buried four days. Ninety-

six bodies have been recovered and 20

are still missing. , '





 





FORD CAR OWNERS

Can learn of an easy way to make

money by writing Dadco, ‘ Detroit,

Mich. Mention the Michigan Farmer.

—-Adv.





 





The Allies fear.-

~that if she assists in the activities





 





 





MARCH 13, 1915. -» ~





For Fun





N0 sport equals shooting for

pleasure and health, and shoot-



ing practice is mighty useful to a

farmer. .V . _.



Clay target shooting is the school

for crack shots.



All you need to form a farmer’s ‘

trapshooting club is a barrel of clay

targets and a





BMW"

HAND TRAP





Price $4.00 at your dealers, or sent

prepaid by us. Meet on your farm one

weekz Smith’s next, Brown’s next, etc.



Write for free illustrated Hand Trap

Booklet No. 3-473, which shows how >

to throw 4o-yd. to 75-yd. targets that

fly just like ducks, quail, etc.





DU PONT POWDER CO.

Established 1802 ' \ WilmingtomDeI.





Delivered no. FREE





on Approval and 30 days Trial





7”]; ~37 ,i‘ .)

‘ ’7‘ 7 I a," L‘".

\ H ,





 





 





 

 

 





 

 

 





he .- Ag

I» G x:- In.“





' P . 77‘ .



gowaw.

\5 Vb-



SEID I0 HONEY Eli'm'm'”.§°oz #32235





Blcyclol, Tirol and Sundrlel uterine- so low they will



with you. Also particular: our [rout new offer



to deliver you a Ranger Bicycle on one month'- In.



trlal without a cent expense you.



8 you can nuke money taking orders for biczcleu.



tires lamps. aondnesnetc. frompur'blg and-



some catalog. t7: fr... It; contoma "combination offers”



for re-fitting your old bicycle likeonew at very low cost.

Also much useful bicycle lntgymuéntgn. Sefid for it].



m net: you. 0 one e so can,



u" FAcTon' ‘3 offer such values and such



terms. You cannot afford tobuy n bicycle, tires or sundtioe



withoutfiru lemma that m can qfl'cr you. W to new.



ILIJ





n

m GIG-E 00., - Depth-71. GHICAGO,





 

   





   

 

 





 





 





 





Bowsher Mills often reduce the

cost: of grinding one-half.

That's because they are light

running with perfect conical shape

grinders, difierent from all others.





\~ .





‘ ‘10.





(Sold with a nu elevator)





‘iQ/m. ' ‘

.. ..





Crush on corn with or without

finch ) and Grl all kinds of small

no. Kandy to operate. 10 sizes—-



to 26 H. P. Also sweep grinders.





.4; FREE mm'xsaamg

n: -' D.N.P. M80}. “Bell III.





harm,





(Rex. U. S. Pu. Ounce)





\





if“?





 





 





 

 





lug is that

V: a Red Head.

Red Head: are guaran-

teedalll’etime. Stanford!





r -





urn-m.“ rum-ya. Bunny... N.Y.. U.A.

Maker- of Everhulngly Good Motor Necessities.





EALEDJOINT '

EMENme

TAVEW§§

l l.





 





 





AGENTS WANTE. D.
we

a:

E.

5

o

m

o

O

:5

o

":3





 





 





LITERATURE ii 97w FARM BOY





POETRY 1’ ma GIRE ,

HISTORY are 1i SCIENTIFIC one -

INFORMATION i MECHANICAL





 





. .





 





 





This Magazine Section iormsapart of our paper every week. Every arIicle is wriIIIeII especially for it, and does not appear elsewhere.





WORLD EVENTS IN PICTURES.





 





 





 





 





(“wry-right, hv Underwood It Undorwnud. N. Y.





Col. Roosevelt Investigates Efforts to Aid Poor. Audrey Munson, Poses for Exposition Statuary. Earl Kitchener Directs England’s War? Operations.





 





 





 





 





 





Copyright hy Ulldm‘Wuwl .\' i‘nvII-ruwml. N Y. (,‘npyI-iglit, by ndcrnwvl It Emmi-wood. N. Y.

Emperor William, Prince Henry and Admiral Von Tlrpltz Direct Arrange- MrS. Ernest ThompSon Seton Proves the Montossori System ct" Education is





ments from Kiel for Blockading England. Practical for Poor Children.





 





.i"

w,





 





‘ c

v: o





 





 





 





Copyright by Ulldel wood I: UIIdcru-mnl N. Y.





. Copyright by Underwooc «I Underwood. N. Y.

Street Scene in Furnee, Flanders, wnere British, French and Belgians Meet. German Field Battery on Eastern Frontier, in ‘Action Against the Russians.
326—14 ' T H E M I c H I G A N4 F A R M-E R I . MAncmwxs.





:HOW to Work. ' 9 ~ ., GRASS

’ ‘ SEED ‘

"r‘ a 0m! ION“! 0N“ III my





 





 





 

 

 

   





. s



, Wr'oe us gi ' some idea; of‘ your

FREE : sprayingf nomnd' we will fawn-d

absolute] free. a copy our valuable illustrated work

on Crop ' uses. also full particular! of a ‘





SPRAMDTUR:





best suited to your requirunents. We make SPRA-

MOTORS from $6 up. Write in today.





 





 





By H. A: BEREMAN.

'Mhuynroyhmm-otmn





MAN prominent in agricultural



affairs stated that “mankind are new on our



1323' mortals after all.” He was mswaas'ém'flzrmt

talking to farmers about farmers and





 





 

   





- Iv

Made in U. s. A. SPBANOIOR 00. DOSSibly he imagines he said some- 20mm ”m 1” m. $3333

No Duty to Day. 3315 Eric St" thing very clever. 4 “Jo-yon land, dthordqoruoisenson.





   





2 or 8 outlaw. We tried It on onrown

farm hit 1'. “new 7 1-2dfiliohyfi gullpnrticulirs howai’o

grownnd humpingorlen .or pneum-

olo. to: 1 Inglootrld. Woshonnmlb. axiom.

or 1 lb. each or o “I. {WRITE US.‘





Minimum.” tu'flEMJOWA





Hodges Potato

ORTER

will pay for itself in a few

days work. Furnished with

three screen: of different

also meshes. It folda_up





BUFFALO. N. Y.





 





The truth won't hurt any of us, but

in this accusation the facts indicate

that it is just the other way around—

many farmers are not “lazy” enough.

For example, a man walks ten miles

in plowing an acre of land with a 12-





inch bottom, and his two acres a day ~ ‘Nr

compel him to "hoof it” nearly twenty ' LeSS Ork





 





   

   

 

 

 





 





 





 





Ingest betwefm daylight and dark Less Fuel, Better Cooking 3?; afibfixglyfiv‘jfifi‘félfi‘i

Equipped with 0 so very many years ago a farm- Banish kitchen drudgery. Do. . 318,333; “$5..“2’63322;



or seen riding a plow was regarded your work in half the time with - Pwd . agingstgixr moneyreiuntb



by his neighbors with mild contempt. haltthe elfort. Give your cooking Julia-191* W~ 3- #000355





They called him “lazy” and a “sissy” Ski" the 695‘ OPPOMN‘Y to Pro” Nfl'nudnn' Mid”





and kept on walking, as their fathers itself. The





       





 





 





‘1‘} .

‘ had done before them. Monarch

1 _ , ‘ . ' It is no longer a. disgrace to ride a - ' IDEALGARDEN (201-13310N

_ we PAY THE FREIGHT. corn cultivator, and high-pressure ma- Malleable Range well: TRIIEfiIEVWE-u slim: Pal; $3331“

THE GUARANTEE chlnery is gradually making a differ- Lirttlléglogq‘fgmg (188$; Emisigjfl: “chairman-M mammals; gag: 01:31:33..

. - . ent ro osition o farmin f m w . , ' the: . The reach. 1 - um calculus. I hpp'st.

lee and Fefhhzef Spreader p .p . ‘ f g r0 hat ' fggrgi‘?:dm:fi:gfomtllegglleg‘laliin'nnd nightm.y;dm4: ream beauties-s

it was in ear11e1 days. Still, there is a ._ iotleu. ertohodnyforour free eels-l e.

The Spreader that Spreads Evenly under steel. 1: has complete triple wall: nmm nos. awn“ Mm Dmvllh. _,_

TH]: aumAthllcughdllgghn has shifting tendency on mOSt farms to work too- - “bum? kind “we" an: “lifvgnduoumm " ‘ ' ‘ ‘

clutch thotoon be thrown: and out or gear. hard with the muscles and to neglect $9.233 aims—“no a: '0; 8.0% Bu





.C I . m.

The Guarantee Mfg o ’M' - one reason why many farmers fail to m 2°;5’mngfismflmfim'fi‘an...mm ' t .h

realize big success. With mistaken full explained in out “'0 free 5003' $flfig’hfluwm‘f





. No 1 us postal ml Address p16, “a prices.

A 0 economy or through excesswe zeal Malleoblo It” Ran e co"

POT T . . g. m





nonunion- can be made from seat. Accurate , , - D ‘8 kg We out can you

i . to loosen and fallout. The up 1 to _



acre mnrkfblnldgatog. oiome=|in§thlild B. . the Clllth8thn“ of that 11108:. valuable and Hot Blast Fl 80‘ l u e M mime? :nénffimng‘

" "°° ii ' property, the upper forty. This is and full use of all the fuel. The polished $33..“ng “1...“; on





when there in nl o





Michigan’s Standard Sir Walter Raleigh. they labor early and late at severe 731 14.30% [L lflllld‘h.

1 Pure and well grown.” cents bushel. tasks and save no energy to think or an“ lldgl, Iich.





OAT SEED togllxlaxlvlatlllergy may be expressed in





Worth ——Our own seed, $1 bu. Member dlflerent ways—it is all out of the

ichigan Experiment Asso. same storage battery—it may be used

H- 3- SAI‘LR' Lan’lnfi- Michm‘m' to propel the body or it may be used is: n





to create ideas.

KUMONG APRUNS 590 We grow by exercise. An arm tied





, up in a sling for a year shrivels and . . .7 ..

Msdeoi the bestqnahty heavy becomes useless. Used constantly it are the two man manna Silos on this





 





 





 





fingAlEREED OATS





. nder and other-varieties. Brod

and tested by tho ’Aarloultunl College. Best

of hundreds of var-lotio- teated. Grown in

Michigan and adopted to Micki an condltlo .



Al's; molten; varieties of Mid)!” G.



an 0 or . to



sm Clover soeafwi. to "" "'

SECRETARY HIOHIGAN EXPT ABB'R.

Bolt Lansinu. Michigan.





     

 





   

 





     





A first Aid to Prosperity .





 

   

 





     

 





fine Now





 





 





) r' l {5 a s stri )es and . ,

his? 23‘», .r the: llglit or dgr‘l’rdshadosf in all develops muscles capable of perform- fixfia‘enme'rmfg‘g:gfihzegamfgflgg‘gfig‘: ‘ ‘ H .

illogigge? ion} lenglliteec‘glgmd .flt‘m’. 1116’ heavy tasks. When the mind is, glycin-mefitsmdvefiedflahalgfigtquzlggm SllaWhelly Plants Thal 6"”

~ ...i v ' . . . 7 . .gr'enerconven co 0 u .

“flied Pal-bio; g . $?amsALEs 00., exerCISed It grows also, bUt When it IS silage prime. New camlozahowsconstruction in de- £411“th beefinnofilnd Egg-bong!“ "mousse Also

-. A I ' tail. Send fora copy today and learn how a Unudllla as my. no try. urn-ant on rape

Box 839. Detroit. Michigan neglected, it weakens the reason and Wm bring mater mommy m you t . my Pallfilflm' “41mm“, mm “mm.





 





warps the judgment. A nervous SYS- count on early orders. Agent: wanted everywhere. wondeml fig: “Semwhlflf’gggfbfigffigoffigx

tem does not produce clear thinking. “AW-u 5"” co..liox z. "“‘m" N" Y“ altf‘i‘flltfifiiifiufimizi‘h. Bridtllnmhflch.

By watching the average farmer one _



' - oeaouslbel.1 .A u,

‘? ‘ed ‘9 .bel‘eve that he is the 01’1” THE BOKOP HARROW Swayhuhazn'iwassafsflafssf

Site of bemg “lazy” and that he might ' um THIS IS THE Write formula-naps». n. o. Even-.8. tron-doom 0.

better save some of his precious lite TOOTH THAT DOES





 





 





 

 

 

 

 





7 ble mad B t ith hi h t h (1 THE BUSINESS A filvfigfisnfltyn 0:“Whltlo) maxim"?! SWEg':

l ._ t. ‘05! dun e. as": r e w W r n n . E15 1 r u. up o—onrequ _

”5,3255% '3;- DOIIN-E. GALVANIZED- on r n c 0 u t e y amo out §h£m$¥ 321%: gig? 3:13.35 '1'. c. MoCULLAGH. broonuwntnko. Michlton.





 





Cm: ov-J qualityd puns uni odxu of his mind.





. . . Pull the Wide, Upper Face gives Cul-

l7 But-m Pneu-Dflnipfmh Muscle is necessary on the farm—





Eithor tivator Action. For Blaming Cut. and all small fruits.

somebodfs muscle—but it is not the w” “finggfilgg 33m? Straggm Plaegitnl‘ngfisgfo: E333:

element which alone wins the big and of am. you have always wanted. - We guarantee ulou' lonts.

prizes; it is the quality of brains a 31%“ “WUST'NG—NOL‘V‘RS'ALL 5““ Balfofoknllfifingmfmmfifi. 13;?th ~

' man puts into his business that makes . mum" N‘m’” °°-~ 3“ 9‘ mum... Mich-

him rich or poor. : ,- , mammal Gmnpripo



The man who works with his hands ' ‘ {I/ mgkgmfl’fifl’f‘flfifgmmfifi'g;

alone, reaps the reward of the labor- c I 3 Maim‘m" mm. 600

er. All the men in the world who ev‘ 3’0_ lngrnggi. hub“ Nrbumfincimlgded.

er rose to distinction in any calling 4—-—r

were capable of wisely directing the

_ . work of their own hands, and the for-

Wnri‘r: ”on OUR FREE BOOK tunes have been made by men who





“Secret (“3' Rigger Farm PrOfitS" knew how to direct the labor of other _ -------- .





We uni-ante. :ry rod of fence. Will Ihlp direct.

Dropai'd. wl'” H xnave no dealer. men’s hands.





 

 





   





 





 





 





 





 





 





 

 





 





,’.. 'r. . -





 





SEE. CATS—G‘m" No. 5-"Tho Grout Corn

8. :10!“ Oat-5| Hrlyioldod m harps:

m. “w my a ', no d“. [‘13. IV.

thin hull Boole-nod tree from II t. 8. net'.

n. s. cnmmmx. Corgi. maimf





FOR SALE-fifil‘iiel’ifi’hffié‘msfi’





LUCY O'HARROW, Clarksvllle. Mlchllan.





.3» .7





 





 





’ There will NEVER be enough unny'





 





   

 





 





 





 

 





Choice. select. northern grown under in: rovod

conditions. thoroughly spra ed and free from d8 soups





MlCfi‘iiaiziiil WlRE FENCE C0., It is a matter 0f choice. If you are be: “nappies—ALWAYS too many

10 Logan Simu’ Adrian. HIohInn ' l i cider . Do 't t t‘ —0armo No. a round, white.

1 . . satlSfied to make a bare 1 V ng by and yodftprlefs growling‘l'lffsegolglgdggf seed Pctatoes late varinety. hagdy and productive.





D5312; f BUY until you gotta“:- faotory farming it can be done under favor- Use “Scaleclde” theone Sure Iprayfor





 

 

 





San Jose scale. and produce number





 

 





"'09“ 0“ “sequin” “d able conditions by long and hard plug-





 

 

 





 





 





 

   





- one fruit. "Scalccidc" is loo eflii ut Shipped in sax. 600 per bu. . 0. B. Beulah. om

fill): Pdsl‘oeallvyw :évgnic‘gd' (5333;331:314; l. fi (1 0th alnst 553": and 1‘35 markZd “11:21 price on lam Iota. JO! Boboumn. “All. glob.

tent} ' 0 per rod 41-inch lax-m fence 210 ging- If you are not SEL ‘13 9 W1 a is“dip-opelréles. Usegb besfiogchgrd.

' ' " ' - - ‘ cw over, . ’ .

135‘s“ fiiniirfi“?f.’§i3°ofii‘o‘épfiii§$ mere subSIStence and (heme larger re- , 3mm: gems. oft. Sénv‘lcé SEED CORN-giganYollow Dent. home

1.4:} Write for free catalog. suits, you must use your thinkery, lgfikTMENTvgug-tneiimgvgglgg Go! F] and . 8' lull BelmontMO Wand





 





{0. new bookm_upnn-, Hand. forunplo and circular. F.A.Bywotor.flonphll.lich.

book for Fruit Growers" and "Scale- ' '

cide the Tree Saver." Bot free.



3. G. PRATT GORP



u Ohmi- m In York Oitv





T“'~‘_.Tl(_‘.E.R FENFE COMPANY’ first in learning all you can about





{ your own trade, and then to employ

such wise judgment that every lick

which you and your helpers make will





count.





Brains and brawn are both needed Government Farmers Wanted:“ “21%;: M lik“§3f§,%f§°“?fil°“£ ms?

011 the farm but not muscle that steals monthly. thto. 08KB“, 1'1 I'. St. Louis. Mo. Samples Pin 0. H. XOR . Ellington. Mich.





from the mind. Exhausted bodies

bring dull minds. Success is built on .



wise management and wise manage- WE OFFER MUNICIPAL BONDS, 6%

metn is not supplied from listless bod- MANY ISSUES TAX FREE, YIELDING 4% To



ies and discouraged minds, but by All paid lrom taxes-by coupons collectable throunh any bank.





FARM FENGE equanimity and by working deliberate- migwmduuiymm evczebond-e o‘u' ma hm apnea no time and m to mkemoftheir

1y Without 10“ monons' FAR SAFER THAN moms PLACES AND BANK VAULrs -





   





 





   

 





' —GmtD o it! d

PM?“ 0318 on: 100': do Soy

”1:31:13 03:11.: po‘r bushel“) Gold: fleece oregocend

91' noted I Boolean! on

bio. h‘o.‘ W. '3. MERRIAooI. Amt. Rich.





 





 





 





 





 





 





{y





. . .

«ca-—





 





 





 





 





 





l

J





\\ \\\\|II





..

go





 





 





 





 





41 "I





 





 





 





 





 





 





 

 





 





 





 





 





can. mou Poo .

Stay-mireinm-pu't- IIddifimboyidfig-nemelmtandeauhincm. “flammdunumfity

33153: gins-3‘3fligg'uig z I 653.115) Sgéiplverfitgtrtergggeséhtge :grtgg iano-ul Sun" Dan-h why mtnnil moor of this mty’ and um.‘ They no in ma. $500 and

'izg‘mht‘zztffifi'lgfilfi’fi CENTS cheap and so things of course. that in ‘lwwdffittzfi‘d‘hmh'rx Wm '

gfiggficafidr'g‘g ‘ mm the infinite riches of the soul it is like mm w“ M W 7

rmrodspooLCathsfreev gathering a few pebbles Off the BOND DBPARTM-BNT,





. :Wmmmmu ground, or. bottling a little air in a



I l - 8H Industmm Sinfle I“ "n“ pliiall, when thle whole earth anld3 the

. abet . , w o e a mosp ere are ours.— mer-



...2.'..'%.. .. Wigam: as 6..., , . .





THE NEW FIRST NATIONAL BANK, COLUMBUS,O.¥
‘ A.» ~





, mummy". .iivavi’:;(' my 1 4.4:





In Wu»... «n ,2 4;... guns: '





O





MARCH 13, 1915.





‘Jll





THE MICHIGAN FARMER





IllllllllllllllIIlllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllll|llll|llllll|llllllllllllIlllllllllllllllIllIllllllllllllllllllllllllllllllllllllllllll|IlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllE





Winston Of the Prairie-





BY HAROLD BINDLOSS.





 





Copyrighted by Frederick A. Stokes Company.





Ill|illlllllllllIllllllIllIllllllllllllllllllllllllL





"I





i!





CHAPTER XXIII.



Then Winston recognized. them, and

made a sign to one of the men behind

him as he hauled his binder clear of

the wheat. He had dismounted in an-

other minute, and came towards them,

with the jacket he had not wholly

succeeded in struggling into, loose

about his shoulders.



“It is almost time I gave my team a

rest,” he said. “Will you come with

me to the house?” _



“No,” said Colonel Barrington. “We

only stopped in passing. The crop

will harvest well.”



“Yes,” said Winston, turning with

a little smile to Miss Barrington. “Bet-

ter than I expected, and prices are

still moving up. You will remember,

madam, who it was wished me good

fortune. It has undeniably come!”



“Then,” said the whitebaired lady,

“next year I will do as much again,

though it will be a little unnecessary,

because you have my good wishes all

the time. Still, you are too prosaic

to fancy they can have anything to do

with—this.”



She pointed to the .wheat, but,

though Winston smiled again, there

was a curious expression in his face

as he glanced at her niece.



“I certainly do, and your good-will

has made a greater difference than





you realize to me,” he said.

Miss Barrington looked at him

steadily. “Lance,” she said, “there is





something about your speeches that

occasionally puzzles me. Now, of

course, that was the only rejoinder

you could inake, but I fancied you

meant it.”



“I did,” said Winston, with a trace

of grimmess in his smile. “Still, isn’t

it better to tell anyone too little rath-

er than too much?”



“Well,” said Miss Barrington, “you





.are geing to be franker with me by





‘ and by.





Now, my brother has been

endeavoring to convince us that you





.owe your success to qualities inherit-

' ed from bygone Courthornes.”





\Vinston did not anSWer for a mo-

ment, and then he laughed. “I fancy





. Colonel Barrington is wrong,” he said.

' “Don’t you think there are latent ca-





 





pabilities in every man, though only

one here and there gets an opportuni-

ty of using .them? In any case, would

it not be pleasanter for anyone to feel

that his virtues were his own and not

those of his family?”



Miss. Barrington’s eyes twinkled, but

she shook her head. “That,” she said,

“would be distinctly wrong of him,

but I fancy it is time we were get-

ting on.”



In another few minutes Colonel Bar-

rington took up the reins, and as they

drove slowly past the wheat, his niece

had another view of the toiling teams.

They were moving tirelessly with their

leader in front of them, and the rasp





 





 





 





Taking a Priyate tiles-30in.





Illllllllllllllll|llllllllIllllllllllllll|lllllllllllllllllllllllllllllllllllllllllllllllllllllllllll||l|||llllllllllHHllliHIIllllllllllllllHIIINHIIHIHIIlllllllllllllllllllllllllIlllllllllllllllllllllllIllllllllllllllllllllllINIIIIHHIIHIIIIHIE





' ' oflicer.





Illlllli]IllllllllllIllll:llllllllllllllllllllll





of the knives, trample of hoofs, and

leash of the binders’ wooden arms

once more stirred her. She had heard

these sounds often before, and attach-

ed no significance to them, but now

she knew a little of the stress and ef-

fort that preceded them, she could

hear through the turmoil the exultant

note of victory.



Then the wagon rolled more slowly

up the rise, and had passed from view

behind it, when a mounted man rode

up to Winston with an envelope in his

hand.



“Mr. MacDonald was in at the set—

tlement and the telegraph clerk gave

it to him,” he said. “He told me to

come along with it.”



Winston opened the message, and

his face grew grim as he read, “Send

me five hundred dollars. Urgent.”



Then he thrust it into his pocket,

and went on‘with his harvesting when

he had thanked the man. He also

worked until dusk was creeping up

across the’prairie before be concerned

himself further about the affair, and

then the note he wrote was laconic.



“Enclosed you will find fifty dollars,

sent only because you may be ill. In

case of necessity you can forward

your doctor’s or hotel bills,” it can.



It was with a wry smile he watched

a man ride off towards the settlement

with it. “I shall not be sorry when

the climax comes,” he said. “The

strain is telling.”



In the meanwhile Sergeant Stimson

had been quietly renewing his ac-

quaintance with certain ranchers and

herders of sheep scattered across the

Albertan prairie some six hundred

miles away. They found him more

communicative and cordial than he

used to be, and with one or two he

unbent so far as, in the face of regu-

lations, to refresh himself with whis-

key which had contributed nothing to

the Canadian revenue. Now the lone-

ly ranchers have as a rule few oppor-

tunities of friendly talk with anybody,

and as they responded to the ser-

geant’s geniality, he became acquaint-

ed with a good many facts, some of

which confirmed certain vague sus-

picions of his, though others astonish-

ed him. In consequence of this he

rode out one night with two or three

troopers of a Western squadron.



His apparent business was some-

what prosaic. Musquash, the Black-

feet, in New of remaining quietly on

his reserve, had in a state of inebria-

tion reverted to the primitive customs

of his race, and taking the trail, not

only annexed some of his white neigh-

bors’ ponies and badly frightened

their wives, but drove off a steer with

which he feasted his people. The

owner following came upon the hide,

and Musquash, seeing it was too late

to remove the brand from it, express-

ed his contrition, and pleaded in ex-

tenuation that he was rather worthy

of sympathy than blame, because he

would never have laid hands on what

was not his had not a white man sold

him deleterious liquor. As no white

man is allowed to supply an Indian

with alcohol in any form, the wardens l

of the prairie took a somewhat similar

view of the case, and Stimson was,

from motives which he did not men-

tion especially anxious to get his grip

upon the other offender.



The night when they rode out was

very dark, and they spent half of it

beneath a birch bluff, seeing nothing

whatever, only hearing a coyote how].

It almost appeared there was some-

thing wrong with the information sup—

plied them respecting the probable

running of another load offprohibited

whisky, and towards morning Stimson





'rode up to the young commissioned .





Ill/ll!!(ll"T.--‘~T _ ‘





 





 





 





15—327





 





Fabric is as important as

rubber in tires





EQUALLY important with the quality of rubber, is

the strength and endurance required in the fabric

binding. the rubber into an enduring tire. The fabric

used in Ajax Tires is made of Sea Island lon staple yarn,

the finest yarn obtainable. It is one of the actors which

makes possible the Ajax written guarantee of 5000 miles.





Your own interests are best served by deciding now upon

Ajax Tires. The implied life of other standard make tires is





3500 miles, and. Ajax are

”@ X therefore better tires by 1500

TEIES





miles, or 43%. V’Vhy buy

G u a r a n t e e (1





short mileage and pile up

in writing





further tire expense for your-





self, when you can save from

M I L E S





$4 to $20, according to the

wheel size you use. in exer-

cising your right to have Ajax

Tires?

”PI/hilt other: are (laimfn;

Quality we are guaranteeing it."





Investigate Ajax Tires!

Know for yourself how much

better they are. See the

Ajax dealer who is close at

hand. Write for HThe Story

of Ajax Tires.”





AJAX-GRIEB RUBBER COMPANY

1796 Broadway, New York





BRANCHES: Atlanta, Boston, Brooklyn, Chicago, Clowtlano', Dalia),



Drnrutr, Dies Moinu, Detroit, Indiamzpolir, Kama: City, Mo., Alum:-



apolit, Philadtlp/zia, Seattle, Portland, Ore., La! Ange/u, San Francuto.

Factories: Trenton, N. I.





 





 





 





 





 





Tougher than any black

rubber footwear ever built—these

great brown boots and shoes





Goodrich “HIPRESS”





Rubber Footwear

with the “Red-Line" ’round the top



Built like a Goodrich Tire—of the same tough rubber—and by the same

unit construction, “HIPRESS” process. .

Longest, strongest wear, perfect foot comfort—and the finest lookmg rub-

ber footwear you ever owned. .

ASk your dealer for the rubber footwear with the “Red-Line. " If he hasn't

it yet, send his name when you write for the booklet of many styles.



The B. F. Goodrich Company, Factories: Akron, Ohio



Makers of Goodrich

Tires and Ever thing

that’s Best in fiabbcr





7





Dealers: Get complete par. .

ticulurs today. from the near- .

est of these Goodrich “Hi-

press" Service Stations—

Boston, New York, De-

trmt. Chicago. Minne-

apolis. Kansas City.

‘~ Seattle. Akron.





II





I!





I





 





 





 





 





 





 





 





 





The Most Serviceable and





Economical Dresses You Could Buy





Can be obtained from your local dealer by asking

him to show you





THE Electric BRAND

HOUSE DRESSES

For your kitchen, your parlor or street wear there is nothing





more dainty or dutiful, and their cost of H to $3 places

them within reach of all.





Demand them by name and insist upon seeing the label

to insure yourself of securing dresses of guaranteed quality.

latest style and perfect fit. ‘-





. If your dealer does not handle them, i

- dropvus a postal and we millgive you

. ‘ the name of the nearest Merchant.

BARMON BROTHERS comm? Inc.

' BUFFALO, N. Y. '





 





 





 





 





 





 





 





_....._.._
Quality.





Eompare

Prices.





HE old Olympic Game pro-

motors were great for what

we call “form.”



Symmetry, proportion, soundness

and proper balance out-bid bulging

muscles for favor—yes, and out-won,

too, just as they will today.



Mere bulk never was synonymous

with endurance—and the truth of this

statement drives home with a bang,

when you apply it to tires.





 

 





Q C Q

0.. 0.0 0..





last word in tire construction,

we could wipe out of existence

a Goodrich Research and Test Depart-

ment employing seventy people. We

would take off the road a battalion of ten

automobiles, that run twenty—four hours

a day and every day in the year, grind-

ing tires cfall makes to pieces, just for the

sake of information to us and eventual

economy to the user of Goodrich Tires.

There is where we learn to cut out

of a tire the material which gets the

user nothing.

Of course, when we stripped tire





IF thick, heavy tires were the





The GoodrichTire, '

like the trained

athlete, is all

brawn and muscle

—-no fat





 





0:0





O

0.0





d-





T was their only “come-back."



They had to say that, in strip-



ping down prices to the point



where they were fair to dealer and con-



sumer and left no room for injurious



price-cutting tactics, we had stripped

our tires of some quality, too.





0'. 9:0 0:.

HE Goodrich Tire, like the

trained athlete, is all brawn

and muscle—no fat. It repre-

Sents an achievement—the ability to cut





out the extra costs of manufacture, the ‘





extra costs of labor, of extra, needless

material, and to give you the best, long-

rnileage, high-standard tire in the world.



There are padded tires as well as

padded price lists.



Don’t pay for padding.



Now don’t forget this—we are talk-

ing in the main about Goodrich Safety

Tread Tires, for they represent ninety

per cent of our factory output for resale.



Furthermore, while we have put

the padded prices on smooth tread tires

on the run, the evil of padded prices

on non-skid tires still is in evidence, as





THE MICHIGAN‘FARM'E’R





 

   





price lists of their dpadding—fictitious shown In table below:





values—we expecte rivals to say we

had stripped our tires.





 





Note the following tableof comparative prices

on non-akid tires. Columns headed “A,” "B," “C”

and “D" represent four highly-advertised tires:





 





 





 





 





 





 





 





 





 





 





 





W OTHER MAKES

Size Safety

Tread “A” “B” “C” “D"



P3013 B 9.45 $10.55 $10.95 $16.35 $18.10



30! 3% 12.20 13.35 14.20 21.70 23.60



32 x 3% 14.00 15.40 16.30 22.85 25.30



34x4 20.35 22.30 23.80 31.15 33.55



36x4% 28.70 32.15 33.60 41.35 41.40

37 x 5 33.90 39.80 41.80 49.85 52.05 is the NI by

which all other





 





Famous

Goodrich Safety Trad lea-skids are judged

The B. F. Goodrich Co., Akron, 0.





TIRES





o

A rainy day

need not be dull and forlorn.

You can make it just

chock full of cheerful

work if you wear the

FISH BRAND





REFLEX

SLICKER.





IL .—

X’fsmk Dressy? Note hit. Just

a coat for good hard

service, easy fitting, light,

and walerproof— absolutely. Reflex Edges

stop every drop from running in at the front.





$3.00 EVERYWHERE

Black. Yellow or Olive Khaki. Protector Hot 75 cu.





Satisfaction Guaranteed «WERE





Sadie: tree booklet a“:





A. J. TOWE .

BOSTONR cone WW





WHITE CEDAR FENCE Poms-Will's:





Cedar lenoe Posts. 7 ft... 8 ft" and 10 ft... Ian 8

Special attention given to farmer club orders. rite

for prices and terms. F. G. COWLEY. Olcoda. Mich_





and Win a. Prize





Here are seven sheep in a pen. By draw-

ing three straight lines you can put each one in

a pen by himself. If you can do this we will

send you as a prize, a packet of five beautifufly

embossed postcards Iithographed in rich colors,

and also a certificate of entry in our grand con-

test for a $95 Saxon Automobile. All you have it;

do in to enclose two penniel in your letter to pay

postage and coat of mailing.





Saxon Car Given Away





Remember the Saxon carlwill absolutely ,be given

away at the close of this grand content. In cue of

a tia-aSnoncar will henna to each person to

tied. , Send your answer at once so you can be catc-

, ed all. this great content. Full particulars by return

or





' ' ' co..normnu.. amt...





If you are charged less for any other make

than Goodrich, they are taking it out of the tire; if

you are charged more, they are taking it out ol‘you.





GOODRICH Fair-Listed





The White Basket ‘\\





That secures hi best

Ila-“‘98 for your ruit.

'rite for 19.5 catalog

, showing ourcompleteline

and secure your baskets

and crates a INTER

DISCOUNTS.





The Borlln Fruit Bu co.

Ierlln Heights. Ohio.





 





 





 





 





 





 





The "Berlin

Quart"





 





 





 

 

 





 





 





Hastings. Mich., Feb. 23rd. 191-5.





NOTICE.





TO THE MEMBERS AND POLICY HOLDERS 08'

THE MIOHIGAN MUTUAL. TORNADO~ 0Y-

0LUNE& WINDSTORM INSURANCE COMPANY,



2 OF HASTINGS. MICHIGAN.



Notice is hereby given that there will be a special

meetln of the members of said company held at

Git! H.511, in “19 Olly of Hastings, Michigan. on the

3”“! day 0I March. _A. D. 1915. at 1 o'clock. P, M.. for o

the purpose of voting unon a. resolution to extend

the corporate existence of said company for a par-ind

of thirty years from the 7th day of April A. D. 1915,

and it said corporate existence is extended. then also

it" ”19 purpose or 988N118 upon proposed amendments

to the Articles of Assoclntmn of mud corn .my. By

order of Board of Directors. D. W. R0 ERB, Sec.





 





 

 





 





 





I, Robes at $3.50 each





14.». We We WEAVER,

Reading, Mich.





Solve This Puzzle





.1’ ,

’l





/





 





47’





 





 





 





 





'Mancnm. 1915.





“The man who brought as word has deal more serious than whisky-run-

elther played their usual trick and nlng. One night a man crawled up to

sent us here while his friends take the your homestead through the snow, and

other trail, or somebody saw usrlde you took him in.”

out and went south to tell the boys,” He saw the sudden fear in his com-

he said. “Now, you might consider it panion’s face before he turned it from

advisable that I and one of the troop the lantern.

ers should head for the ford at Willow “It has happened quite a few

Hollow, sir.” times,” said the latter. “We don’t



“Yes,” said the young oflicer, who turn any stranger out in this country.”

was quite aware that there were as “Of course,” said the Sergeant

yet many things connected with his gravely, though he felt a. little thrill of

duties he did not know. “Now I come content as he saw the shot he had

to think of it, Sergeant, I do. We’ll been by no means sure of, had told.

give you two hours, and then, if you "That man, however, had lost his

don’t turn up, ride over after you; it’s horse in the river, and it was the one

condemnably shivery waiting for noth- he got from you that took him out of

ing here.” the country. Now if we could show



Stimson saluted and shook his brid- you knew what he had done, it might

le, and rather less than an hour later 80 as far as hanging somebody.”

faintly discerned a rattle of wheels The man was evidently not a con-

that rose from a' long Way across the firmed law breaker, but merely one of

prairie, Then he used the spur, and the small farmers who were willing to

by and by it became evident that the pick up a few dollars by assisting the

drumming of their horses’ feet had whisky-runners now and then, and he

carried far, for, though the rattle grew abandoned all resistance.



a little louder, there was no doubt “Sergeant.” he said. “it was ’most





that whoever drove the wagon had no a. week before I knew, and if 3113’de





horses cannot haul a vehicle over a. ed him out to freeze before I'd have





rutted trail as fast as one can carry let him have a horse 0f mine.”



a man, and when the wardens of the “That wouldn’t go very far if we

prairie raced towards the black wall brought the charge against you,” said

of birches that rose higher in front of Stimson grimly. “If you’d sent us

them, the sound of Wheels seemed word when you did know, we’d have

very near. It, however, ceased sud- had him.” .



denly, and was followed by a. drum- “Well,” said the man, “he was





ming that could have been made by across the frontier by that time, and

a galloping horse. I don’t know that most folks would





“one beast,” said the Sergeant. Pave done it, if they,d had- the wam‘





“Well, they’d have two men, anyway, mg the boys sent me.”



in that wagon. Get down and picket. Stimson. appeared to consider for al-

We’ll find the other fellow somewhere mOSt ?' mlnute, and then gracely rap-

in the bluff.” ped hls companion’s arm.



They came upon him within five “It seems to me that the sooner you

minutes endeavoring to cut loose the and.I have an understanding, the bet-

remaining horse from the entangled ter 1t W111 be for you,” he said.

harness in such desperate haste that They were some time arr1ving at it'

he did not hear them until Stimson and the Sergeant’s superiors might not

grasped his shoulder. have been pleased with all he prom-



“Hold out your hands,” he said. 1sed during the discussion. Still, be

“You have your carbine ready, troop-was,flying at higher game, and had to

er?” sacrifice a little, while he knew his





The man made no resistance, and man.





Stimson laughed when the handcuffs Well fix it up WithOUt you, as far

as we can, but if we want you to give





were 011- evidence th t th h l h'

“Now,” he said, “Where’s your part- - a e man W 0 cm ls

ner?" horse in the river was not farmer





Winston, we’ll know where to find

you,” he said. “You’ll have to take

your chance of being tried with him

if we find you’re trying to get out of

the country.”



It was half an hour later when the

rest of the troopers arrived and Stim-

son had some talklwith their officer





“I don’t know that I mind telling

you,” said the prisoner. “It was a

low down trick he played on me. We

got down to take out the horses when

we saw we couldn’t get away from

you, and I’d a blanket girthed round

the best of them, when he said he’d

hold the other. Well, I let him, and



. aside.

the first thing I knew he was off at a “A little out of the usual course

gallop, leaving me with the other isn’t it?” said the latter “I don’t

kicking devil two men couldn’t han- know that I’d have count'en .

, . . . anced 1t,

dle. You 11 find h1m rustling south ov- so to speak, off my own bat at all, but





eruthe Montana t.ra11.,’,’ _ . I had a tolerably plain- hint that you

Mount. and ride! . sald Stimson, were to use your own discretion over

and when 1115 companl9n galloped Off: this affair. After all, one has to

turned once more to his prisoner. stretch a point or two occasionally.”

“You’ll have a lantern somewhere, “Yes, sir,” said Stimson. “A good

and I’d like a look at you,” he said. many now and then.”

“If you’re “1,9 man I expect, I’m glad The officer smiled at little and went

I found-you.’ . back to the rest. “Two of you will

‘_‘It’S 111 the wagon,” sand the other ride after the other rascal,” he said.

delectedly. “Now, look here, my man, the first

Stimson got a light, and when be time my troopers, who’ll call round

had released and picketed the plung- quite frequently, don’t find you about

ing horse, held it so that he could see your homestead, you’ll land yourself

his prisoner. Then he nodded With in a tolerably serious difficulty. In

evident contentment. the meanwhile, I’m sorry we can’t

"You may as well sit down. We’ve bring a. charge of whisky-running

got to have a talk.” against you, but another time be care

“Well," said the other, “I’d help ful who you hire your wagon to.”

you catch Harmon if I could, bl“? I Then there was a rapid drumming

can prove he hired me to drive him of boots as two troopers went off at a

over to Kemp’s in the wagon, and gallop, while, when the rest turned





 





CHAPTER XXIV.

The Revelation.





you’d find it difficult to show I knew back towards the outpost Stimson

what there was in the packages he rode with them quietly content.

took along.”

Stimson smiled dryly. “Still,” he

said, “I think it could be done, and

I’ve another count against you. You INSTON’S harvesting prosper-

had one or two deals with the boys W ed as his sowing had done.

some little while ago.” for by day the bright sun-

, “-I’m not afraid of your fixing up shine shone down on standing wheat

against me anything I‘did. then." said and lengthening rows of sheaves. It

the other-amen. _ » ' I, , _- was-in the bracing cold of sunrise the

; “No?” said ‘St son. “Now, [guess work began. and the first pale stars





 





you’re wrong, and it night boa great were out before the tired men, and
MARCH 13, 1915.





jaded horses dragged themselves

home again. Not infrequently it hap-

pened that the men Wore out the

teams and machines, but there was no

steppage then, for fresh horses were

led out from the corral or a. new bind-

er was ready. Every minute was

worth a dollar, and Winston, who had

apparently foreseen and provided for

everything, Wasted none.





Then, for wheat is seldom stacked

in that country, as the days grew

shorter and the evenings cool, the

smoke of the big thresher streaked

the harvest field, and the wagons went

jolting between humming separator

and granary, until the latter was gorg-

ed to repletion and the wheat was

stored within a willow framing be-

neath the chaff and straw that stream-

ed from the chute of the great ma-

chine. Winston had around him the

best men that dollars could hire, and

toiled tirelessly with the grimy host

in'the whirling dust of the thresher

and amid the sheaves, wherever an-

other pair of hands, or the quick de-

cision that would save an hour’s de-

lay, was needed most.



As compared with the practice of

insular Britain, there were not half

enough of them, but wages are high

in that country, and the crew of the

thresher paid by the bushel, while the

rest had long worked for their own

hand on the level of Manitoba and in

the bush of Ontario, and knew that

the sooner their toil was over the

sooner they would go home again with

well-lined pockets. So, generously fed,

splendid human muscle kept pace with

clinking steel under a stress that is

seldom borne outside the sun-bleached

prairie at harvest time, and Winston

forgot everything save the constant

need for the utmost effort of body and

brain. It was even of little import to

him that prices moved steadily up‘

ward as he toiled.



At last it was finished, and only

knee-high stubble covered his land

and that of Maud Barrington, while,

for he was one who could venture

fearlessly and still know when he had

risked enough, soon after it was

threshed out the wheat was sold. The

harvesters went home with enough to

maintain them through the Winter,

and Winston, who spent two days

counting his gain, wrote asking Gra-

ham to send him an accountant from

Winnipeg. With him he Spent a cou-

ple more days, and then, with an ef-

fort he was never to forget, prepared

himself for the reckoning. It was time

to fling off the mask before the eyes

of all who had trusted him.





He had thought it over carefully,

and his first decision had been to

make the revelation to Colonel Bar-

rington alone. That, however, would,

he felt, be too simple, and his pride

rebelled against anything that would

stamp him as one who dare not face

the men he had deceived. One by one

they had tacitly offered him their

friendship and then their esteem, un~

til he knew that he was virtually lead-

er at Silverdale, and it seemed fitting

that he should admit the wrong he

had done them, and bear the obloquy,

before them all. For a while the

thought of Maud Barrington restrain-

ed him, and then he brushed that

aside. He had fancied with masculine

blindness that what he felt for her

had been well concealed, and that her

attitude to him could be no more than

kindly sympathy with one who was

endeavoring to atone for a discredit-

able past. Her anger and astonish-

ment would be hard to bear, but once

more his pride prompted him, and he

decided that she should at least see

he had the courage to face the results

of his wrong-doing. As it happened,





he was given an opportunity when he '





was invited to the harvest celebration

that was held each year at Silverdale.

(Continued next week).





‘It is only through labor and prayer- '

ful effort, by grim energy and reso- :





jA. J. Kilnsrm ems... Ludinflon so amt... Mich.





lut courage, that, we move on to bet-

tere-thingsa—Theodore Roosevelt.





 





THE MICHIGAN FARMER





ONE





back of every

©. J-M Automobile Accessory





.JOHNS'





ANVILLE +7

SERVICE





COVERS





THE CONTINENT .2.





 





 





factory, they will make good.





Third, you enjoy the advantage of buying from one of the largest distributors of

automobile accessories in the world; therefore you get in extra value what they





save in selling cost.





Jones Speedometer





Controlled by Centrifugal Force which is

as absolute as the law of gravitation. Not

atfected by age. use, changes in tempera.-

ture. altitude. vibration or electrical in.

fluences. Absolutely accurate at all times

and under all conditions. Lame clock-

faced dial with widely spaced figures

makes it easy to read from any part of

the car. Ford model $12. Other models

$12 to $125.





Model “J” Long Horn





A real warning signal with a powerful,

compelling warning note that is always

heard and invariably obeyed. Strongly

built to stand up under the hardest ser-

vice and to give maximum reliability.

Handsome in finish and in design. The

horn that insures safety and economy.

Made in models for electric as well as

odel “J” (illustrated).

Other Models. 85 to $12.50.





Carter Carburetor



Multiple-Jet Principle

Obedient to every change in engine

speed, insuring the utmost flexibility.

Vaporizes every atom of fuel completely,

insuring the utmost power and economy.

Purchase price will be immediately rc-

funded if after thirty days’ use you find

you are not getting the results repre-

sented. The Carter must make good.

Sizes for all cars. Special outfit for Ford

can at $17.00 complete.





J-M Non-Burn Brake Lining





With your brake drums lined with J-M

Non-Burn you are prepared for the im-

mediate stop that is sometimes the only

meansofavoiding disaster. You have the

satisfaction of knowing that your brakes

will work—instmdly. This thorough de-

pendability is built into every inch of

real J-M Non-Burn Brake Lining. Costs no

more than other linings and lasts longer.





J-M Dry Batteries





The most efficient and lasting batteries for all

Ignition purposes. Sold with the guarantee

that should they not prove entirely satisfac-

tory, we will replace same with new batteries

Without cost, or refund purchase price, in-

cluding transportation charges. Made in

three capacities, 20, 30 and 35 amperes, 1% volts

per cell. Choice of round or square shape, 25c.





 





hand operation . M

$5.00.





 





 





 





 





OTHER J-M AUTOMOBILE ACCESSORIES

J-M Automobile Tape .LM Fire Extinguisher “Noork ” Enclosed Fuses G-P Muffler Cut-Out





Sold direct on receipt of price if not at your hardware or accessory dealer’s. Write for booklets. 3003





H. W. JOHNS-MANVILLE CO.

302 Madison Avenue, New York City





Service Stations in all Large Cities





 





 





47 Branches





 





 





 





S an automobile owner and as a user of

automobile accessories you will surely

be interested in this announcement.





Now, for the first time, you are able to buy your accessories of one firm, with one

service and one guarantee. The benefits of buying in this way are threefold:





First, you have the reputation and financial stability of the H. W. Johns-Manville

Company as an assurance that the accessory you buy is a product of proven excellence. '





Second, you have their guarantee that should any J-M Accessory prove unsatis-





Firm i

SerVIce

Guarantee





J-M Non-Blinding Headlight Leno





Makes night driving safe. Enables you to

see the road clearly ahead and prevents

driver of approaching car from misjudg-

ing your position. l‘lll‘ect produced by

semi-spherical lens with entire surface

frosted except for small oval arca through

which central ray is seen against a sur-

rounding area of non-glaring light. For

all standard makes of lam ps. Price,

$3.25 per pair.





J ohns-Manville Shock Absorber





Extreme simpli'city of construction makes

it possible to offer this highly ctlicicnt

absorber at almost half the cost. of other

makes. Single cylinder. utilizing specially

designed spring, giVes greatly int-roused

flexibility and riding comfort with loss

added weight. Ensily attached to any car

in one hour. Per pair $15.





J-M Auto Clock





A high-grade timepiece, built towithstnnd

thejol ts and jars ot‘cur service. Eight-day

movement. enclosed in dust-proof casc.

Winding and setting knobs out of the way

ofmcddlinl.r lingers: attachingr screws cou—

ccaled. Dial 3% in. diameter. Finish, blnvk‘

andbrass, black-and-nickcl or all black:

choice of dashboard or flush mounting.

Price $5.00.





 





J-M .larco Tire and Top Repair

Materials





This line includes an efficient and lasting

repair for every tire trouble. as well as an

excellent preservative for automobile tops

-.l-M ’I‘irencw. J-M Narco ’l‘irc (fut Filler,

J-M Narco Rubber Reviver and Refinishcr.

J~MNarcoVulcanizinchmcnls,.l-I\l Nari-o

Cementlcss Patches, each the boot prod-

uct for its purpose. With one of the

J-M Narco Tire Repair Outllts you are cu-

ablcd to make home and roadside repairs

that will stand, and at a very slight cost.





J-M (Mezger) Soot-Proof Spark Plug





Gives the biggest, fattest, hottest spark your

current can deliver and will not short-circuit .

Gas-tight construction positively prevents

compression lcnkugc. Specially tcmpvn-d

porcelain standscxlrcme temperature change.-

without cracking. We guarantee the perform-

ance of every genuine J-M (Mezger) Soot-

Proof Spark Plug. Sizes for all cars and motors

cycles. Price 75 cents.





 





 





J-M Packing





 





 





 





 





One Man' 3 KIRSTIN ONE-MAN STUMP PULLERS have made a won‘

Pu"- Bis K\“mm"°§‘::‘M".i‘l°.°m“°"°§§£233?“333:3.1531‘3‘333333

STUMPS I .3 more speed. at ”friction of cost of other; Big stumps out“; 2 to 10 mln- . ’





one. The KIRS‘HN" ls gamut“ for life.





one- Chain or cable on

Live agents wanted.





Osmo- Inm- rest it . .

wru- mmm."m" fir'an'Wom





The KLI‘A‘LILII Free For A Month





Sold on month'l

(no out and com: to unit. Donn dilcrent nodal: tor Ill

- coodhl meat.





 

 





 





3 Garden Tools in 1

Th. BARKER gamlllchorand





«a The only garden tool that successfully. in one on-

. \\etation. MI]: wudr, and forms a complete m‘l

"=55. mulch to hold moisture. Best Weed Killer

Ever Used.“ A boy with a Barker beats

ten men with hoes. Has shovels for

deeper cultivation. Sell ad-

diusting. Costa little.

Write for (”mud folder

and nodal Fanny-trill"





00.





   





 

     

 

 

 





 

 

 

   





\
330-18





THE MICHIGAN FARMER





 





 





 





 





 





 





 





m





Wcman and Her Needs





MARCH 13. 1915.





 





 





 





 





At Home am) Elsewf) ere





 





 





 





 





 





 





 





 





3/3? 11





 





What’s the Matter [With Father?





Dining the past. few 1ea1s a cus-

tom seems to lpiave sprung up of chil-

dren calling their fathers “dad” or

“daddy.” The old familiar “mamma”

has given place. properly enough, to

the, more dignified name of mother:

but why should the correspondingly

dignified name of father he changed

to ignominious “dad‘.” It would be

amusing. if it were not deplorable, to

hear self—respecting matrons teaching

their little ones to master mother, but

in the next minute. saying daddy. A

few yeais ago a 101mg lady using that

expression 11 ould not ha1e been con-

sidered a. desirable member of polite

society. The name of dad may have

its place in the comic songs of the. 111

iiety stage but not in 11111 best homes.



\\ e must look to the mothe1s of the

land to 1est01e father to his proper

place in o1de1 that 11 e ma1go down

in histoxv as a nation of fathe1s and

not “dads.” \\ e can not let George

\\'ashing ton be known to posteiity as

the “dad of his country.’ ~’~Reade1.





EAR, ye mothers. One more job



for you. Somehow, somewhere



in the day’s routine, father has

got shunted from his proper place and

it is up to you to restore him to the

pedestal from which he has fallen.

Again the “mothers of the land are

looked to" to do' what the fathers

seem unable to perform.



If the rest of the mothers are. as

sick of being “looked to” as the par-

ticular mother who edits this column,

father will remain in his present 101v

state for "a time and times and half a

time.” We are “looked to” to keep

the children in perfect health. mental-

ly. physically and spiritually: to se-

lect and make their clothes: direct

their reading; pick out their friends;

decide upon their amusements: to

bathe them and curl them; inspect

their teeth and their eyes; get, tip

with them nights when they' are ba~

bies: wait upon them when they are

sick: correct them when they are

naughty and act as a compendium of

uni1e1sal knowgled e when the1 ha1e

questions to propound. They a1etuin

ed over to us completely for their up-

bringing, especially when there is any-

thing unpleasant or hard to do, and

the most we get for it is criticism be-

cause we do not do a better job.



In addition to the light task of car-

ing for them in the home, what are

we not “looked to” for outside? The

mothers of the country are looked to

to 1eform labor laws, to get justice for

women and children. to wipe out the

liquor traffic. to abolish the white

slave trade. to secure higher wages

for working women, to run the church

and the Sunday school, in short to

clean 11p conditions at home and

abroad. \\\\'hatever is right and just,

but hard to be done, the mothers of

the country are looked to to perform.



isn’t it about time the fathers of the

country were looked to for something

beside the meal ticket? The Ameri-

can father is not in his proper place.

no one knows that better than the Am-

erican mother. But the fault is the

father’s For father to keep in his

proper place requires more sacrifice

and hard work than the average man

is willing to give. To keep his proper

‘place he must be on the job every

minute, he can not delegate his duties

.to mother and then expect to occupy

the throne. He must have a voice

and a hand in the child’s upbringing

from the hour it utters its first cry if

h‘e expects to be revered when it is

old enough to understand. To the av-

erage American father the baby is

but a plaything. So long as it is hap-





 





p1 and playful he is willing enough

to be amused by it, but. if it cries, he

drops it like a hot coal into mother’s

arms.



As it grows older and begins to ask

Questions he answers it by saying.

“ lo ask your mother." If it. comes to

him to have its face washed. a sliver

taken out, or a hard knot untied, does

he help it out? Nay, nay. That is

mother’s work. If sickness comes

mother sits up nights while father

snores, for he has to work' next day.

He pays no attention to the. child’s

friends except to order them home if

they bother him. He absolutely re-

fuses to take any of the responsibility,

and hard work, of caring for the fam-

ily other than bringing in the money.

Why, then, should he complain if he is

not consulted when the child is grown

and has problems, or if his children

fail to think to give him the respect

he thinks is his due?



It is a hard pob to be a father en-

titled to respect; a job calling for con-

stant sacrifice and eternal vigilance.

So hard is it that the average Amer-

ican father has not sufficient courage





and ambition to tackle it. To be more

plain and less polite, the average Am-

erican man is too lazy and selfish to

be a father, and he has no one but

himself to blame that he docs not oc-

cupy the exalted place in the family

once held by the man of the house. He

delegates all his powers and duties to

his wife and then complains bitterly

because the children do not fall down

before his shrine and do him homage.



Father can be restored to his proper

place any time he wants to work to

get there. Nothing that mother can

do or say is going to get him back.

Mother has been doing her share. in

the family, doing her share and fath-



s, too. and the children are quick to

see where credit is due. If father

wants to share with her in the love

and respect of his offspring, he mus1.

share with her in the work. When he

does it will not matter what he. is

called. “Father” or “Dad” will be.

equally good if filial respect, is back

of the name.



The whole thing is 11p to father. If

he can not command the respect of

his family, the fault is his, not. moth-

er’s. And one, mother at least intends

to let him work out his own salvation.



D1-211ormn.





Ill...l|'ll'l’ll|l'll1Il'llllllllllllHllllllllllllllllllllll”lll|||lllllllllll'l!Illlll|l||Illllll|lllllllllllllllllllllllll||l|||ll"'llll|illl"'llll' lI'I‘W'“ . ".tllllllllllllllllllllllllllllll llilllllll lllllllilllilililllllllllllllllllllll





City Helpsin the Farm Home.





(Continued fxom last 11 eek).

O quicker did the question pre-

sent itself than she hastened to

find the answer. Among their

legal papers she found those pertain-

ing to her little place, the place where

her father and mother had lived,

where she was born. and where her

parents had died. Tears came to her

eyes as she thought how glad they

would be if they could see what this

money would help her to do now.

Then she found the deed of the farm.

It was to Daniel Lewis Vaughn, with

no mention of his wife. No joint deed

here. Mrs. Vaughn smiled to herself

as she said, “This must be changed.”

But the afternoon work was to be





done before baby should awaken. She





studied as she worked and only did

the necessary things. When Doris

awakened, she took her out as she al—

11 ms sdid in the afteInoon. Whatever

else had to be neglected, the child

should be taken care of. Her own





haid life must not spoil the baby’s

chance of healthy growth.



The evening demands came early, but

before these Mrs. Vaughn managed to

look over the letter and literature

from the experiment station. The.

helps were so plain and so practical,

that she began to see light for her

plans.



Then, in with these were many poul-

try bulletins. She smiled when she

looked through these, and said to her‘

self, “I’ve been so busy working that

I could not find time to learn how to

do things in the best way.”



She seemed possessed of a new and

more interesting viewpoint as she fed

the chickens that evening. The hens

looked up from their over-generous

feeding, as though wondering what

had come over their mistress, and

Baby Doris crowed in concert with the

big Plymouth Rock rooster. She also

felt something about her mother alto-

gether different from ordinary.





ltllillllillll|lllllllllll'lllilllllllllllllllllllll‘Hllllllll'lllllllllllllllll'llllllllt.lllllillIlllllll'lllIllltlllllllllllllllllll”"‘li iii Eh: W W Illlllll‘l"'”l‘ ”nimlllllh."l".'<“‘l‘ll‘liiiiltltll..l.l‘||llllllllll[l





Two of Michigan’ 8 Happ1 Babies





 





 





Maurine Sisson.





 





Glenn Smith.





‘housework more simple.





 





At last the work was all done. Myr-

tle Vaughn had always held to the

habit of dressing carefully for these

short evenings together and tonight

she, took extra pains. This, with the

1ig‘ht of the great hope that had come

to her, shining through her eyes, made

the marks of the last two'years less

noticeable.



Baby, after the evening playtime

with her father, had gone to sleep.

Mrs. Vaughn knew that the time

which she had both dreaded and hop-

ed for had come, and she. must try

and win her husband to her way of

thinking. So taking a. foot-rest she

came and sat down by him, and gently

pulling his paper from his hands said.



“Dan, do. you think we had better

buy that forty?”



“Yes. puss, don’t you?”



“I’m not sure, Dan. dear. I’ve been

hoping for the past two years that

when the tools and stock were paid

for we might have some conveniences

for the house.”



“\Vhat did you want?" he asked.



The “puss” was absent. now and no

pet name came to take its place. He

was just plain business man being

stingy with his wife.



Not in the least daunted she said:

“I want, 011, lots of things. I want

water inside the home, both cistern

and well water so that I will not have

to carry thousands of pails full each

year up those steps. I want a. wash-

ing machine, with an engine or a man

to run it. I want a. bathroom, a fur-

nace, a fireless cooker, a. bread-mixer,

etc., etc., my liege lord. Not all at

once, of course, but all of them as

soon as we can afford them. I’ve

been thinking of this all the,after-

noon, and I have concluded that I am

of almost as much importance as the

forty. I am not going to grow into an

unattractive old woman, while you

ltz‘ep so handsome.”



Dan smiled but grew sober in a mo.

ment and asked: “But what will it

cost, pet?” His good nature had re-

turned even more quickly than she

had hoped, but the reason was deeper

than she realized. Her husband loved

her very much indeed, but he had not;

lived with her two whole years with-

out knowing that when she had really

made 11p her mind about a thilg,,he

had to let her have her way. Too, he

knew her to be a. splendid housewife

and helpmeet. He had often acknowl-

ed to himself that their success was

due. as much to her efforts as to his.



Myrtle Vaughn hurried for her let-

ter and literature from the domestic

science teacher and field worker, and

together they studied over the con-

tents.



At last Dan said: “We cannot do it

all at once but we will do what we

can. \Vhat had we better tackle first?"



Then his wife put her arms about

his neck, buried her face in his shoul-

der and cried with relief.



“\Vhy, Myrtle, dear, what is the mat-





ter? Did you want these things as





badly as that?”





“No, no,” she replied, “but I feared





you would not be willing, and I so

wanted you to love me well enough to

help me when I needed it, and you





.do. I studied it all out this morning,”





she went on, “and decided that for our

sake and baby’s, we must make the





letter came in the morning mail,” and

she. took from the foldsof her dress

the precious offer for her' place. “Read

it and I’ll-tell you what I thought we

might do it it meets your approval.”





o1





Then this '





 





 





 





1 xhvm -.
. “flaw xvvk -





 





MARCH 18. ms.





Bohons

Bighook





,gufiuggy

Bargains





ClReal bargains on every 112

Chang.“ buggies.” easy ridinganll





All

Hooch

because he mhuc’gia profit

‘ and expenses to make

\. and can ’t meet my





From-Factory-

To-You Prices





My price is inst the cost

of mki the bum plus

Em“





saves you 825:0

My faunas“





Unlimited Guarantee





Backed By a $30. 000 Bond





Try it for 30 da

on your own rat I.

Test it {or entyn

log. durability. style.to

If it don’ t cameo

scratch—send it b:ck.

My guarantee on m-

Ihip and 1;: :ztcrial [-

no time limit. “you, -

our find any«

thing defec-

awe g) o Bo- \, I.-

on I

”not Igtigzg§ ”I. ’2:

w. I will ‘





mnheitrlgh t 7 <\\‘-;’;;‘

Save £35 to ‘



$3353: 4“", 4



Write for My Buggy Bargain Book Now





Bavoitonbnndwbon 'nroadytobo

It will save you money. ’uVS'Vribe now—lbthyy





D. 'r. notional!“ Main St. 11mm. Ky.

ON’T Pay Two PRIO 6E

Enoslen’

8:. RangesF

1% To i your home it n”



Shovyldm Idem Freight "its:

11!. Bend it back at our expcnne if on

donut wont to I: You In guy

the bout u Aoc-nl?utory Prion. Our

new improvements absolutely m

anything ever produced. Somme-3h



than

oonmn

‘ STOVES Guaranteed

‘ hove-n. and I



“do: lol- largo



m hrs.





nut-on to nice: bun.

No 05W -





‘ nooslm STOVE on.

13! MEL, Iarioo, lid.





 





 





 

 

 

 

 

 

 





 





 





 





farm lighting Solved.





Light. your house and'barn with the





. MICHIGAN PIT

Lighting System.

‘ mane "his, uh and canonical.





Write for Partlculors.





,Nigm commander lighting to.





. Dept. E, Jackson, Michigan.

5 E L r:





' MDNIJU'R mmc lRDN





. flakes Ira-g 3 Plants

, W the “World's

‘ loot”by overNGBO Msofisfiod



‘ customers. No hot stove-

‘ h e a t regulated instantly.

clothes ironed r, easier.





AGENT S mg...”





sells itsel’. Absolutely m priced and mm sellmg

ironmsdn. Every lwmealxoepeet. In“.

territory. Sample tree to workers. Write today.





rummage. 650 Inkkhdlqo.

_





 





 





 





 

 





   





 





hints at adequate



munTll n val-kl: when you

last alla“B6t" Lightsystem-

More than 20!) styles are pic‘s-red



" in our catalog—every one 0!

meedtofyivelcku.





them

Wgfiuumuwm

‘chnuyuha





an “is; ”M

run lhs'l‘ nonl'l' on.

280 ammonia...





 





 





names. 23 mum-samu-





PM? FLORALGUIDE—ol about a

final-Downriver“! m fink..."





10c Seed Coupon and copy Park’- Flora

The old“! and

all (or don). Don’t uh Goo.





 





 





 





 





THE ”MICHIGAN FARMER





Dan read the letter through and





then said: “Do you think you had

better sell?”

“Yes, don’t you?”





' “I presume it would be better. It





' does not give you much pin money as





it is now. You could put this amount

at interest and do better.”



“Now I want to be very plain, dear,"

said Mrs. Vaughn. “We are man and

wife and what is yours is mine, and

what is mine is yours. Is not that the

way it should be?”



"Yes, yes, of course, my dear, but

what are you driving at?”



“Just this. I want to be joint owner

of the farm with you, and I want to

help buy the forty by paying $500 as

the first payment. Then I want to

make the house on the forty a con-

venient place for a tenant, and I want

to make this house what it ought to

be for our home. Are you willing and

will you help do it?”



“I think, we can work this out to‘

gather,” Dan said. “But what do you

mean by owning the farm jointly? Do

we not do that now?”



“No, indeed. It is deeded to you

alone. Of course, you could not. sell





» it without I, as your wife, signed the





deed, but otherwise than that I would

have no voice in it. If you should die

I would simply hold the use of one-

third of it, and my money if used in

improvements would all belong to you.

Of course, I have only a little but I

think that we both would feel much





better to know that if anything hap-





pened to either, our property would

belong to the other without process of

law. Do you not feel that way ?”



“Yes, I do,” replied Mr. Vaughn. “1

was only wondering what father

would say?"



“I thought of that, too. I do not

believe he would object, though, and

anyway, it is not for him to decide.”



“I guess that is right, too. “Fell, lit-

tle girl, I think We had better sleep

fore we come to any more decisions

over these revolutionary things,”

he said, with a laugh. “Tomorrow we

will see how much farther we can go.”



The next day a letter was despatch-

ed to Mr. Jones accepting his offer,

and the papers, properly executed,

Were placed in the nearest bank for





collection.





Night after night they poured over

bulletins, advertisements and plans.

Stoves had been their cross during

the past two winters, and how Myrtle

had longed for a furnace! Now she

could have it, and the only question

was just how was the best way.



The result of their spending the

fifteen hundred dollars was interest-

ing. Five hundred dollars Mrs. Vaughn

insisted should go as first payment

on the desired forty. The small five





' room house on this piece of land was





equipped with cistern. force pump,

hot water tank and range, kitchen

sink, properly drained, and all at a

cost of 3100. Another $100 put in a.

small heating furnace and made a par-

tition separating the furnace and veg-

etable cellars.



This left $800 to spend on the im-

oprovcments in the home. The rush of

fall and summer work was over and

much of the labor could be done by

Mr. Vaughn and the man he had hired

by the year, who had moved into the

tenant house.



There had been a long considers.»

tion of the heating system. The final

decision was for the hot water, which

would cost more in the beginning but

in the. end would prove more econom-

ical. By doing much of the work them-

selves the cost of this complete was





_ only $300.





Before frosts had come a drain was

put in to care for all drainage from

the house, including sewerage. The

wells .were all deep rock wells, so

that there was no danger of contam-

ination, and only the manner of dis-

posing had to be considered. A four-

inch tile was laid. from the bottom of

the cellar; to about six feet from- the





h cellar wall where it emptied into 3

TE two-mot me, three lengths or which





were set upright, one half above the

inlet and one half below, these being

closed at top. Opposite the inlet was

an outlet, also of four-inch tile, and

these in turn emptied into another set

of two-foot tile, set upright, about ten

feet from the first. Underneath these

a large excavation had been made

down into the sandy soil, and this was

filled with fine stone and gravel to

the bottom of the tile. The tile was

then covered and the location properly

indicated so that if any trouble arose

it might be easily located. The whole

cost above the labor, which had been

all done by the regular help, was less

than $20.



A small gasoline engine was install.

ed for pumping both well and cistern

water, the former into the kitchen and

to a small tank in the attic which fur-

nished the water for the flush tank of

the closet, and the latter to a pneu-

matic tank in the cellar from which

would come the supply of soft water

for bathroom, kitchen and washroom,





 





the engine and washing machine be-r





ing located in the woodshcd. The en-





gine and the pneumatic tank connect;





ed with the range and gasoline heater

and with bathroom, sink and wash-

room, cost complete, $275.



To make room for a bathroom had

been something of a puzzle. It was

finally decided to take one of the

small bedrooms upstairs, cut off a

good-sized clothes closet and use the

rest of the room for this purpose. It

was located directly over the kitchen

which greatly simplified the plumbing

arrangements. Then the bedroom, or

or parlor, down stairs with the addi-

tion of a wardrobe and bed davcnport

made a splendid den and sewing room.

These changes and additions cost

about $50



With the balance of the money a,

washing machine, lighting plant, fisc-

less cooker and a bread mixer were

bought, and there still remained a

very small sum to be used at some fu-

ture time for labor saving.



Christmas Eve found everything

complete, and as the young mother

went from room to room, enjoying the

even temperature and the home-like

comfort. as she glanced into the den

where her husband was busily engag-

ed in arranging the first Christmas

tree for his child, and caught the look

of perfect happiness on his face, as

she put Baby Doris in the bathtub

and heard her cries of delight as she

splashed the water to her heart’s con-

tent, she thought:



"I wish that every family in the

land could know that the most im-

portant things in the home furnishing

are those that lessen labor and that

bring to the family physical health

and comfort. These are the best ma—

terial foundation for ideal home life.”



Ingham Co. IDA L. CHITTEXDEX.





THE INDIAN PAN.





 





BY L. M. THORNTON.

Seat all the players but one in a

circle. This one, the leader, then gives

each of the players a number, whis-

pering it in his ear so that the others

shall not hear. He then takes a new

pan and placing it on edge in the mid-

dle of the circle sets it spinning. at

the same time he calls some number.

The one having the number called,

must leave his place and catch the

pan before it stops spinning. If he

fails he pays a forfeit.





 





HOME QUERIES.





 





Mrs. P. L., Tekonsha.~——Every baby

should be weaned at from nine months

old to 11 months. As your baby would

be 11 months old in the summer I

would advise you to wean her at nine

months so she can be used to the

change before hot weather. I would

advise you to secure milk from some

other cow, or better yet, from a herd.

There is no satisfactory substitute for

milk. If, when you make the change,

she does not get along I would be

glad to advise youatthattime.





 





 





19—331





E”?

FREE mama





§ & 10° Ba ains





 





Address: ”0080' 4-8





Parcel Posts & IOcStoreo





8. 8. KIEJGE MPMV

1 100-1 108deaohAve..Chlca¢o

_





mmehrhMWMbmb

thqun!





See what n 51, saving you can make by buying

range direct —what a fine range you can get for a (ti:

money. Write us. We’ ll send you l‘ac tor Catalog show-

lbshnndredo hundred“?! otyles and sizes wholesaL prices, freight

W808“.





 





 





 





Money Back Guarantee

and pproval Test for

, whole year. Nearly

a” “10 delighted users.

Wm for one». 1 13





{al.KalomdL





Dircct to You





 





 





 





For bums, cuts, insect bites and

all irritations of the skin, use





Reg. U. 5. Fat. 03.



Keeps wounds clean; soothes and heals.

Specially valuable in the nursery.



Put up in handy metal capped glass box~

tics. Al drug and general stores every-

where. Illustrated booklet describing a‘ l

the Vaseline" preparations mailed free

on request.





CHESEBROUGH MFG. CO.

(Consolidated)

33 State Street. New York City





 





 





 





 





J





 





 





H0“ COMFORT FOR nWlNTER DAYS





b t

'“fiyefmi°:o‘r$ $2

e Wolverine



Chanical Closet



Ille- it. we



. have a. toilet I. ”'1: ’33:



lo “I“! or Sow-

m





' ,..,- sick-

’ Cor‘ebilll. The Indoor

L Goo“ “no health.

contortudoonvonience.

MI! the“. of your

Hardware or Implement Deal-

or and we will loud you our

than: giving complete de—

seription of the Wolverine

Chan [weaned Closet System.

Guaranteed Odorless and.

Sanitary.





mum PO.





 





but am



II) E. Iain Sk.hnfln¢

Nation the Michigan Former



who. with; to advertisers.
that’s the most fitting name for a scale. It reg-

isters the value of your hay. grain or livestock.

Showsif you get your money‘s worth of what

you buy. Get the easily built. accurate





Allen Piilcss 3:3, Scale





Guaranteed for ten years. \Vorks without fric-

tion. Absolutely accurate according to U. 8.

Standard.

Allen Improved Land Rollers



We Guarantee satis- properly pack

faction or money is ro- and pulyenzethe

funded. Catalog Free. £12m 5:13;; 03‘ (:1;

Allen Fillers Scale (10.. seedingfashoreuy

Box 40 New Castle. Ind. _ ‘ terms. Write To-Day.





3-7 “—





«initial





" Mt . .. . - L5

_ m

5 _‘

Po r

A N ‘D I M 0 'l' H Bu.

liWESTlGA'I'E-vaoal and Cheapo-l Seoul"? Known.

Alsike Clover and Timothy mixed. Fully 1-3 a sike. a big

bargain. Greatest hay and pasture combination grown.

Write for Pros Sample and oil-page catalog and circulars

describing this wonderful grass mixture. Beats on thin

fan can sow and ridiculously cheap. We handle on y bes





ested recleaned seed guaranteed. Write beioreadvanco.

A. A. BERRY SEED co.. Box 531 Glarlnda. Iowa





SAVE 50 per cent.





ON TREES





Buy direct from our Nurscries and get best. reli—

able, hardy nursery stock at a saving oi fully one

half. \‘i'ritetoday for free copy of 1915 catalogue





CELERY CITY NURSERIES,

Box 112, Kalamazoo, Michigan.





CARMAN PEACH TREES





The liurdiost and Best Peach of its season. ‘30

iirstclass trees of this Variety by EXPRESS

PRlll’Aillior$;‘. Satisiuci’ionGuaranteed. Your

money back if not pleased. Write ntouce for our

l’ricc List on full line of high-grade Nursery

Stock. \‘urieties true. No agents





NEW HAVEN NURSERIES





Box 57, New Haven, - - Missouri





LIME





Pulvorized lime rock for "sour" soils. Write for

LUVV PRICES J)! Rl'K‘T TU V! Ni and wu will scnd Haun-

plc and full particulars. Write to otlicc ncurost you





LAKE SHORE STONE C0.,

Muskegon, Mich, and Benton Harbor, Mich.





LIMESTONE





For General Farm Use.

Fincly pulverized. made from higlicst high calcium

I-touc. Quick shipments in closed curs. Let us send

sample and price.





Northern Lime 00.. Potoskey, Mich.





—You should get the highest grade

of limestone manufactured. Buy

it upon the basis of analysis. We

manufacture the highest grade pul-





verized limestone sold in Michigan.

Let us prove i for sample and analysis.





t. Ask

CAMPBELL STONE 00.. Indian River. Mich.





PULVERIZED LIMESTONE





For RIG-H GRADE MATERIAL and PROMPT

SERVICE- plucc your orders with

D. O. MARKLEY.

86‘! Division Avc. South, Grand Rapids. Mich.





LILLIE’S SPECIAL BRANDS





BUF F ALO FERTILIZER





Made from best. muterial. Always reliable.

Limc. l‘utnsh. Acid Phosphate. Nitrate of Soda.





Agents wanted in unoccupied territory. Ship di.

rect. to farmers in cnrlots. Fertilizer questions

answered and farm soil surveys made on request.





Colon C. Lillie, Sales Agt.. Coopersville, Mich.





SURE CURE FOR

SPORICIDE in oats. Guaranteed. SMUT

Simple to treat. Sent

direct on trial where we have no agents. Free Booklet.





{mild Sporicide Chemical 00.,ATkfl‘ir-M





PURE FIELD SEEDS





(Rover. Timothy. Alsike. Alfalfa and all kinds of

Pure Field Seeds direct from producer to consumer.

Free from noxious weeds. ASK FOR SAMPLES.

A. C. HOYT & C0.. Box M, Fostorin. Ohio





Our Trees and Vines Grow—3301331155“; 1°93:

Apple. Peach. Pear. Plums. Vines. etc. Catalog free.

W. A. ALLEN & SONS. Geneva. 0.





SWEET SEED.——‘V bite and large blen-

nlal yellow. Prices and Circular on

GLOVE R request. EVERETT BARTON.

Box 129. Falniouth. Kentucky.





SWEET CLOVER SEED 2?.er





YOUNG-RANDOLPH SEED CO.. Owosso. Michigan,

——Wholesale price to you 50



Garden seeds per oz. for vegetable seeds.

etc. Write for Catalog to-



day. ALLEN‘B SEED HOUSEDsk. M. Geneva. Ohio





CW“ SEED POTATO ES





Northern Grown

CATALOGUE SENT ON REQUEST





NORTHERN SEED COMPANY

Box 26 :-: :-: Grand Rapids. Michigan.





STRAWBERRY PLANT “gfi'fifiile‘ifififi

O





catalog tree. MAYERS'PLA' NURS





 

   

 

 

 

 

   

 





 





 





 





 





 





 





 





 





 





THE MICHIGAN FARM‘ER '.





HEN the destruction of the

W forests—the home of the



birds—caused the rapid in-

crease of insect life injurious to fruits

and edible plants, the farmer was com-

pelled to resort to artificial insecti-

cides and fungicides... The first stan-

dard combined insecticide and fungi-

cide given to the farmer was Bordeaux

mixture with some form of arsenate.

Later it was found that the lime-sul-

phur wash had advantages over Bor-

deaux mixture. It was a better scale-

cide. in controlling San Jose scale, and

combined with arsenate of lead it had

superior properties in destroying in-

sects and fungi. The application of

these. spraying solutions hasbeen ex-

pensive because of the. labor involved

in their preparation and application.

The extensive orchardist, to insure his

crop, has found several sprayings dur-

ing the. season necessary, and his in-

vestment in modern machinery and

necessary outfit, added to cost of la—

bor and material, has been a large





Advancement in Spraying.

mcn'ts, there has been an evolution in





discoveries promise such rapid pro-

gress that revolution would seem to

be the best term to describe it.



These discoveries are of late incep-

tion and were first given to the public

at the recent convention of fruit grow—

ers held at Rochester. The dust spray

for orchards is one of the new discov-





item in the expense of fruit growing.~

Like the history of other improve:





spraying methods, and some recent





New Developem’ents in. Spraying.





 





secticide is known as the "Babcock-

Lasher formula,” discovered by Prof.

Babcock and H. W. Lasher.



Up to the.» present time the method

of insect and fungus controlhas been

on the line of smothering and poison-

ing, and protecting the foliage by an

impervious coating of spray material.

The new formula strikes out on a.

new line of destruction, not waiting

for the insect to eat the poison, or tak-

ing chances in smothering it. It kills

instantly by contact, and the power-

ful agent found to do this effectively

is carbolic acid combined with fish

oil soap. The statement is made that

this insecticide will kill any insect by

contact, and will not injure the foliage

of any plant. The Babcock-Lasher

formula is as follows: 100 gallons of

water, 15 pounds of fish oil soap, and

one pint of crude carbolic acid. The

soap is dissolved by boiling.



it may be well to say that Mr. Lash-

er is a responsible business man, hav-

ing a. business in Rochesmr, and ex-

tensive orchards in the vicinity of that

city. He has no‘ desire to make mon-

ey out of it by retaining proprietary





rights, but- wishes all to be benefited





by the discovery. ’

An Effective Insecticide for Rose-bugs.

According to the paper read at the

fruit growcrs’ convention Mr. Lasher’s

orchard was badly infested with rose-

bugs, an insect which is very hard to

control with an insecticide. Mr. Lash-

er called the plant and tree doctors

from tho state institutions to his aid





 





 





 





 





cries mentioned. Prof. Reddick, of

Cornell l'niversity, is a pioneer in

dusting orchards. The process he is

working out, is the use of lime-sul-

phur and other materials in powder

form, and applying the combined pul-

verized materials to the trees, letting

nature supply sufhcicnt water in the

form of dew to harden or set them on

the trees. The making and applying

of the lime-sulphur solution, which re-

quircs costly equipment and much

time, has been one of the burdens of

the orchardist. It is claimed that

leaving out the water from the lime-

sulphur mixture reduces the labor of

spraying one-fourth that of using the

water solution. The dust spray has

been found to be especially effective,

according to Prof. Reddick, in destroy-

ing apple scab, and he hopes to con-

trol about all orchard pests with it.

Dusting of trees instead of spraying

with solutions is in its experimental

stage. but results obtained so- far

promise to eliminate much of the cost

and labor of spraying orchards.‘ Spe-

cial equipment is needed, also protec-

tion for the eyes of the operator, and

a knowledge of meteorology, that will

enable one to apply the spray at a.

time that will be followed by a dew

the next night.

A Newinsecticide.



Another newly discovered insecti-

cide has been presented to the public

which its discoverers claim marks an

This new in-





 





.mmmch. iepoch in insect control.





Spraying is the Greatest Factor in Getting Good Fruit.





and every known remedy was tried

but without success.

he called Prof. A. Emerson llabcock,

also a fruit grower, to council with





him, and the result was the trial of





carbolic acid as a destroyer of insect

life. Finally it was combined with

fish oil soap. which at once cleared

the orchard of the bugs with no injury

to the. foliage.



A few quotatiOns from his address

are as follows:



“The speaker after killing the rose,-

bugs then conceived the idea. that

with this wonderful penetrative power

it might be possible to spray egg

masses of all insects and take the fer-

tility out of the same, reasoning that

if that were possible orchards would

be free from all insect life except

such as may fly in from unsprayed

areas. This could not be large, there-

fore all sprayiugs subsequent to the

dormant period would be eliminated,

creating a tremendous saving in time

and expense.”



“With this end in mind the writer

began his experiments in May, 1914,

on eleven apple trees of different va-

rieties, fifty-five years old, distributed

through a fourteen-acre orchard. The

application was made just as the leaf

bud was breaking. I considered that

to be the psychological time, and am

now of that belief. Early broods that

have hatched have no place to hide,

and the egg masses I believe to be

softer then than earlier in the seasou,





As a. last resort





 





M A ROI-1’13, 1915.





Planet J1:

Wheel Hoe:HorseHoe





‘Planet Jrs. are the most economical farm

and garden tools you can buy. They are

made the best, last the’ longest, and give

the biggest results. Fully guaranteed.





No. 11 Planet Jr. Doublo "

Wheel Hoe, Cultivator,

Plow and Rake





A single and double wheel-hoe in one. The plows

open furrows and cover Iht'll'. 'liie cultivator teeth

work deep or shallow. Tilt. itlws’are wonderful weed

killers. The rakes do fine cultivation. Unbreakable



,sieel frame. The greatest land-cultivating tool in

tin: world.





No. 8 Plano: Jr.

1 Horse Hoe





Stronger, better made, and capable of a greater

variety of work tliuu any other cultivator ~mads.

Non-clogging steel wheel. Depthqegulutor and extra-

lung {mine make it run steady. Adjustable for both

depth Lind width.





72-pago Catalog (168 illustrations) free





Describes 55 tools, Includim.v Heeders, Wheel-hoes,

Hnrmws, Orchard and Beet-(hummus. Write poo-

tal for It.





S I. ALLEN & C0 Box mm Phila Pa





 





 





All hardy stoc k——iwice trans-



" planted—-root pruned. Pro-

tect buildings, stock. crops.

Hill’s Evergreen Book. illustra-

ted in colors. Free. Write today.





i > B. Iii" Inna Cu. line. 2303 CodarSl..

llumin, Ill. evergreen Specialists





 





 





vari . Flu

Iargfi'Yhizhly





some of those plants free. Write for prop-

osition and handsome colored catalog filled





with new and stand etiea of garden

. ‘ and flower seeds. etc. Address.

ms. h ()0. .183 Gallowa Sta. Waterloo, Iowa





 





 





 

     





We are trying with all our might to furnish ab-_



solutely pure; Red, Alsika. Mammoth, Alfalfa.



1 imothy, Sweet Glover, and all other field seeds.



With all blasted and tm’nwture grains removed.



Write today for free samples and instructions

"How to Know Good Seed."



0-31. SCOTT & SON, 26 Main St... llryaville. Ohio





BANKEB’S TRIAL COLLECTION. Awfufa'd





:00 Fruit Trees, Berry Bushes 3:. Grape Vines, $5

Money back if not satisfied when you no the trees.

20 Apple trees—5 to 7 ft. 2 yearn—4 Baldwin. 2 Banana. 2

McIntosh,2 R.I.Greening.2 lied Astrachan.2 Stayman.

2 Xork Imperial. 2 Black Ben Davis 2 Stark. 10 Fear

trees No. 1—2 year—2 Bartletts, 3 D’Anjo, 5 Kiefl'cr.

l Elberta Peach. 1 En. l ruwl‘ord. l Montmorency

(literry3to 5 ft.. 1 Grab Ap lib. I Burbank plum 5 to 7 It.

1') Gra )c Vines, 5 Concert. 6 Niagara. 1 yr . 25 Black-

berry arge size. 95 St. Regik. Red Raspberry. 1 year.





 

   

   

   

   





 





 





Get my big Catalos. it’s lircc. I sell only trees I

grow. D. G. BANKER. DANSVILLE. N. Y.





STRAWBERRY PLANTS,





i Seed Potatoes. Seed (om. Catalog Free.

i FLANSBURGI—l & POTTER

Box 360, Leslie, Mich.





 





 





i trawberry Plants





Guaranteed as good as grows at $1.00 per

i 1000 and up. Catalogue FREE.

‘ ALLEN BROTHERSJIAL Paw Pamnlich.





 





i new smwnrnmrs gains:





! Reliable, interesting and instructive—All about the Now

‘ Evorboarors and other important varieties.‘ ‘Address

i‘ C. N. FLANSBURGH & SON. JACKSON. MIC".

i





iWHOLESALE PRICES





on Strawborry Planes. Many other varieties and garden roots

atreasonable ricea. Catalogue FREE. Write to av to

A c MPANY BRIDG AN Icm





MEDIUM man cum SEED





99;? urity.97"lri16rminution.39.1% erl u.ba sin 1 d .

p nAnM’UN 33103.. wm’e'éwa'ter. “Wag.“ °d





Sood Corn and Oatsrsggiggggggf

JESSE W. PICKETT. Caledonia. lilohlgan.

12 BU. PER ACRE—The Corn'BeIt: Oat. De-





sori‘l‘iltion. rioes and sample free. MUNOY.

TO N ST OK FARM. Flat. Rock, Michigan.





For Sale——400 Bushels of Senator Oats.

Ready to sow. Price 81 per bushel. Backs free.

Yielded 70 bushels to the acre. Address



J. E. SKEOUH, Maple Valley Fa . Coral. Mich.





STRAWBERRY! PLANTS.

1000 for tl'as per new ofler in free catalogue. 100

varlgigg‘gidviilflg:srb$:o§: l}m.t896d cos-n. potattoel.

l‘ 8 . . 11 . ' .

A’IPLEGAN NURSERY. - I A3223]. iii; “:3.





Saw your ad. in the Michigan

JHSt summer" when writing advertisers. .





 





4





     





 





 





 





 





 





.... mi-A—‘m- w - 7.... ”Quad“... . w»... .... ..
MARCH 13,1915.





and more susceptible. This orchard

subsequently developed the worst at-

tack of pink aphis I ever saw, every

tree having thousands upon thousands

of curled leaves.” .



- To Control Aphie.



“While fighting these aphis Prof.

Hotchkiss, of Geneva Experiment Sta-

tion, kindly paid the farm several vis-

its. We counted the curled leaves on

the eleven trees and, as I recall it, the

maximum was 120 on a tree, the mini-

mum thirty, such a negligible amount

that in a year pronounced free from

aphis one would have more than that

amount.” '



“I believe that this formula has

fungicidal, properties. A neighbor has

an orchard near'mine. We both have

Greenings and we both sprayed at the



same time with the same material we

have always used. I made an addi-

tional application of this formula and

my apples were absolutely without

scab while he had a great many scab—

by apples.”



“Should anyone spray after the tree

is in foliage I would cut the soap down

to ten pounds, and the carbolic acid

to one-half pint to each 100 gallons of

water, or even less. To save time

have one kettle boiling the soap while

you are spraying. We slice our soap

with a spade to have more surfaces

exposed to the hot water, and thus aid

in its speedy reduction. The advice

may be thought to be out of place but

all these must .be done thoroughly.

This is a contact spray and all sur-

faces must be hit. Rough-barked trees

for a good job, should be scraped, al-

though I don’t' believe in scraping

trees as a general proposition.’"



An Economical Spray Material.



And now I pass to the saving in cost

of application, and this is a most im-

portant matter in view of the low sell-

ing price of fruit the past year. One

application of this formula, using a

team and three men, and applying

1600 gallons daily, will average $2.10

a hundred gallons, labor and all. The

three applications of any combined

fungicide and insecticide necessary

for thorough work will aggregate at

least $4.80 against the aforesaid $2.10.



Within the range of reason one can

picture this formula controlling all in«

sect life on fruit. the codling moth.

bud moth, leaf roller, pear psylla,

thrips, etc. The gypsy moth. brown

tail and tussock moth, caterpillars. ex.

cept in a. cocoon form, the boll weevil

on cotton, the Hessian fly in wheat,

and aphis on nursery stock. Animals

can be washed with it and poultry

houses disinfected, vegetable and fruit

gardening, greenhouses, white fly and

black aphis on oranges, in fact, the

field is unlimited.





New York. W. H. JENKINS.





__.._.





SAVlNG TIME DURING SPRAYING.





 





Spraying is always a busy and

pressing job, and any hints which en-

able one to push the work are valu-

able. It is only when the spray dope

is going onto the trees that work

counts. The least possible time that

can be consumed in the «preparatory

work—preparing the mixtures, filling

the spray tank with water, driving

back and forth between the orchards

and the water supply, etc., facilitates

the actual work of applying the spray.



We have made a considerable study

of rapid and economical spraying, and

the quantity of spray material that

can be put on in a given time with-

out waste. It is not economical of

time to have such a fine nozzle outfit

that a man must stand with the noz-

zle pointed at a given space any con-

siderable length of time in order to

wet it sufficiently. Nor is it econom-

ical of the spray material to have

such coarse nozzles that the liquid

goes on too rapidly and is wasted. We

have about, concluded that about the

proper medium‘is reached when large

trees are being sprayed in full leaf

when two men put on a ZOO-gallon

tank full in 40 to 45 minutes. When

trees are bare of foliage, or with





5





THE MICHIGAN FARMER





smaller trees where more time is spent

in driving from tree to tree, so that

the nozzles are not kept so constantly

employed, more time is required in

emptying the tank. I had to invest in

a new spray rig last spring and I did

not buy a rig already assembled, but

I procured such an outfit as met my

ideas in all respects, and I aimed to

get one of about this capacity. In

spraying large apple trees about 50

years old we put a tank full onto

about 15 or 16 trees and the nozzles

were kept busy almost constantly, and

it took about 38 to 40 minutes to

empty the tank.

A Convenient Water Supply.



The water supply is an important

factor in doing rapid work. In our

case we met this particular difficulty

in a. (SO-acre orchard by driving a well

in the middle of it. We had been get-

ting water from a lake and had to

haul it about 40 rods to get it into the

orchard. There was quite a hard hill

to haul it up, and the best the men

had been able to do was to put on

seven to eight tanks per day, and

often if there was any delay not over

six tanks were put on. With two men

and a team spending time hauling wa-

ter so much of the time it appeared

that it would pay to have the water

supply handler, so we put down a well

and put up an elevated tank for water

in the middle of this orchard. We had

an old gas engine that had served on

a spray rig six or eight years and had

become uncertain for that purpose,

but we set it to pumping water into

this elevated tank and. it did good

service there and kept up a good sup-

ply of water. We put in a two-inch

pipe to draw the water into the spray





tank, and with this we could fill the'





spray tank in three minutes. In four

minutes from the time we drove up to

the water tank we were loaded and

ready to start back to the spraying.

It was necessary, though, occasionally

to tap a barrel of lime sulphur or pre-

pare some arsenate of lead, and we

found that we could just about aver-

age a tank an hour. Ten tanks a day

was 25 to 30 per cent better than we

had been doing where we had to go

farther for water, and it justified the

expense of the new well.

The Spray Rig.



The rig I got up has a metal base

securely riveted together so that the

machinery is rigidly held in place.

The pump is a duplex with two up-

right cylinders two and a half inches

in diameter. It has solid plungers

with the packing around the outside

so that any leak can readily be seen,

and it is easy to keep the packing

tight so that a full pressure can be

maintained at all times. The engine

is three horsepower and hopper cool-

ed. I have used a three-horse engine

that was air-cooled and frequently in

the summer time it became so hot

that it bothered a good deal, and I

have at times turned the nozzle onto

it to cool it so that the work could

proceed. This was probably not an

ideal way of cooling the engine, but

we preferred it to delaying the work.

So we put on a water-cooled engine

this time. The tank is provided with

an agitator with two small propeller

paddles on a single shaft and driven

with a belt from a pulley on the pump.

This keeps the entire mixture in the

tank thoroughly agitated.



Allegan Co. EDW. Hurcnrxs.





CATALOG NOTICES.





The Maple Bend Nursery catalog of

fruit and ornamental trees, shrubs,

grape vines, small fruit plants, etc., 1

sent upon request by T. B. West, pro-

prietor of Maple Bend Nursery, Perry,

Ohio. This catalog lists a complete

line of the specialties above noted.



German Nurseries and Seed House,

Beatrice, Nebraska, send a 1915 gar-

den book of 130 pages describing and

illustrating their line of garden seeds

and plants, flower seeds, etc.



Strawberries and other fruit plants

are listed in the 1915 catalog of L. J.

Farmer, Pulaski, N. Y. A full line of

fruit plants and trees is listed in this

catalog.





 





21—333





 





Maurice Costello





' Famous Moving Picture Actor,

says :



"The great thing about Tuxedo 1':

the fact that it gives full fragrance

and flavor together with extreme

I wildness. I find Tuxedo not only

the height of pipe cm'oyment but

a distinct benefit because it give:

just the proper degree of relaxa-

tion. Tuxedo is undoubtedly an

I exceptional tobacco. ”





WA





“As Popular As The

Movies”——TUXEDO





tobacco.





. Gladsomc Sunshine.





weather fits.





 





sensitive throat.





Convenient, glossine -wnpped, 5

moisture-proof pouch. . . . C





In Tin Humidors 40c and 80c





 





 





 





 





 





. Tuxedo answers every smoke desire—every little .

palate craving,evcry longing for the one Perfect Pipe

No matter when or how you smoke

Tuxedo it sends right into y our heart a glimmer of

And you can just about hear 1

the honeybees buzz in the far-0H gardens.





. I / The Perfect Pine Tobacco. I





Sings into your system a song of keen delight. ’ ‘



lt spreads real happiness and cheer because 1t’ 3 smok-

11 able, lovable, all day. all night—no matter how the - .

Tuxedo a flavor 13 so enticingly mild l

and delicately fragrant it will not irritate the most I ’

I





Simply the choicest mild leaves of grand old

Kentucky Burley—ripe, rich, fragrant and mellow—

made into delicious tobacco that smokes as Smooth

I as cream. That’ s Tuxedo.





YOU CAN BUY TUXEDO EVERYWHERE





Famous green tin, with gold

lettering, curved to fit pocket 10C





In Class Humidors 5 0c and 90c

THE AMERICAN TOBACCO COMPANY '





 





   





ON SPRAY PUMPS

For Spraying. Painting and Disinfecting.

"you grow fruit or mvegetnbleamiscpoultryorcare loretock.you can't





alongvnthoul

Ennyodmerkmd.m GctyaM M;Ef5—Buc‘e





 





 

 

 





 

 





 

   

 





You mightjust as well have a good one

Barrel or Power—occuding





 





 





 





, BEST IN THE WORLD

. , Prlces Below All Others

: I will give a lot of new

-:- sorts free with every order I

‘ fill. Buy and test. Return if

not 0. K. -moncy refunded.

-' Big Catalog FREE

' ‘ Over 700 illustrations of vege-

‘ -- tables, andflowers Sendyours





,..~





‘ and your neighbors’ addresses.

R. H. SHUMWAY, Rockford, llliuois





lllll





1 ES I II)

SEED

Don’t I», Alfalfa until ’01: not our Price

H'l and Samples. We spool-ll to 011mm harem." Toot-





od Alla". Seed. No second or



Drop 113 a postal and. get our low, DI m

and What complete 1915 Pure Seed book

and Planting Guido, an eye-opener work of

:11. six colors .00 picture also U



list. Orlend 10 chi and get. in addition our 62 page. 25 ct.



book' tour-ow Altalf- the Wonder Drop" —a nine 1"



information Tell: how to get 3 our. ”’eotch,’ prepare



gm lnouhlo. WMMMdmoIi-tm



bets and important discoveries.





HM" ms. 8 00.. Mice "Am "A





 





 





 

 

 





 





 





 

 





iMllllONS 0i TREES





PLANTS, VlNES, ROSES, ETC.





The oldest. largest and most. complete nursery in

Michigan. Band for catalog. Prices reasonable.





I. E. lLGENFRlTZ’ SONS CO.





THE MONROE NURSERY. :-: MONROE MICE





SE ED OlAa'l‘SM 3%”? 1.1. an???“



SEED WTATOES pig"... t‘l‘nu‘ln nasal."

Write for sum is and Price



COLON C. ILLm. Cooper-ovum. Michigan.





 





 





Champion Beardlcs: lulu "fififiihud p.613“.

Backs inc. AL'ADALE l' BM. St.J Johns. Mich.





LAROEM WH l'I'E be.IJNI’IIJI.I.EII,)8SVVIEB‘I‘m CLOVER SEED

h“ m.

“5?”? $311“ 63111.11e. ml‘c‘h'iffn’"





KANT-K106 SPRAYER





Dduoof strum M Start:



or stops hpnhgtly—szo pointing



work. Seadforca

”M





tdo'. “curated.





   

   

 





 





Extra solace



61000 ted, sure to

Basie—Ls '0' 2°

ading va-



Moon. Also-Cellos“. barley.





IMImm-I. 8 mph no“. erhtod

”Meshing. W.N. 80ml", gov (bride. on:





 

 





anddcscribeooutfits R’IFREB.

ereatonceforFREElo-D YDTRIAL FFER

andSpecialIntroductoryOfl 0





WM "MI. WWI 00.. lo: 53 ,Qulnfilm





Wmmnmm s PRAYERS
334——22





Light Weight"

Cushman Engines





For All farmWork





 

 

 

 

 

 

 





handy for all

ower work.

0 light a boy

can pull it 1.

around from jobto “39:3.

to 'd et lit ealsily ‘ (\v" ,

an esa wor up " -

to 4 or 4% H. P. Engmeweigluonly 190“».

Runs at any speed desired, speed changed

while running. Pump circulation to water

tank prevents overheating, even on all-

day run. All Cushman Engines are





Throttle Governed—Steady and Quiet





No Jerky, explosrve hit-andomiss running.

They are the most useful engines for farm

work, as they do everything the big fel-

lows do and so many jobs big engines cannot do.

May be attached to binders and other machines

as power drive. Equipped with Schebler Carbur-

etor and Friction Clutch Pulley. Not a cheap on-

guns, but cheap in

the long run. Sizes

4 to 20 H. P.





Before buying any

engine. better in-

vestigate light

wei ht engines. Ask

for ree Engine Book.

I: U 8 H M A N

MOTOR WORKS





mu run 21.! 3M

meoL'ia. NEBRASKA





coocoooco





 





q H. P.

2 Cylinder

‘ Weazolbe.





 

 

 





 





 





 

 

 

 





d Your Silo

Once Only





i inate all chances of blow—downs. de-

galymand destruction by tire. Do away

with painting, adjustments and repairs.

Build for permanency. or in other words.

build economically. Plan now to erect a





NATCO

IMPERISHABLE SILO





"The Silo That Lasts for Generation."

de of vitrified hollow clay tile which will en-

Ili‘liire forever. and reinforCed by steel bands held

in the mortar between each tier of tile. It is

windproof, dccayproof. verminproof and fire-

proof. The Natco is the best silage preserver

known, for the vitrified hollow clay tile are

impervious to air and moisture,and prevent

freezing. Write to nearest branch for list



of owners in your State and for catalog A





 

 





   

 





 





 

   





N atronal Fire Proofing Company





Organized 1889 Pittsburgh.l’e.

Bloomington.lll. Madison,VVis.





S se,N.Y. . '

yracu Philadelphia,Ps. Lansmg,Mich.





Huntington, Ind.





 





   

   

   





 





 

 





 





 

 





g





 

 





   





 





   





iii—#77! . -... ,

til“ it it)





   

 

 





Read This!





The KRAUS brings better crops. with less timc,

labor and cxpt-nsc, BECAUSE—



Slight toot. prcssurc shifts wheels and gangs to

right. or lcit; horses furnish the power, the driver

only steers. (.‘uitivutcs hillsides, uneven lund and

crooked rows and brings more land under cultival-

Lion. Dodges obstructions: leaves no end hills.



Fully adjustable. light- drui‘t. perfect balance.

lcatst wear and. tear. Your boy can runlt.





Get Good Crops During Backward Seasons





by equipping the KRAUS with Akron Fertilizer

Distributor and apply fertilizer while cultivat—

ing. Strengthens the lunts and hastens their

development. \Vrite oday andlct us explain

other ieatures.





The Akron Cultivator Company,

Dept. 03‘ Akron. Ohio





   





 

 

 

   

   

   

   

   

   

   

 





 





 





6 H I l I 9 6 —-

1V9 ll-P. - - 3 24.75



' 2 ll-I’. - - 28.75



3 Il-P. - ~ 53.90



4 II-l’. - - 88.”



5 Il-P. - - 87.50



8 ll-P. - - 135.50



10 "4’. - - 179.90



12% ll-P. - - 214.90



Many other sizes—all sold



direct and full uran-

teed. BIG 32$de CATALO

OTIAWA MFG. CO. 218 SL. (Mania. lens.





 





lllllllil lIEEll HBM HELP? bodied





experienced and inexperienced. who want; farm work.

Our obiect is to encourage arming among Jews:

no charges to employer or employee;

d. steady. sober men. write to Jewish Agricultural

gggiety, 714 W. 12th Street. Chicago. Illinois.





We always have able

young men.





If you need





 





 





THE MICHIGAN FARMER





FE"ElliliiillllliiiiiiiiliiiillliiliillillllllllllliillIliilliiliillllllllillllllllliillillilIiiillliiiiii”iiillllliillllllllllliiiiiiiiillilillllliiiilliiiliiiiliiililiillliiliilliliiiliiilllililllilii”illiilllIiillllililliiliIlllllllllllillilliillliilg





Farm Commerce.





   





'0





liliiiiiliiilillilllilllllilili





LléilliiiiliiliiiliilIiHii|liIHHIll|llliiliillll”HilliiiilillliiiilllIiilllilillllllillillllliillilliiiilliiiilHlI”Illiiiiililililiiillliiiilliiiiiiliiiiiiliiif]Illliliiiilliiiiiiiiiiiiiliiiillllllililiilliiili!liliillliiliiiiiHIIIIIIIHHHIHHHII”





The “Co-op” Membership Problem.





Address given before recent Country Life Congress at East

Lansmg by Jas. Nicol, Secretary of South Haven

Fruit Exchange. .





HE membership problem for us



was not a serious one. we had



been well advised not to try to

start with too large a membership. We

organized with capital stock of 35-,

000, divided into 50 shares of $100

each. Under state law it was neces-

sary to pay in $1,000 in cash before

we could commence doing business.



Tcn growers got interested and de-

cided if necessary they would take

enough stock to insure the starting of

the exchange.



No ExpenSIVe Soliciting Done.



But to give all growers a chance to

join if they desired it was also agreed

that no member would take more than

one share unless necessary. The list

was then signed and left at local bank

and general invitation was given to

growers to unite in starting. We de-

cided that any grower who was not

willing to risk $100 in the selling of

his products was not ready for co—op‘

eration.



While $100 is a good deal of money

yet it would only pay for two months

rent of a store in a city of moderate

size, or about half the cost of a power

sprayer, and when they signed the list

guaranteeing the $100 it was good evi.

dence that they meant business.



One share of stock entitles owner

to all rights and priviliges. Not-one

cent was ever paid for soliciting stock

subscriptions. All money paid for

stock went into association and all the

soliciting that was ever done was just

friendly invitation or advice to join

the association.



Forty dollars per share was paid

when the exchange was started. Sec-

ond year $20 premium was required

and at last annual meeting stockhold-

ers voted to call in balance due on the

stock and not sell any more.



August, 1014, the capital stock was

increased to $10,000. We finished the

second year with 60 members, and the

admittance of new members was left

to the discretion of the directors.



Members with Special Markets.



Some of our members had private

customers which trade they did not

want to discontinue. So the members

Sign a yearly contract as to what they

expect to deliver to the exchange and

I will say that 95 per cent of the mem-

bers sign for all their fruit except

what they reserve for help and home

use.



Several members have turned over

their private orders to the exchange,

saying they are more trouble than

they are worth. They generally find

that selling fruit to private consum-

ers is a very much over-rated propo-

sition and does not pay except in a.

small way locally. we have had no

trouble with members selling fruit out-

side of exchange after signing the

agreement.



In fact, should a buyer offer extra.

prices to individual growers, we say

figure in your five per cent commis-

sion and sell them. Then offer the

buyer 10 or 20 cars more and we will

stand back of you and fill the sale.



Troublesome Members.



We have a few members, only a few

who do not want to sign a contract

but want to consult the manager on

every variety as it gets ready for the

market, and they want him to guar-

antee a higher price than they can get

anywhere else. Then they bring their

fruit to the packing house when they

have exhausted all local and other

markets. Such members are more or

less a nuisance and they take up val-

uable time asking the same questions





daily. Then they complain because

the manager gives them abrupt an-

swers. With such members it is the

duty of the board of directors to take

a firm stand that, unless a. contract is

signed, the members cannot deliver

friut to the packing house. This pre-

vents bad feeling between such mem-

bers and the manager.



Buying Outside the Membership.



When the members have not signed

their contracts at the proper time, the

directors can admit new members or

let the manager buy fruit so that the

packing house can be run to its full

capacity, for this cheapcns the cost of

packing and tends to giving better

financial returns.



We really have got to a. point where

We do not worry as to what the mem-

bers are going to do. If they want

their farms to pay a higher return

they had better do business through

the association. Repeatedly last sea-

son, We were oli’ered fruit by growers

saying, :“Take it and pay us what

you can.” Just think of such a condi-

tion when an investment. of $120 would

have entitled them to all the privi-

leges. One grower I heard say: “I

cannotattord to join the association.”

We bought one car of fruit of him

that paid the association a profit of

$75.00.



At East Casco Grange one day dur-

ing our first season, one of the older

members asked how many members

have you? We answered that there

were about 30 in the fruit exchange.

“Well,” he said, “I believe it must be

a good thing, for if it were a. fake the

farmers would be taking stock in

bunches.” One cannot blame the

farmers for going slow in a. new prop-

osition as they have not had the bus-

iness training.



Reduces Cost of Harvesting.



One of the strongest arguments in

getting members for the exchange is

the central packing house. Under the

Michigan packing law, a grower is at

the mercy of his help. Any careless

or malicious employe can damage a

fruit grower beyond maesure by hav-

ing the grower fined for snide pack-

ing of which he was entirely ignorant,

but the general public will say, “Farm-

ers are all alike. They cannot pack

honestly.” In the central packing

house, should a mistake be made, it

would not injure the grower, because

the public knows that the packing is

all done by hired help.





Another good feature is that it





greatly reduces the amount of help .





needed on the farm at time the crop

is harvested. 'We have never refused

an applicant for membership and it

has been our good fortune that they

have not come any faster than we

could accommodate them.





 





THE REFRIGERATOR CAR AND

HOW TO USE IT.





 





Now that farmers are beginning to

market their products in a wholesale

way, either as individuals or through

co-operative associations, it is essen‘

tial to understand the nature and use

of refrigerator cars. Samuel Fraser,

a veteran New York state fruit grow-

er, gives some sensible advice as to

their selection and care.



There is just as much difierence in

refrigerator cars as in folks. Avoid,

if possible, cars that are» becoming

worn and old. Sometimes in handling

perishable products it will be neces-





sary to accept a car of doubtful'char- _ .





acter. In that case accept underpro-





 





 





 





ll , -

to

0 ‘ I . .

o' I... I O

I. ‘ .

. : O O





Get This Offer





IT marks a new departure in



low prices on the highestgrade

vehicles that can be made. member

that these bu gies are made from se-

lected secondg rowth hickory, a lit,

not sawed, an the; are the mft est,

classiest buggies t at mil over the





road. .

Get the Big Boole

Read Phelns' big story to buzz?

users this year. Let; me tell you how

I have worked out a manufacturing

and sales plan that will save you

more money than ever.





30 Days’ Road Test Free





Two Years ’ Guarantee

All explained In the book, wherel

tell you my new money saving story.

Write for the Book Now





It contains 150 new and beautiful

styles and 200 illustrations. Also I'll 1

send you at the same time my 70 page

Harness Catalog free. Address

H. C. Phelps, President





The Ohio Carriage Mfg. Co.

Station 59 Columbus. Ohio





339%:





 





 





 





 





 





 





O o

Cham-

pion

Line



Cutters

Planters

sprayer-

Diggers, Sorters

Descriptive matter

free. Write for it.

Our No. 22 Planter

ls automatic; one man and team plant five acres or

more a day; Our No. 25 quntier plants abso-

lutely 100 per cent correct. a, seed piece to every hill.





CHAMPION POTATO MACHINERY CO.

145 CHIMGO AVENUE HAMMOND. INDIANA.





AW WOOD THIS WAY!





ndent of hired help. Save your time.

money. Saw big timbers at the rate;

to 00 cords a day. It's only "boy's,

play" wirh an

Drag Saw Ma‘chine'

. Has no equal in convenience. simplia‘

city and long liie. it's light, compact, strong. well-f

built and warranted, Savvy whole log in short length

without leaving lever. No turning ior last cut. 7

advantages. Write ior inc printed matter. Also

details on our Wood Saw Machines, ‘Saw and'

Shingle Mills and Hoists. Equally low

‘ prices on canva|.belting.

"HI-d Machine I Foundry (o. l

33 State St. N





 

 

 





... . as. “foreign; es»





Investigate

Our Line





Mme... .





 





 

 

 

 

 

 

 

 

 

 

 





Be ind:





 





N0





 





N. tj





@ make any wagon a spdngwngon. Prevent





damage to eggs. fruit. etc.. on road to market. Soon

save cost—produce brings more—wagon lasts longer.





MADE llKE FINEST AUTO SPRINGS“





Very resilient and durable. The standard springs of

- America since 1889. 40 sizes—litany wa'gon— ,6

; . sustain load up to 5 tons. It not at dealer's. [

write us. Catalog and fistiul of proof free. ‘

' HARVEY SHINE 00.. 152 -l'lih 81.. WINE. '3. '





 





 





 





 

 

 





 





 

   

   





 





 





   





 





 





 

 





Btu- Sweep Feed Grinders

Bur returns from little In-



_ vestment. Eu- corn and null

~ Saves you





- mone .fieo chhltig. Write

0





 





 





 





 





 





Steel Wheels





‘. will moire your-old form

~ f as good as new. Sovo'molm 300‘

5 flit? foft’inli'egig free 503%? I

. 1113 all about them and'how the; FREE

We Infill! ”7.0 a." “'78, “I”. ‘
MARCH 13, 1915.





test and write your protest plainly;

across. the bill of lading.



Meat refrigerator cars are not fit

for the shipping of peaches or any

other food product the flavor of which

is easily tainted. '



Slat bottoms are most desirable

when shipping fruit.





It is often necessary to cool quickly

a cargo of peaches or other highly

perishable produce which has been

placed in the car while still warm.

This can be easily done by throwing

salt upon the ice. Be sure, though, to

test the car with a thermometer to see

that you have not overdone it. Take

no chances of frosting the fruit





In the late fall refrigerators are al-

so used to protect produce from cold.

If shipping pctatoes, examine the bot-

tom of the car for salt. Your own

tongue is perhaps the most reliable

detector. Many a car of sound pota-

toes has been ruined by the action of

salt. The ends of the car should be

papered, and it is a safe practice to

paper the bottoms also. '





Examine the refrigerator cars and

remove any unmelted ice. Go over

the top of the car. See that the cush-

ions are securely in place, then clasp

down the lids. Have them sealed by

the station-master.



A carload of fruit gets some terrific

jolting before reaching the final sid-

ing. Be sure there are no loose bar-

rels to rattleiaround.





One of the greatest dangers in ship-

ping fruit during cold weather is that

the car may be held indefinitely upon

a siding and arrive long afterit is

expected. .



The writer accompanied a earload

of apples to Chicagovduring the first

cold snap last fall. This car was

side-tracked at the Muskegon yards

and labeled “Out of Order,” by the

car inspector.





Examination showed that the trou-

ble was merely in the roof and could

not possibly caliSe an accident. So i

got busy and persuaded the night in-

spector to set the'car rolling upon the

next train. Otherwise the car would

have been held for at least 24 hours

and that, too, While the mercury was

hugging close to the zero point and a

gale was blowing from off the lake. .



Kalamazoo Co. C. A. ROWLAND.





|[ll|llIllllllllllllllllllllllllllllllllIlllllll||llllllllllllllllllllllllllllllllllllllilllllllllillllllllllllfllllllliihlllllll

Crop and Market Notes.





Michigan.



Berrien 00., Feb. 23.—Snow is all

gone, frost out of the ground, and the

roads are in bad condition. W'heat,

rye and clover seeding in fine condi-

tion. There is no surplus hay. Wheat

and potatoes are being held; oats are

scarce; cornvis being shipped in at

50@85c. Wheat $1.45; potatoes 30@

L35c. Farmers are busy preparing for

spring work. An unusually large

acreage of oats will be sown to sup-

ply early feed.



Eaton 00., Feb. 23.——No snow and

frost is nearly all out of the ground.

Wheat and meadows look fine. Live

stock looking excellent, though there

is not a very large amount of feed on

hand for home use. There is still a

small amount of surplus wheat and

beans. Wheat $1.50; oats 550; corn

70@75c; beans $2.75; potatoes 250;

butter 20617250; eggs 20c; steers 6@

7c; hogs, live $6.50; sheep $2@4.



Kansas.



Cowley 00., Feb. 23.——Very little

snow but a good deal of rain has made

roads bad, and will keep farmers out

of the fields for some time. Wheat

and rye are improving. There is lit-

tle live stock in the country, and there

will be a surplus of rough feed. This

county is quarantined for foot-and-

mouth disease, so there is very little

live stock moving. The only outbreak

of the disease is in a bunch of cows

brought here from Wisconsin.



Franklin 00., Feb. 23,—We had a

heavy fall of. very wet snow this week,

which clung to trees, breaking limbs

of many fruit trees. Roads have been

in very bad condition. Meadows are

fair. Wheat and rye look- fine. Very

little live stock being fed, but there

is enough feed on hand for home use

with a few exce tions. Few farmers

were able to ho their wheat and po-

tatoes, but those doing so received

good’ prices. ‘ Wheat $1.50; potatoes





 





THE MICHIGAN FARMER 23~335





 





r

J





 





.ll





 





gllllllllllllllllllllllllllll





CASE “2 5 " ‘

Complete $1350—5% tits?

If We Equipped and Priced as Others Do





$12397-5-





Ol the 30 medium-priced cars—from $1250 to

$1500—the CASE costs the least.



This is the only car that comes completely

equipped with Extra Casing, Tire Cover and Ex-

tra lnner Tube Co Rim, Weed Non-Skid Tire

Chains, and Eight-Day Clock.



On any‘other car, men have to pay extra for all

these necessary features.



‘ The farmer requires them even more than the

man in town. Because you drive in the country

six days to his one. You are much more remote

from garages and service stations.



These features, with 5% discount that we

give it cash, amount to precisely $110.25.



Add this to the

price of any other car

in this class, and it

costs you more than





the CASE “25" com-

plez‘e at $1350.





Or deduct it from

the $1350 price ol the

CASE, and this car

costs but $1239.75.





on their-basis of price





and equipment. 7 The Namo Behind the Goods He n ce we save





Hidden Values





CASE buyers count this low cost an extreme

advantage. Yet these cars have never been sold

on price. They are winning men everywhere be-

cause of the way they are made and the stullthat's

in them.





These are the “unseen values" in the w'tals of





NOTE: -Ask II alsofor





 





 





 





lIllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllg





 





“was...“ ‘ \ ' J. l. c... r. M.

lwndkmmsgga ‘ , ,,,, _ . Company, Inc.

iFmdmhfihfs-Rouoo'k'“ / ~ Founded in 1342

msnllfiu ll.” _ ‘ A Depl. 536

dainty. Sen: fro: . 0 Racine. Wis.

ward. The Car With the Famous Engine 1)

(28





. . _

llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllIIIIIIIIIIIIIIIIllllllllllllllllIllllllllllllllllll‘.





a car. And you must rely upon a maker's abz'lz'ly

to build them rig/at. Also his reputation for

embodying them.





Your Safeguard





in both of these respects CASE stands. as you

know, without a peer.





We have won, through more than 70 years,

acknowledged leadership as makers of farm power

machinery. And motive power is the basis of an

automobile. So—when it comes to you. as it must.

to rely on the name behind some car—





Remember that CASE means utmost semrz'ty.





*****





 





And rememberthat

CASE cars are sold

by our own organiza-

tion. All over Amer-

ica, and beyond, it

handles this car in

connection with our

other products.





 





 





. thousands where

other makers must spend—in selling. And so we

spend in many ways for better materials and work-

manship. These are ways when" other: must save.





Our new illustrated catalog tells you of many of

the places where we spend to your advantage.





Before you buy a car, write for this book and

learn the facts that save your repair bills.





 





 





 





 





 





 





 





60c; cream 2.69: eggs...18c;, hens 1,0'c._





',;.-’





 





 





‘1





f-------------





WHIRLWIND





for that careful thought which is ever the basis of complete





success.





‘H Just as you plan ahead the spring crops, plan now the winter supplies

{for man and beast. You of the South are today planning how best to

diversify crops. You of the North how'to get the most from diversified

forming. You are both thinking Silo—but don’t overlook the true





economy that lies in the host machine.





Write for our Whirlwind Silo-Filler Catalogue

1 Are you thoroughly posted on Silo Filler values ? Do you know





want you to know why the Whirlwind lo the





Then decide— for yourself.





wine for “ ’I'he‘Why and How or Silo Filling”





M boob no your- flu- the asking-om! by tho way btoflur thi- oll'or lm'tnwlo to: tho d

do’lnz on I. lolooman. Wo want you your-elf W'Icnre «it in lmpMont m: now, mu





1 booty, ill-coulduod diolco nut mot.





WILDER-STRONG IMPLEMENT C0, Monroe, “ch, 30: l 3

m also“ Coukqstonohlono





FooduCuuon Loud Rollo" and M





 





5.2m.” FREEBOOKSNOW





THESE long winter evening's afford the best possible Opportunity





at. Get our free books—

: other maker-5’ cata es. Com re the machines point by point.

femur about the motor-in we use an our exclusive patented foobar“.





 

 

   





‘

*jw’f‘g 4‘





r .





 





Reasons Why You Should .

2" Investigate the SAN DOW

Kerosene 32.1mm ENGINE





It run on korou-o coal oil loo"-

ammu. on! molol(wlllout’.ob‘on I:

oqulpnont — otu-to without crank n3—

runl In oitbor dirootlun~tbrottlo [ov-

orood—Ioppor and tnnlr-ooolod—opood

controlled while running—no ”ow-Io

valve. — no goon—no uprookob— only

three moving pom—light wolghl‘ oully

. potable—grout po'or—otnrh on“: at

. [my degree: boiow uro- oompioto ready to





 





 





 

 





 

 

   

 





 

 

     

   

 

 

 





m-ohlldron opt-to ohmnlow hot

prlooo hood on normal out put—80 :3

,- ‘ manor-book trial-401:3" Ironclad gnu-

- com Shoo. l 1-3 to 18 boroopowor.

h-ndo postal today for boo wologwblob

1;“: how Band" will be uooml to you.

o burn-L Pocket w Ind



mmmon‘o canal-dong}.

. (302)





 

 





 

 

 





 





Is to get in the

money-making class.

There are thousands





in

I

I

what we offer — what the other fellow offers an for your money ? We , : 0f farmers in America

I

I

I

U





who have modo roll

nonoy formulas—not

merely alivinx. but a for-

tune of from 825.000 to

$100,000. Week by week

The Breeder’s Gazette hello

how to make more

moneyonthefarm



and to Ink. It

ooolor. 81.00 per



Ask for a
. ~. my.” .. -.—





 





o





 





336—24





@ '"iliiillllIlllillllIlIlIlIIIllllllIl!lllllllllllllllillllllllllllllIilllllIllllIIIlIllllllIll]IllIllIlllllllIlllllIll-fl





Markets.





llllllllllllllllllllllllllllllllllllllllllllllllllllllllIllIII|illIlllIlllllIllIIIllIIIIIIIIIIIlllllllllllHllIlllllIfi

GRAINS AND SEEDS.





March 9, 1915.



Wheat—Wheat values have fluctu-

ated between wide margins during the

past ten days. On Saturday, Monday

and Tuesday an advance of 18%c was

recorded on the Detroit Board of

Trade. This sudden upturn of prices

is due to domestic as well as foreign

influences. It is believed that the op-

ening of the Dardanelles will not only

be a more difficult proposition than

was at first anticipated, but will also

offer the bears in the grain market

less relief than they hoped for, as Rus-

sia has comparatively little wheat to

send out of the country at the present

time. The U. S. government report

shows 152,903,000 bushels of wheat on

the farms in this country. This is a

smaller amount than dealers had fig-

ured on. Then, too, the farmers are

not selling wheat liberally even where

prices rule high, and in many cases

where they are inclined to let go, the

roads are so poor that they cannot de-

liver the grain. The growing crop has

suffered in some sections-of the 0 un-

try. Argentine cables are also bu lish,

and the general demand from every

quarter is becoming more urgent. One

year ago the local quotation for No. 2

red wheat was 98c per bushel. Quo—

tations are as follows:





 





E





 





No. 2 No. 1

Red. White. May.

\Vednesday . .1.44 1.39, 1.46%

Thursday ...... 1 37 32 1.38%

Friday ......... 1.36% 1.31% 1.38%

Saturday .......1.41 1.36 1.43

Monday ...... 1.49% 1.43% 1.51

Tuesday ....... 1.55 1.50 1.56

Chicago; (March 8):—l\lay wheat





$1.55; .luly $1.22 per bushel.

Corn—Corn values have advanced.

The amount of this grain in the hands

of farmers is estimated by the govern-

ment at 910,894,000 bushels. This is

less than dealers had calculated the

amount to be. Farmers are not sell-

ing liberally and the visible supply

shows a decrease of over a million

bushels for the week. A year ago

No. 3 corn was quoted at 621/20 per

bushel. Quotations as follows:

No.3 No.3

Mixed. Yellow.

\Vednesday ......... 72 73





Thursday ........... 72 73

Friday .............. 71% 72%

Saturday ........... 72 % 73 1/n

Monday ............. 3... 74

Tuesday .............. 3 74





Chicago, (March 9).w—May corn 73c;

July 740 per bushel.



0ats.—~A large decrease, in the vis-

ible supply and the small amount of

this grain reported upon farms by the

government were factors that made

higher oat prices. Another influence

was the advance in wheat. The fed-

eral crop report gives the quantity of

oats on farms at 379,369,000 bushels.

One year ago standard oats were quot-

ed at 411/20 per bushel. Quotations

are as follows:





Standard. White.

No. 3

Wednesday ......... 56% 56

Thursday ........... 57 56%

Friday .............. 57 56%

Saturday ........... 57% 57

Monday ............ 58 57%

Tuesday ............ 59 58 %

Chicago, (March 9) .—May oats





57%0; July 530.



Rye.——Values show further decline.

Market dull. Supplies are small. No.

2 spot is quoted at $1.14 per bushel,

which is 50 below last week’s price.



Beans.——Business is lifeless, with

prices off 10c from last’week. Detroit

quotations are: Immediate, prompt and

February shipment $2.95; May $3.15.

Chicago trade is tame with lower

prices ruling for white beans. Red

kidneys steady. Pea beans, hand-pick-

ed, choice, quoted at $3.20; common

$23fi>3.15; red kidneys, choice, at $3.25

@350; at Greenville and other pri-

mary points beans are quoted at $2.70.



Clover Seed.—Market is easy and

lower. Prime spot $8.50 per bushel;

March $8.50; prime alsike $8.50.





FLOUR AND FEEDS.





 





flout—Jobbing lots in one—eighth

paper.sacks are selling on the Detroit

market per 196 lbs., as follows: Best

patent $7.60; seconds $7.20; straight

$7.00; spring patent $7.80; rye flour

$7.10 per barrel.



Feed.——In 100-lb. sacks, jobbing lots

are: Bran $28; standard middlings

$28; fine middlings $32; coarse corn

meal $30; corn and oat chop $29 per

ton.



Hay.——Quotations are steady. Car-





lots on track at Detroit are: New,

No. 1 timothy $16@1%50: standard

$15@15.50; No. 2, $14. 0@15; No.





cloverand mixed $13@13.50.

Chicago—Demand good for choice.



Prices steady. Choice timothy $17



18; No. 1, $15@16; No. 2, $13.50@14.





Lyn-ax. sag.





THE MICHIGAN FARMER





New York—Higher. Prime $22; No.

1, $21.50; No. 2, $19@20.

Straw—Steady. Detroit prices are:





Rye straw $7.50@8;



straw $7@7.50 per ton.

Chicago—Rye straw $8@8.50; oat



straw $7@7.50; wheat straw $7@7.50.





DAIRY AND POULTRY PRODUCTS.





Butter.—-—Market is dull but prices

rule a half cent lower. Extra creamery

281/20; firsts 26%0; dairy 21c; packing

stock 170 per lb.



Chicago—Demand is light and the

supply good. Prices are unchanged.

Extra creamery 29c; extra firsts 28@

28%c; firsts 25@26c; seconds 23@

24c; packing stock 17%c.



Elgin.—~Unsettled market conditions

prevail and values are uncertain. A

fair expression of the market: feeling

would be 281/20 per pound.



Poultry—Market is firm with de-

mand good and supply light. Prices

are higher. Live—Springers 15%@

16c; hens 16@17c; ducks 16@17c;

geese 14@150; turkeys 200.



Chicago—Light receipts and a good

demand make market firm. Prices on

fowls and springs are higher. Turkeys

14c; fowls 11@16%C; springs 14@16c;

ducks 160; geese 8@‘9c.



Eggs—Market is active with supply

large. Prices are slightly lower.

Fresh stock sells at 180 per dozen.



Chicago—Due to increased supply

an easy feeling prevails. Prices are

10 IOWer than last week. Miscellan-

eous lots, cases included, 17%@18%c;

ordinary firsts 17%@18c; firsts 18%0.



VeaI.—Quoted steady at 12%@130

for fancy, and 10@llc for common.



Pork—Market is steady for dressed

hogs, light weights selling at $8 per

cwt; heavy $7@7.50.





FRUITS AND VEGETABLES.





wheat and oat





 





 





Apples—Market is active and well

supplied. Baldwins $2.25@2.50 per

bbl; Greenings $2.75@3; Spy $3.25@

3.50; Steele Red $3.50; No. 2, 40@5OC

per busheL ‘



Chicago.-—A steady feeling prevails

but there is no change in prices as

the supply, is large. The prices as

here quoted are for refrigerator stock.

Baldwins $2.25g.‘2.50: Kings $2.75g>3:

VVageners 3122561250: .lonathans $3.25

@375; Greenings $2.75@3; Northern

Spy $2.50@3.50: eWstern box apples

are selling for 90c(rr*$2.25 per box.



Potatoes.—~Oft'erings are liberal and

demand fair. Carlots 35@37c per bu.

At Chicago the market is weak with

prices lower. Michigan white, in bulk,

are quoted at 30@36c per bushel. At

Greenville potatoes are quoted at 20

fir‘23c per bushel.





The wool trade has been quiet the

past couple of weeks, and the aggre-

gate of sales has been comparatively

small. Prices, however, are firm and

nobody seems to think that they will

decline for some time to come. Fleeces

are in limited supply with Michigan

delaines at 33@34c; 1/2-blood comb—

ing, unwashed 34@Il5c; 3/3-blood do.

36@37c; 1/4,-blood 34@36c. Fine un-

washed clothing 26@27c; 1é-blood do.

13063310; 3/8-blood do. 31@320 at Bos-

on.





 





GRAND RAPIDS. -



’1‘he egg market is off to 16 and

17c, with outlook for continued weak-

ness until buying for storage begins.

Buying for storage will start at about

150. The butter marketds also off,

with dairy quoted at 190. Potatoes

are still lifeless, with quotations be—

tween 20 and 25c at. loading points.

Beans have slipped off to $2.75. and

even lower than that at some stations.

Wheat has also been making sensa-

tional losses, with $1.30 as top price

at present here. Oats continue at 55c;

corn 75c; rye $1. Poultry is scarce,

with dealers unable to secure stock

at 13c live weight.





LIVE STOCK MARKETS.





March 8, 1915.

Buffalo.



(Special Report of Dunning & Stev-

ens, New York Central Stock

Yards, Buffalo, N. Y.)



Receipts here today as follows: Cat,-

tle 100 cars; hogs 60 61. (1.; sheep and

lambs 45 d. d.: calves 1000 head.



With 100'cars of cattle on our mar-

ket here today and Chicago reporting

15,000 and not able to send any live

stock out of that market to any other

market. our market was active from

start. to finish and from 15@25c per

cwt. higher on nearly all grades, ex-

cept extreme heavy grades which sold

fully 40@5OC per cwt. higher, owing

to good demand and there being only

two or three cars of that kind on the

market. The market closed steady

w1th the opening and we think the

turning point has now arrived when





1 these cattle will sell decidedly better





from this time on than they have sold

in the past six weeks. Our advice 'to





@ shippers is to buy cattle that are fat





as there is no call for feeders or;





stockers here and anything in that

line haste go to butchers at a very

mean price. ‘



We had about 60 cars of hogs here





today and a higher market on every-





thing. Extreme heavies sold at $7.25;

pigs and lights $7.40@7.60; mixed

grades $7.40@7.50: strictly yorkers





generally $7.60; roughs $6.25@6.50 and

Stags $5@6. Market active and the

close was strong with a good clear-

ance.



The market was active today on

lambs and sheep, with prices steady

with the close of last week; most of

the choice handy lambs selling at





$9.90. Look for steady to shade high- h





er prices the balance of the week.



We quote: Handy lambs $9.90@10;

100 to 120-lb. lambs $8.50@9; cull to

fair $7@9.50; yearlings $8@9; bucks

$5.25@5.75; handy ewes $7.25@7.50;

heavy do $7.25@7.40: wethers $7.75@

8: cull sheep $5606.50; veals, choice

to extra $11.50@11.75; fair to good

$7.50@11.25; heavy calves $6@8.





Chicago.

March 8, 1915.

Cattle. Hogs. Sheep.

Receipts today..16,000 25,000

Same day 1914..24,765 29,007

Last week ..... 39,461 165,101 58,812

Same wk 1914-..41,782 118,531 107,586



Shipments from here last week

amounted to 8,657 cattle, 32,018 hogs

and 7,172 sheep, comparing with 18,-

934 cattle, 30,286 hogs and 31,468

sheep for the same time last year.



With a fresh rigid quarantine by the

state of, Pennsylvania announced to-

day, forbidding any live stock ship-

ments through that state, there were

few eastern points in a position to re-

ceive stock, and despite the small cat-

tle receipts, early buying was restrict-

ed to butcher stock, which was in fair

local demand at steady prices. Low-

er prices were bid for steers, with

prospects that late sales would show

a small decline. Hogs started off a

dime higher, with sales at $6.50@7.05,

but later the improvement largely dis-

appeared. Hogs received last week

averaged 223 lbs., comparing with 227

lbs. a year ago and 235 lbs. two years

ago. Sheep and lambs sold fairly early

at nearly steady prices, some nice

yearling wethers bringing $8.90.



Cattle have been in larger demand

from shippers recently, and much

higher prices have been paid than a

fortnight ago, when steers sold at

$5@8.50, the low time of the season.

Naturally, prices were much lower

than a year ago, when trade was un-

hampered by quarantines, at that time

steers selling at an extreme range of

$7@9.75, largely at $7.90@9.25. Last

week steers brought $5.85@9.15, going

mainly at $7.25((i>8.75, with the choice

to fancy class of heavy steers taken

at $8.956i19.15, while good steers sold

at $8.25 and upward, medium grade

steers at $7.65@8.20, plain to fair

warmed-up lots at $7.25@7.60 and light

weight inferior steers at $5.85@7.20.

Ordinary to prime yearlings Were pur-

chased at $7.40@9.10, while butcher-

ing cows and heifers brought $5.10@

8.10, the best cows going at $7.25. Out-

ters brought $4.45@5, canners $3.40@

4.40 and bulls $5@7. Calves had a

good sale at $9@10.50 per 100 lbs. for

light-weight vealers, with sales all the

way down to $5@8 for common to

good heavy offerings. With no ship-

ping outlet for inferior lots of thin

steers, local slaughterers bought them

at» low prices, although they sold much

higher than at the low time a fort-

night earlier. The demand for heavy

beeves showed improvement, although

fewer of the high-priced cattle of long

feeding were wanted than of the fat

medium-priced offerings, with especial

activity in attractive looking consign-

ments of cows and heifers. Even or-

dinary to medium grade bulls sold

much better, and it was evident that

the packers had disposed of the great-

er part of their former accumulations

of beef of all descriptions and were

forced to replenish their coolers with

beef to meet current requirements.

General conditions have not changed

much, however, and the new restric-

tions placed on eastern shipments of

cattle from Chicago prohibited ship-

ments through Pennsylvania, thereby

cutting off shipments for the New

York market.



Hogs underwent much narrower

fluctuations in prices during the past

week than of late, and the packers op-

erated quite freely, being disposed to

leave values about stationary. East-

ern shippers purchased more liberally

than usual, and this was quite a help

to the market, their demand running

mainly on the better class of light-

weight hogs, which sold at a good pre-

mium over all the heavier hogs. Hogs

received averaged well in quality, and

the bulk of the offerings sold daily

within a range of 15c that was close

to top quotations. Recent receipts av-

eraged 221 lbs. in weight, comparing

with 226 lbs. a year ago and 232 lbs.

two years ago. The unusually large

marketing of hogs everywhere this

season has resulted in heavy accumu-

lations ,of provisions, and Chicago

warehouses héld eonrMarch 1 stocksl





 





:...-.......,.. and... . .....x... , i. 4...: .... , 3...». , "...... “we” ,, , ,





MARCHJ3. 1915. »





aggregating 186,225,788 lbs., compar-

ing with 162,152,178 lbs. 9. month ago

and 125,124,987 lbs. 3. year ago. Since

the first of last November slaughter-

ing at western packing points show an

increase of 1,701,000 hogs over the

corresponding period a year ago. Pro-

visions have declined materially in

prices under the generous supplies.

and hogs have sold around $2 per 100

lbs. lower than a. year ago. At the

week’s close hogs sold at $6.35@6.95,

comparing with $6.30@6.75 a week

earlier, with most of the pigs selling

at $6.50@6.95. Prime light hogs sold

highest, being about 200 above prime

eavy.

Lambs, yearlings, wethers and ewes

have been booming widely in prices

during the past week, with reactions

after extreme figures had been reach-

ed. Lambs formed the bulk of the re-

ceipts, with the greater part at times

from Colorado feeding districts, and

they were largely of superior quality.

There was also a large showing of fed

western lambs, although the total re-

ceipts of everything in the sheep and

lamb line were very moderate in vol-

ume, falling below the demand. At

the week’s best time top prices were

$10.10 for lambs, with closing prices

ruling at $8@9.75, while yearlings sold

at $7.85@8.75. wethers at $7.25@8,

ewes at $4.75@7.90 and bucks and

stags at $5@6.50. Lambs that weighed

90 to 100 lbs. brought $8.60@9.50.

Horses adapted for army uses were

as active as ever last week, with

sales of good to prime animals at $175

@200, but otherwise trade fell off ma-

terially, with undesirable_horses sell-

ing lower. Farm horses sold .usually

at $100@150, with the better class of

farm mares taken at $185@215. Com—

mercial chunks sold moderately at

$215fi‘245, a pair that weighed 3200

lbs. bringing $380.





CATAfiLOG NOTICE.





 





 





The Bates Steel Mule. manufactured

and guaranteed by the Joliet Oil Trac-

tor Co., Joliet, 111., is a new principle

farm tractor fully described and illus—

trated in literature sent upon request

by this company. Illustrations show

the machine at various kinds of farm





work.

...... FREE

Insurance .LLF‘

With man:

Edwards Fl

STEE L





Shingles





Special offer by acting now. Free roof insurance

against lightning under our $10,000 bond. And Edwards

Steel Shingles cost less than wood shingles. Last five

times longer. Patent “Tighteotc” Process and Inter-

locking Devrce prevent rot, rust, fire, leaks. Shingles

dipped in molten zinc after being cut—no exposed edges.

y to lay with hammer and nails. Come in handy sheets of

100 or more. Fine for any r00! anywhere.





“OT "ow Gel: till“ movrviey snvirlilg, (mcoEy-dlrectgg-

yfluo el‘: 3 u D I mg 8,863. I

book or bargains. No 867 gives all acyza. i” rite tcoday—NOVIE





TIIE EDWARDS MFG. 00.





317-361 Look Street. .. Cincinnati. Ohio





8an of Pure Bred Horses





; Thirty head of pure bred registered

Percheron, Belgian and Clydesdale,





I‘rom weanlings to aged Horses. Mares and Stallions;

Also fifty head good grade stock will be sold at auction





Friday, March 26,





at one o’clock sharp at Caro Racing Park.',fCaro.

Mich. One year's time on good hanknble paper at.

seven per cent, or special terms may be arranged on

day of sale. For further information write





ERNEST E. JONES





Sod. Tuscoln Connly Horse Breeders Auocintion.Caro.Mich.





 





 





     

 

 

 





 





 

 





 

 

 

 

 

   

 





 





 





 





The Grand Rapids





VETERINARY COLLEGE





Offers a three years Course In Veterinary Science.

Complying with all the requirements of the U. 8.

Bureau of Animal Industry. Established 1897.

Incorporated under State law. Governed by Board

of Trustees. Write for Free Catalog.





152 and 154 Louis St" Grand Rapids, Michigan.





 





 





 





 

 





.9





r MOVE TO MARYLAND

The State for Thrifty Farmers. Delightful, healthy

climate. Land, Reasonable rices.- Close to big



markets of large cities of the ast. Send for free





     

 

 





l“\ descriptive booklet & mag.

.1 g g STATE BUREAU _o IMMIGRATION,

1 ' 65 Hoffman Burldmg, Baltimore, Md.





 





 





 





Ship your Hay in Pittsburgh Illllll

llanrol Mccallroy Son: Company

Pittsburgh. Pa.



Rot-my bank or Morcnntilo Agency.

—-Wp will pay you th hi h t

FARMERS official Detroit. Marketguotfitigsn



for our 9 as 3111 ped direct to us buy express. er

I or Info It will pay you. AMERICAN





:u rmatfon.

BUTTER a: CHEESE 00.. Detroit, Michigan.





> . -—More Money If on

POTATIJES—HAY ...... .. T. ..

L. RICHMOND CO.





 





 





 





Detroit. 21 you- in bullion. Reference your Burke:





- «a
“a... 1....





 





MARCH 13.1915.





DETROIT MARKET CONDITIONS.





Thursday, March 4,1915.





The local stock yards here were

closed a week ago, and are being thor-

oughly Cleaned under the supervision

of Dr. P. B. Scott, United States In-

specter, who had charge of disinfect-

in the Chicago yards. E_very pack-

ing and butchering plant in the city

is also being disinfected under his

supervision. The work here is not be-

ing done as rapidly as was expected

and it looks as though it would be ten

days at least before the yards would

again be open for business but when

they are opened it will be possible to

handle interstate shipments as before

the first quarantine was placed last

November. At this writing only a few

of the cattle yards have been com-

pleted. There is only about a hundred

men on the job, when there should be

at least twice that number. Chicago

Was cleaned in seven days and why

the work here is allowed to drag along

so slowly is a mystery.



On \Vednesday there was over 100

cars arrived for the packers. all of

which went to their various plants to

be weighed off the cars without feed

or water and prices. at their plants av-

eraged as follows for cattle, and few

are wanted, the dressed beef trade be-

ing very slow.





 





.Cattle.

Best heavy steers $7@7.50; best

handy weight butcher steers $6@6.50;

mixed steers and heifers $5.50@6.25;





handy light butchers $5. 50@6; light

butchers $5@5.50; best cows $5@ 5.;75

butcher cows $4. 50@4. 75, common

cows $4@4.50; canners $3@4; best





heavy bulls $5@5.75; bologna bulls





$4.50@5.25.

Veal Calves.





Veal calves sold fairly well at about

the same prices they had been bring-

ing at the yards before the tie up.

Best g1ades $10@10. 50; medium and

common $7@9 50.



Sheep and Lambs.



The best grades of lambs weighed



off the car brought $9.25 on Wednes-





' day and the prices shown below will





prevail for the balance of the week.

liest lambs $9.25; fair do $8.25@8.75;

light to common lambs $7@8; fair to

good sheep $5.50@6.50; culls and

common $3.50@4.50.



Hogs.



Hogs are not arriving as freely as

during the last tie up and prices have

been $6.85 all the week weighed off

the cars at packing plants without

feed or water, and theSe prices are

guaranteed for Vv'ednesday and Thurs-

day’s shipments, and there will be

but klittle change if any during the

wee .





Monday’s Market.





 





March 8, 1915.

Cattle.



Market very dull; prices shown be-

low are at packing plants, weighed off

cars, without feed or waetr.



Best heavy steers $7.50; best handy

weight butcher steers $6.50@7; mixed

steers and heifers $5.50@6.25: handy

light butchers $5.50@6; light butchers

$5@5.50; best cows $5@5.75: butcher

cows $4.50@4.75; common cows $4@

4.50; canners'$3@4: best heavy bulls

$5@5.75; bologna bulls $4.50@5;.



Veal Calves.



Market steady. Best $9.50@10; oth-

ers $7@9.



Sheep and Lambs.



Market steady to 250 lower. Best

lambs $9@9.25; fair lambs $82565“ 8.75;

light to common lambs $7@8; fair to

good sheep $5.50@6.50; culls and com-

mon $3@4.50.



Hogs.





Good g1ades $7 for Monday’ s and

Tuesday’s shipments, off car: at pack-

ing plants.





CHANGE OF SALE DATE.





 





As the last issue was going to press

Opholt Bros. of Glenwood Stock Farm,

Zeeland, Mich, advised us of a change

in the date of their sale of O. I. C.

swine, to March 16 instead of March

12, which date appeared in their an-

nouncement. Note the change of sale

date to March 16 and improve this op-

portunity of getting good foundation

stock at sale ring values.





Corn is still bringing high prices in

the markets of the country, although

it has declined in value materially in

1ecent weess, and the average stock-

111an is unable to see much benefit to

himself fro“.1 feeding corn to hogs,

with hog p1: 2‘ es weak most of the time

and averaging about $2 per 100 lbs.

low er than :1 year ago. The unusual



popularity of fresh pork chops and

masts with meat-eaters everywhere

accounts for the good premium for

choice light weight hogs and the heav-

:ier pigs, with heavy hogs selling at a

marked discount mast of the time. The

early marketing of hogs points to cor-





respondingly smaller marketings later





on, and after the quarantines can be

declared off, there will be a better





I show for sellers.





 





l





   





 





THE/MICHIGAN FARMER 25—331





 





1 4 111m11unnulmuunnmI111nullllllunmumu11m1111I1m1m1mnmummmm1mmIIIummmllmlmm11IImmlmllmlllllllullnmlmmmllllIn p.





The. Whole Top Hot





and the Oven Cool





HESE pictures



speak for theme

selves; study them

—then send for our

Free Book which

gives all the rea-

sons, with proof

of Eclipse results.





Ordinary Range—Half Hot “Eclipse” Range —ALL Hot





See how the heat scoots u the chimney; No shirking the Eclipse Way; all the heat

catty- corner across the top; oing only half under all the covers, using every unit of fuel.

the work; wasting fuel and time. A saving in money and labor.





Built The

Stove

'5 Behind

L the Cool:





Right—

STOVES AND RANGES





Built

Tight

No heating of the oven unless de-

sired. Whole top of Eclipse can be hot

without a big fire. The Diagonal

Plate Control is an exclusive

Eclipse-feature which regu-

lates the use of heat as well

as its quantily.





 

 





--_.“_





 

   





Illllllll.. 1.

. ”-"ll‘l'b ‘ — ‘





 

   

   

   

 





   





 

   

   

 

 

 

 

 

 

 





 

 

   

 

 

 

 

 





IllllllllllIIIIIIIIIIIIIIIIIIIIIIlIIIIlllllllllllllllllllllllllllllllllllllllllllllllllllllllllll





 





 





Eclipse Adjustable Damper msures that

your baking shall be right with least

possible fuel. The cast iron of

which this Joy Eclipse is made is

your best wear- insurance.

Looks fine, and is easily

kept in condition. For

comfort and economy

with long life, con-





 

 

 





 





 

 





'

4‘





 

 

 





Eclipse Stove Company





 

 

 

 

 

 

 





venience and . Mansfield, Ohio

good appear- ‘ ..

ance order I 'Q - ‘ ._..

e ._ A , .. ». . .... ....o

.C -..'. .....

Book " ..

FREE . 9,. -’

0

It will tell you “9&6 by '

about the Eclipse {a 3."

line. Ask for the name 09° .-"

of. our. nearest dealer. 0 "





 





 





 





 





 





 





HERE is a shortage of food in the world now. That shortage will be





more serious a few months f1 om now than it is now.



“It is necessary th 1t we should plant a great deal more. It is necessary that; our

land should yield more per acre than it does now. It is necessary that there should notbe a plow

or a spade idle in this country if the world is to be fed. ”—President lVilson.



To secure the hicrhest corn yields in 01151 ial State Corn Contests is somethimr to be proud of.





 





Look for the Red Steer on





“$152”; 4231,27? The men and boys ”who secured the highest corn yields in Ohio and Indiana during 1914

mm. quality. used Swift’s Fertilizers.





Prize Winners Use Swift’ 3 Fertilizers

Blood, Bone and Tankage Always Win





What Swift’s Fe1tilizers have done In increasing corn yields they will do in increasing the yields of all crops. Get the full

benefit of war time grain prices—make every acre produce its maximum by using Swift’s Fertilizers (Available Plant Food. )





Again per Acre Boys’ One Acre Contest. Yield Der Ac"





Com Shelled

Arnett Rose, Alger Ohio (Ohio Champion) - 53.90 bu.





Men’s Five Acre Contest.





Noni MHen , Eli bth I . ~ - - 5..

s c ry 23 e town, “d llilifbtai-Suu Harold Doster. Hayfield. O. (Champion Cuyahoga Co.) 97.6505.

G. W. Thompson, Letts, Ind. - - - - 104.22bun. Roy N Friederadorf, Elizabethtown, Ind. - - — 133.3 _

W“

Paul Patram, Columbus, lnd. - - - — - INLZbu. Sherman Mngaw, Edinburg, Ind. - - - 103.45 buns.

m 1...... - - - - - m... an $11:- sas‘a... .. - - — - - - ‘ new.





How You Can Make a Record Profit This Season





Proper Tillage, Good Seed, Crop Rotation, (which includes To Dr“; Your Wheat The wheat you not In last Fall

3. legume) Barn Manure and Swift’s Fertilizers (Maid. m grtmu- my be dulled or brudcaateda mailebmadmopted ma a'xuiuufuionlfé



Haiti-ed) enables you toincrease your yields from year to barrow rout-3;: gulf: 11:; 21313:) '11::

year and add to the fertility content of your soil.





ehoieedgflthe ugh: fertiliserdf:not ’01,:er emu” vitalbuntnortnnee Swiféte Fertili-

Small increases will pay for Swift 3 Fertilizers mm Food on y away, e a ‘ the m"

at preSent grain prices. 4 to 7 bus. of corn pays for 200 to 4001119.;





102 Babel: of OahperAcre 3.3.; %m33' “gifh’géél' 2:3;





worked into thebe soil by

wheatwill notbe





 





Stoslms. otwheator5tosbuo.ofoetapoysformotoaoolbs. The “as“, sw'ft’ perm A.“ M .1“) mm

. .m M I. all m prom 80 to 1m busllelssof «13:13:21.1 by using Swift's Fertilizers. are producing

3k the farmers who have used Swift's Fertilisers (Em Swift’ I FertilizenA (A We Plant Food) give firearm on outs and enable

€900.11: wifltellyoutheyueobhiningmbfl «new and: 301132001! stand of clover or alfnlf “coil Moro-

Obi-halo eon-.lOtoIG bushebofwhut, sonny-chum august '59 continuous 'fififsam Them

1 C M ”k h

line between hot' dry weather. nuance“ “3.55342?





Profit I[by the experience of others— use Swift'l Fertilizers (Am than?

M! M) Myhereaseyourprofiu. adhlvyuinghifteF-filhuumdyourmwmm





lfyoucnnnotbuySwifi’oFertixc’ol’n-yowlodmmum PLACEYOURORDERNOW. ‘

swine. COMPANY, - - Dept. c 1.1.st - - ancncqua. L





 





 





vb LEARN All GTIONEERING WW—Po-mo- -1... «rum-gm .. in...





and em School and boom m “'1‘". gm“; ,1,“ ’m‘.h_°"

fin” " “h 11° 9‘9““! "lgwwfigfl hing: guru .1 “.017... £31.? in'. no 5.1533... no:

"School “A Auctioneer“

fimnmmm cum“): .0.!!!“me mum.





W‘WAN In“: Who moanthlnkgéfl





wlngtigzm filing?“ rt . 'lh

momsmhm. 11. WW WE?“





 





 





/
Made in Ls Balle and

Peru. “1., by Westclox





A Self- Starter for the Farm





For an early call He has two c'alls—a

that fills the fields on straight five-minute ring





time—.for early yields 01' ten gentle half-minute

that fill the bins— reminders to bring you





For a business-like 01;: grafduajly. . l ,

f rm S stem that gets not oun at your: )ewe er s,

a . y . a money order to his makers,

th‘ngs (101,16 on "me “Westclox, La Sails, 111.," will

arid according to plans— bring him postpaid—52.50 in the

Big Ben. States; $3.00 in Canada.





 





 





 





 





 





 





 

 





 





,fore them in dishes.





 





 





 





flanrézd WI N S





W

in 2 Biggest





we: 8.31.§§“1¥v“’i,“5'1mg.2 H ATCHI NC.

CONTESTS





 

 





 





 





DR. HESS

Instant

louse Killer





 

 





 

 

 





 





   

 

 

 

 





e incubator and hatched

3332;01:3- chicke. Think of that.





 





 

 





   





 

 





You can now mietcige‘senoldemoul Ever field

I 40 Egg Incubator } 301'" 3 mile Uce on Poultry

(thickl Broodelr thFerORd 1 o and Farm Stock





 





It kills them as soon as it ets to

them—that’ 8 why it’s called nstant.

Sprinkle it on the hens, masts and

in cracks—put ii in the dust

bath. Seethe name“lnstant”

gnlthefcan—tlhatés/Ehefr louse



1 er ormua e gDr





 





 





Hess (M D.,D

Sitting-top cans. lib. 25c;

lb Except in

Canada and the far

West. It not at your

dealer' 5. write





Dr. less in Clark

Ash

Ohio





. ~ .-

E. J. Reefer. the poultry expert of “3 Main St.

Kansas City Mo. .. is agving away free a valuable

book entitled White Diarrhoea and Bow to Cure



keontainsscientific facts on whitediarrhoeo

and tells hsow to prepare a sim le home solut. on that cures

this terrible disease over nigh and actually raise998per

cent of every hatch. All poultry raiser-s should certainly

write .Reefer for one of these valuable FREE books.





Prairie Slate Portable Ilover





Here is I quickly above:- that has made good

among thousands critical bu ers. Constructed of cal-

vanized steel, 11 ight in weight, heavily insulated

economical in 01 consumption

Adapted to any brooder house.





 





 





 





 

 

 

 

 

 

 





A Bucomgebefi. uipment at low cost.

edemand for a

dc“ able _y rue broode





$.60. rite c(or CstalOC





Prairie State Incubator 00 '~'

123 I‘ll sum. MEI cm, PA.





SHOEHAKEB'G Po u LTRY





BOOK on

' snd nun-nu ior 1915 in: over 200 peg



many colored plates of fowls true to life. [Hells

all about chickens. their prices, their care. di-

seases and remedies Allsbout Incubators, their

prices and their operation. All about poultry

houses and how to build them. It's on encyclo-

" is of chickendom. You need it. Only 150-



(2:10. QSBOEIAKEB. Box 911 Import, Ill.





 





 





Why Pay More I





For only $10 you

can get these two prize-

winners complete, ready

to run— guaran

years—on 30 days' trial-—

money back if not satis-



fre' ht





Every

tear





Contests





prov



with “33.3 mak

wonln the b Na t'lHa

1041-11-13





Contests of 1

fishers“





Thinkofit. t.veFi

36 Days FREE

‘ I





diastof





nlldin

teen. in.-





ere orl

it. These

21m..-





FRElCHT PAID

LAST 0F ROCKiES

Wiseo mine have hot water heat.





d bl double glass. doo

on e :figm boilers. self- e rs.





i=0 Nursery under nut!!! will

ed. I CALIFORNIA REDWOOD no

‘9‘ e ." finished in” naiur color—not pain had to cover





or at imsy material; Incubator-ll

‘°' “"d “we. 3335'.





up cheap. I!)

Bmodee i be wi

, 1, amass. find it so





. °Wbfik

% B Fin fit #33me 1916 “catalogléflm dose-thing this ”$998. -wisnl outfit.“

Wisconsin monas'roa COMPANY, Box 112 Rules, wig;





it not slush-d





 





 

 

 

   

   

   





 





 

   





 





 

 





 

   

   

   

 

 

 





   

 

 

 

 

 

 

 

 

 

   

   

   

   





MARCH 13, 1915.





~Care and Feeding of Early Chicks.





 





EAVE the chicks in the incubator

until they are 48 hours old. Sup~

ply plenty of fresh air during



thls time. Remove to brooders thor-

oughly warmed and dry, with a hover

temperature of 98 degrees near the

outside of hover. The first. few days

in the brooder we see to it that they

have the proper temperature, plenty

of fresh air and sleep. The first feed

we give is fine No. 1 mica spar grit,

fed so they can’t help but find it. Then

water with the chill taken off is plac-

ed before them in such a way that

they can not get wet. We keep a dish

of grit, charcoal and oyster shell be-

fore them from the start.

The First Feeding.





For the first five days we feed the

following mixture, slightly moistened

with sour skim-milk, five times a day:

Eight pounds of rolled oats, eight

pounds of bread crumbs, two pounds

of sifted beef scrap, and one pound of

bone meal. In addition we keep the

following mixture in shallow trays al-

ways before them: Three pounds of

cracked wheat, two pounds of fine

cracked corn, and one pound pinhead

oatmeal. We scatter a little green

food over the cracked grain mixtures.



Between the ages of five days and

two weeks we feed the above dry

cracked grain mixture in the litter

twice a day instead of keeping it be-

The mash mix-

ture we continue feeding in the same

manner with the exception that at





lthis time we cut it down to three feed-

;ings a. day, and in addition keep the

same mixture di'y always before them

‘in self-feeding hoppers.

3are two weeks old,

,mize in labor we cut down the wet

dnash feedings to two a day, continue

feeding the same grain mixture in the

flitter and the dry mash in the hopper.

iThe above is a very popular method





When they

in order to econo-





of feeding chicks, and has given uni-





ivei'sal satisfaction.





Essentials of Raising Chicks.



In the rearing of early chicks the

following factors should be remember-

ed: Proper temperature, careful

watching, fresh air and sunshine, ex-

ercise, green feed, cleanliness and an-

imal food.



When we first place them under the

hovers we watch them carefully, the

first few days, so they do not wander





away from~the hover and become





chilled. We teach them to find their

way back to the source of heat, and

do not allow them any great distance

from the hover.



1n the winter we aim to keep the

temperature, if anything, a little high-

er than in warm weather. A tempera-

ture of 100 degrees in the warmest

place of the hover is about right. We

watch the chicks more than we do the

thermometer. We aim to heat it 11p

high enough so that when we look at

them the last thing at night, the

chicks will all be near the edge of the

hover curtain, and the majority of

them sticking their little heads out

from underneath the same. The tem-

perature should not be so high as to

drive the chicks entirely from under

the hover.



Fresh Air Essential.



We believe in giving our chicks all

the fresh air possible. We have a lit-

tle opening in practically all the

brooders, covered with a hinged mus-

lin covered frame which we use as the

weather dictates. We believe in hav-

ing the exercising room too cold and

sweet smelling, rather than warm and

ill-smelling. After the chicks are

three or four days old we allow them

to get in the sunshine; previous to

this time we deny them this privilege

because, until they know their way

back to the source of heat, theyare

apt to huddle in the sunlight trying? to

get warm. We never allow this be-

cause at this age they are very apt to

get chilled.



We make our chicks workfrom the





 





start, and after the fifth day all the

grains are fed in a deep, loose and dry

litter. We use oat or wheat straw cut

into three or four-inch lengths and

about three inches deep, the first

week, six inches deep the second

week, nine inches the third, and after

this 12 inches is not any too deep. We ’

see to it that the grain food gets well

down into the same in order to make

them work for every particle. On

pleasant days around about noon, we

shovel away the snow, throw down

some straw in front of the exit and

allow them to run outside for a short

while, watching them for the first few

days so as to get them back into the

110101 as soon as they begin to huddle.





Green Food for Chicks.



We feed a little green food every

day from the start. For this we like

cabbage and a little onion cut up very

fine, and scattered on the litter. This

is fed sparingly at first and increased

as the chicks grow older. Sprouted

oats free from mold is excellent.



We feed a little animal food from

the start in the form of sifted beef

scrap, mixed with the dry mash mix-

ture. We do not believe in allowing

the chicks to have access to a dish of

beef scrap all the time. because some

of them appear to have an unnatural

liking for it, eat too much and

contract bowel trouble and diarrhea

as a result. We test all of our beef

scraps before feeding to our chicks by

pouring boiling water over them and

noting the 0d01.Afl'91‘ the second

\1 cc , if we can get it we keep a dish

of sweet skim- milk before them in ad-

dition to the drinking water.



In the roaring of early chicks we

lay great stress on the factor of clean-

liness. We clean under the hovers

every other day, and the exercising

pens are cleaned out once a week. We

disinfect thoroughly after each clean—

ing. The feeding dishes and drinking

fountains are cleaned regularly once





 





a week. The milk dishes are scalded '

twice a week and washed out each i

day.



New York. F. W. KAZMEIER.





 





CLEANING UF’ EARLY.





 





The fight on lice and mites should

begin by giving the poultry house a.

good overhauling. The sooner this .

work is done in the spring, the better. i

A louse or mite killtd while the

weather is yet cool, means thousands

less to contend with later on. On the

first warm day of spring the house

should be given a thorough cleaning.



The perches and nest boxes should be

removed, the walls and floor glvena

good sweeping, and the: entire inside

of the building treated to a good coat-

ing of whitewash. The whitewash is

made more effective as a killing agent

by adding from two to five per cent

carbolic acid. In applying the fluid

one. should be careful not to get any

of the wash on the face or hands.



he whitewash is best applied with i

a spray pump, as the pump will not

only put the fluid in cracks and crev-

ices that cannot be reached with a

brush, but it does the work in one-

tenth of the time that-would be re-

quired in doing the job with a brush.

The farmer who keeps many hens can-

not afford to be without a spray pump,

since _the saving in time effected by

the use of one will, in one season’s

time pay for the pump. The hand

spray pump can also be used for other

purposes, spraying vegetables, shrubs,

small trees, etc.



Controlling the Red Mite.



The red mite, or spider louse, does

not live on the fowls. It lives in the

cracks and crevices on and around the

perches and dropping boards. After

the house has been thoroughly white-

washed, the perches and dropping--





 





boards should receive especial attend

should be thoroughly~

If the mites:





tion. They

painted with kerosene.
MARCH 13, 1915;





 





Belle Cit





GET the whole wonderful story of the





lo 11'!

.. World’s Championshl Hatches inm great Freeg‘ook.

Hatchmfil‘acts." '1 9 winners 0 the 21 Worl 's

Champions up lintches tell the story of their money—m -

mg. pnze-wmnmg success in their own words. Book

gives on full information, facts, proofs and culture

about igh contage hatches everywhere wi h World's

Champion lle City hatching outfits. 327,000 in use.





Write for“natehing Facts.” Today

A Postal Brings I!





it tells everything. illustrates the Belle City Incubator

and Broader in actual colors-shows what makes the Belle

City the 21 Times World's Champion~gives facts about

hatchm success, bigger-and better than you have ever

heard 0 before. 8 gwes





My $800.00 Gold Offers





Here’s the eatest chance ., Ge

you ever had make money 3

with a hatching outfit. Con-

ditions so easy every man.

woman. boy or girl ma re-

ceive bifigestpn‘y. k



ves fu particu arsofmg



2. 3 months’ Home Tee

dfler. my 10 year money

back guaranty and my low



rices. Freight repmd.



0 after the gel . Don't

let anybod get a .

of you. sin quick

from Buffalo, ansas

CRY. Minneapolis or

Racine. Write now.

Jim Rohan, Pres. "





.0". City Incubator Co.





THIS KEY TO

POULTRY

PROFITS





FREE





THIS famous

Uld Trust book ‘



has started 80,000 geople making

poultry profits. The ohnaons offer

no untried experiment in chicken

raising. If. the Old Trusty Isn't all

that's promised we trade back. An





OLD TRUS





   

 

 

 

 

 

 





 





lo: 1 4 Racine. Ulla.





 





 

 





‘ r





 

 

   





 





10 years.

Makes big hatches

in . coldest weather.

Shipped _on 30 to 90 -

da 9 trial. Order

shipped day received. 8”“

wills in Big hes leek.





"heme.“ #12310





 





 





 





 





 





$985 For 135 Egg an.

National Incubator

Ill-135 Chick lat. m





National Metal Incubators

are built after U. S. Gov't ’





 

   





 

 

 





 





Specifications. All metal ,-

body. 30 days e Trial—10 l

yegr aran . from -_d

this a . Money refunded if unsatisfactory. ~

Let us send you Free "Poultry Pobls’

NATIONAL INCUM'I'OR c





 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

   





 





Roof Protection at a low

cost against Fire, Storm

and Lightning





The danger from lightning

can be avmdcd, roof fires

pever occur and the weather

as kept out w en your buildings





are roofed With





K anncberg





Metal Shingles

"We Pay tin Faith"





Lightning never damaged a Kannev

berg shingled roof. because they are

fire-resisting. Rain, snow, heat and

cold stay outside. Karim-berg Shingles

need no repairs. because they resist

rust. don't rut, crack, buckle. curl. nor

fall Oil. Can be laid on low-pitch roofs

and always look well. Give clean

cistern water.





TREE—Send for our big Catalog at

once and you'll SAVE BIG MONEY -

on roofing and you get the best protec‘

tion. Take advantage of our LOlV

FACTORY PRICES. Catalog shows

many designs and sizes. ,



Kamcbcrg Shingles come singly, 8 ' '

to a sheet. or in clusters 2 feet by any

length lrom 5 to 10 feet. You can put

them on quickly. Easy to lay.



Write for catalog and give dimen-

sions of roof, so we can show you how

little it will cost to get perfect roof '

protection for years.





Kan-short “Sims: Ceiling Co.

1440 noun. shim Canton, Ohio





   

   

 

   

   

 





"son-«neonuunounee-o





mm ”ilummfltoeesoooilludofl‘





THE MICHIGAN FARMER'





were very troublesome last season,

and the perches are rough and full of

cracks, affording many hiding and

nesting places for the pests, it would

be a good idea to touch a match to

the oil-soaked perches, and let them

burn until the outer wood is thorough-

ly charred. When this is done one

may be absolutely certain that the

perches are free of the pests. If the

perches are made of; smooth, sound

pieces and application of kerosene

without charring, will answer.



If the house is whitewashed early

in the season, and given a fresh coat-

ing of the wash at least once a month

during warm weather, lice and mites

are not likely to get a foothold.



The nest material should be chang~

ed occasionally. Straw makes a. poor

nesting material for the reason that

the hollow straws make fine hiding

and breeding places for lice. Excel-

sior or hay are better nesting mate

rials than straw, but in the writer’s

opinion, the best nesting material is

tobacco stems. Lice cannot stand the

odor of tobacco, and when stems are

used in nests, the material will last

an entire season. The stems should

be. lightly covered with excelsior or

hay. T. Z. RICHEY.

AN ECONOMICAL WAY OF CARING



FOR CHICKENS.





 





 





 





Regarding the chicken coop, my ex-

perience has taught me that a very

warm and expensive coop is not nec-

essary for utility. Single boards well

battened on the outside and tar paper

on the inside is sufficient, a dry

ground floor, and instead of a tight

ceiling merely strips or poles, and a

layer of straw about a. foot thick on

top. 011 ordinary days open the door

or windows, but so as to avoid drafts.

It is a mistake to think we must make

summer conditions in our coops to

have hens lay. Hens will lay if kept

in an open shed, if other conditions

are correct. Of course, it kept very

cold it takes more feed. Don’t crowd

them, and keep no more than about 50

in a. flock.



Give them a mixture of bran and

middlings in the form of a stiff dough

in the morning. Give them plenty of

litter to Scratch in, and keep them

busy by making them work for every

kernel during the day, such as wheat,

buckwheat, millet or anything that they

like, and that does not fill them up

fast. In the evening give them corn,

either on the cob or scattered in deep

litter chopped in short pieces. If L.

W. will follow my instructions as

briefly stated, he will find eggs within

eight or ten days. I tried meat scraps

and found them all right, but if the

meat scraps were absolutely neces-

sary to make hens lay, and everybody

who kept chickens wanted to use

them, I fear we would be up against

it. I do not use them, and yet, my

hens lay. Crushed oyster shells should

be supplied. Another mistake is the

idea that a fat hen won’t lay. My ex-

perience is that a hen in poor condi-

tion will not lay. Plenty of feed, ex-

ercise, light and fresh air keeps them

in a healthy condition and that is the

laying condition. L. V. SOLDAX.





 





TH E EGG-EATI NG DOG.





To break a dog from eating eggs, di-

vide a heaping teaspoonful of tartar

emetic into eight or ten doses; break

oil the end of an egg, empty :1 part of

the contents and stir into the re-

mainder left'in the shell 8. dose of tar-

tar emetic. Confine the dog in a room

0r tie him and give him the doctored

egg. In an hour or two he will be

trying to turn himself wrong side out.

As soon as he is over neausea give

him a. second egg and a third 'if he

will eat it. When he refuses to eat

the egg and lets it he by him for sev.

eral hours untouched, pry open his

mouth and force the egg down his

throat. Afterward you may trust him

in, your henhouse.





 





27 ~39





 





BalggAll-Sleel (lilvlraclors and Plows





 





 





ket for five years an





steering





TRAN





 





 





Oceana Co. JENNIE WILLBON.





105 Bates St...





 





 





BATES ALL-STEEL OIL TRACT ORS have been on the mar-

are not experimental.

STANDARD DESIGN with two drive wheels behind and two

wheels in front. They have POSITIVE STEEL GEAR

MISSION and gears are WARRANTED NOT TO

BREAK FOR A PERIOD OF FIVE YEARS. You should

consider the life of the tractor as well as the price.





We not only guarantee the horse power on the belt and draw bar but guaran-

tee _to do as good work plowing, harrowing, etc., as you have been in the

habit of domg. This holds good on hilly fields and stony land.





A cardfor our catalog which will tell you all about our two and four plow outfits.





DON’T FORGET WE USE KEROSENE AS FUEL

BATES TRACTOR COMPANY





They are of





LANSING. MICHIGAN





 





 





 





 





Get MORE Cream





by usin





Sample Speed Indicator





on your Cream Separator. Fits any make

of separator. Attached in two minutes ; easy

to adjust; control speed of machine; abso-

‘ utely accurate; can't gctout of order. Price

83. Agents wanted. Splendid proposition.





Simple Speed lndlcalor 60., 331,33





 





' GREIDER'S Fine CATALOGUE





and calendar of pure bred poultry; 10 varieties illustrated ind

' described. many m nuural colors Perfect guide to poultry

"lien—lull of lam Low prices on stock and eggs for batch-

ing Incubators and broaden. 22 years in business. ’You

need (INS noted book. Send 10: lot n—goday.





, [aimless :. :x n' o. 50. 111mm,};

“50 for 25 to 50 CHICK “0V5





Made of Galvanind Steel.

box. 54f





 





 





 

 





in any ' e and durable.

heal. All complete. ‘lncubaior book (rec.





We make 7} different articles. ‘ .



WENDELL lNCUBATOR C0., Holly. lid.

‘ —- l d t k. 1'



Eden“ "If“ 'ay Guaranteed pod glee s on or





sale reasonable. Write us for

North Lewisbugr, 0‘





HODE ISLAND REDS. Cookerele 82 to 85: 15 3a

$2. Plymouth Rock cockerels 5m 12 lbs.. accord n,

to age '2 to 85: hens 5 to 9% lbs. according to age: l.)

as 82: Tom Turkeys H to 38 lbs. according to e: 83

to ; 10 Bags 84. A. E. ORAMTON. Vassar. ich.





am. Bronze Turkey Eggs, $3.00 per lo. Mono





order or Draft. from 1 yr. hens of fine plum

RALPH WISE NURSERIES, Plainwcll, Michigmi.‘o





—-P l t 2 ' -

Blllfll noel: .22.: 203 crazrlhlbznll'd:

Vl. O. OOFFMAN. R. No. 6, Benton Harbor. Mich.

null-In soon as. 222°

J. A. BARNUM. Union City. ”Michigan.

Pine Broil While 0rpingionsf€§§§°5fiElf.“ 1125?" $2333





from heavy laying strain. Catalogue on request.

MRS WILL“ IIOUGH. Pine Crest Farm. Royal Oak, Michigan.





HOYILTOI IllEli POULTHI’KQK’ 5.13 'v’iii‘il'enil‘oeofii

Cookerels st 82. $3 and 8:3; from prize winning stock.

D. F. VALENTINE. Bup't.. Temperance. Michigan.





While Wyandolln Eu: 332% 222522223 abnd‘i‘alih

per 100. A. Franklin Smith. Ann Arbor. K‘Ieichigan.

Barred Plymlllllll floch'awiiilfi’éflg :53 332222":

OSTRAND B 31108.. Morley. Mich





 





 





 





 





 





 





 





 





 





 





prices. Btalter's Ilabbltry, able prices.

. -Cooks. Oookerels. Pallets and

POULTRY 'hfl. “Imam: Hens. and eggs for sale. Send for

1915 Circular. David Ray, 202 Forest Ave.. Ypsilanti, Ml('l’l.



s

' -—B d-T ~ '. 5'

30 000 Ghlcks Fill l 9l5 W" 'l.“‘°"” *3?" ”3353 ‘8 W133- 1 '

’ EGG-A- n POULTRY RANCH. arshail. Mich

I t hea‘v ] 1 mi 9 of Poultr , Ohioks ig Beautiful hen hatched, farm raised Ringlet Barred Rock



0111:0813; each. ynntlyulbg. Buynyour Chick: Its the B Sold on approval. Ckls. and females 32 to $5 each, Brecdin‘





only sure way of getting a satisfactory hatch every-

time. My booklet No. 2 seal; to any address. Free

upon request.





I. B. F R O NTZ,

Route No. 2, McAlisterville, Pa.





Gholce Barred llocll Cookerels $1.50 Each,

Bourbon Red Turkey Hens $3.50 each.

Toms all sold. All pure bred.





lilLLCRES'i‘ FARM.

KALAMAZOO, 3-: MICHIGAN.





"Hoosier Strain." Established In 1892.

Winner of II first. prizes at Chicago. Cincinnati and

Indianapolis in two years. no kerels. some

8001! oook birds. hens and pulls“ in any number. All

stock shipped subject to ap royal. rises reasonable.

Write your wants. O. ri ver. 8.7, MatthewmInd.





Eggs for Hatching

Barred and White Books. Winners attle

Creek. Three Rivers. Union Git and Mich. State Fair.

Riverview Poultry Farm. Box . Union City. Mich.





Slam '1 B d—African noose. Turkeys, Ind. Banner

‘ I. ducks. Pearl gulneae, Ii. & 8. (l. B: I.

Beds, W. Ply. Rocks. B.L.W'yandottes. & Poland China

swine. Prize winners. Best eggs any kind $2 per setting. Write

(or quantities and stock. French F. l P. Farmsludiugtomhiich





BUFF ROCKS. in°“"s‘l'1§“."-i“-. “mu is ”its

333 ; u I I y en ,

100; S. 0. Bull {Leghorngs hlgsvyclatyers. £1.50 15. 37.50

- ( a a cane.

mkglfl’iwfi’rnghofit Box D. Lawrence. Michigan.





668 for hatohlns from pure Toulouse geese. ten

A for ll. . ho a ew antlers for sa'e at $3 each.

MR8. AMY SOUTH ORTH. Allen. Michiun.





—— 1



'lllIE IEIIIOIIAEIIICIS (2?.‘g13‘iagfipfifig‘éfifi

. . o DY



513 3133?"? efliirERogigéfMOfi-ohpghd April is

ii.’ iil'nnii’c'iinnuii‘h son".L &yt::.?klflun.





[‘6’ from one and two year old dark ”19'1qu





bred Bourbon Rod Turkeys, $3.50 fo

NELLIE J. WHITNEY. lonia, Michigan.





' -Prize winnl birds. Van Buren

While “End."u 00. fair. fingggs £1.60 postpaid.

GEO GE SHEPARD, Hartfor . Michigan.





 





from prise-

winning

at B





—f I . Th -

aloulouso Genders .3”..£‘..a°.. 2.3:.

proli 0 layers. GEORGE KOBL. Boys] Oak. Mich.



—l'ine cooker-





s. c. Re '0 RED 9]. .nd 93...

.l. I. GRAHAM. FLINT. MICHIGA .

BIG Ursulysing Poultry—260 brings 12 magazines





to be noose-In]. invaluable to in.

ners. lighten Poultry Breeder. Battle Creek, M oh.





 





 





pen.l5 females and male ‘10.Circulars..lohn NorthonJllareJiich





 





RPINGTONS: Single Comb white line pedigreed rim-k.

Eggs and chix cheap. Only a few pens and cockerels for

sale. Order early. M. E. THOMPSON, Redford, Michigan.

FOR SALE -—Iiose Comb Brown Leghorn

from the leading strains in





Americmalso Mammoth Pekin Ducks. Stock and eggs

in season. CLAUDIA BETTE. Hillsdale. Michigan.





shy Chix $10 per 100, Brown and White Leghorns, Barred





Rocks. Buff Orpingtons. White Wysndottes. lo E .

RIVER RAISIN POULTRY FARM. Dundges. Mi'c'ii.





Immoih While Holland lurks] Egg: gamma?



order earliy. Irst come first served.



RIVERVI W FARM, R. No. 8, Vassar. Michigan.

—P k . 200— ' -



man also caucus“ screens:



81.50 per setting. Fred Astllng. Constantine, Mich.





 





 





Rinflet Barred Book Oocksrel Birds of uslit).

T irty years the standard. a a-piooe £5 for too,

PLAINVIEW STOCK FARM. Borneo. Michigan.





—B. P. k k I

fill Sll best .i‘mofé’fi :fi':.%.“.ii‘:h°i§i§€fl‘.§§3





 





bone. nicely b lees reasonable.





. fine birds.



MRS. EARL W. BARNA RD. 11.13I BannaelMlchigan.

Rhode Island lied Eg . $1.60 15.



n. c- a :v c- post aid: 8 r100 byex'pirees. " strlsfy

customers". Jl NIE B ’ELL, Ann Arbor, Mich.

"0c“ cocKEnEl‘ Alli) veggies.) g ziforfimtkching.

a '0 H! 3811 . 0‘“,



SHERIDAN POULTRY ARDS. B.15.§heli-id:§.fllch.

65 'mds—Ohiekens. ducks. geese. turkeys. sulnese.





hares and dogs. Stock and eggs reasonable.

00-psge catalog free. B. A. SOUDER. Box 55. Seller-ville. Pa.





I

Chicks:

booklet.



ILVER LACE!) GOLDEN and WHITE “'YANDCT'I‘ES—A line





lot of White oockerels weighing 6 to 8 lbs. at n and ’3

cash. Browning’s Wyandoces Farm, Portland. Michigan.





 





 





We ship thousands. dlilerent Varieties. prices

ibt. order now for spring delivery. free

roeport Hatchery. Box 12. Freeport. Mich.





:. 1:. will. Lugluusfrilfl careers 3:320“





eggs M per 100. Also White Pekin Ducks.

dueklines. Bunnybrook Poultry Farm.Hillod30.,aMl‘dh.





hlte P. Rocks. Pekin and white runner ducks.





White guineas. as and day old ducks d hi k .

H. V. HOSTET .ER. St. Johns. Migimgn? 2;





Willie leghm: liay-OId-chicks. w. ”‘""‘“i§°°c"‘“°‘





faction to all our customers. MA ITY

POULTRY PLANT. Box C. Charlotte. Michigan.





DOGS.





lrainsdliu ring Fox Handrail? 31%." ”3233

m”.





I

w. E. war. Holmeevllie. Ohio.





FOX, COON AND RABBIT HOUNDS





Write for circular.





Broke to and field. Prices right. For and

Coon houn pups $5 each. Stamp 2 reply.

11. c. LYTLE, Fred urn. 0M0.





 





I.





BEE IIIVES. SECTIONS,

cull Fraudulent, Snickers. sic.

Send‘for catalog A. Thorough-

bred Italian bees and queens.

Ask for catalog B. -





 

 





 





srnnv nisrari in





IQ “ART GRATIS.

Both w and paper baskets.

an waxiined paper poo

3.14 In 1st and 2nd some fox-81.



six for catalog 0.





'H. H. WIT D SON. Ion 685. LANSING. NICH- -
MARCH‘13, 1915.





 





 





 

 

 

 

 





 





 

 

 

 

 

 

 

 

 

 

 

 

 

 





 





A Hardwood Post and a

Tight Staple Can’t Bother

This “ Puller” ‘ .. V /





No. new ‘ "-

m0. $1000 ,1 \1...

Here is the handiest little tool a

farmer can ha1 e in his “kit"—a combined staple puller,

driver, wire puller, splicer and bolt grip. Forged from high-

est grade crucible steel and oil tempered. Takes hold of a.

deeply driven staplewith a bull dog grip, and pulls it easily.





You can 't imagine what a time—saver and bother-killer this





/,/ KEEN [(UTTER





Staple Puller





in about the farm until you try it. Like all other Keen



Kutter farm tools, it is fully guaranteed. If you find a defect



of temper, adjustment or balance in a Keen Kutter hoe, rake,



scythe, fork, shovel, axe, spade or corn knife, your dealer 1s author-



'ized to refund the purchase price. The same broad guarantee covers



the Keen Kutter line of carpentry tools, pocket knives, razors, shear:



and table cutlery.



Send for our Home Furniture Design Booklet lllo.AS 976-





“ The Recollection of Quality Remains

Long After the Price 1': Forgotten.”

Trade Mark Registered. --E. C. SIMMONS.

If not at your dealer’s, write us.

Simmons Hardware Company

st. Louis New York Philadelphia

'loledo Minneapolis





 





 

 

 

 





 

 

 

 





Sioux City Wichita





 





 





 





FRICTION REDUClNC MOTOR OIL





You Always Have That Film of Oil





Lubrication begins the instant the mo-

tor starts if you use POLARIN E.



POLARINE flows at zero. and maintains

the correct lub1icating body at any motor

speed or temperature.



Last year (1914) American motorists

used 6, 926, 614 gallons of POLARINE

——2309' carloadsl Conclusive evidence

that drivers get service and save

motoring trouble by using

POLARINE.



Buy it in half barrels and cut

down up-keep cost. You

can make a big saving.



POLARINE is made

by the Standard Oil Com-

pany, the great service

organization.





Sold Everywhere

Standard Oil Company





(AN INDIANA CORPORATION)





Chicago, U. S. A.

(308)





EllllllIlllllIlllllllllllllIlllllllillllilllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllfl

s Grange. :=

EllllllllllllllllllllllllllIllllllllllllllIIIlllIllIllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllfi





A, BIG BOOSTER.





 





A Big, Big Booster Meeting of Five

Counties—such an event is entitled to

be reported in capitals and with ex-

clamation pointsl! That is what they

had at Reed City, February 12, when

the Pomonas of Osceola, VVexford,

Clare, Mecosta and Lake had a. point

session. Two halls, the home of Rich-

mond Subordinate Grange, was the

place of entertainment. and that in-

cluded all the helpfulness of Rich-

mond's large and loyal membership.

It was a great day. D. E. McClure,

Deputy Secretary of State Board of

Health, was the special speaker and

he declared it to be the “grandest 10%

cal meetinghe ever attended.” And

why not? For weeks the Osceola peo-

ple had been planning and lookingfor-

ward to the success of the day. When





,folks do that, success is assured be-





forehand. Master I}. D. Clark and

Lecturer Mrs Or'ah Tucker are 11o-1k

ers who lock out for (let ails and lend

a hand 01111115911 es 11~"'l1111e111r needed.

They provided in advance success of

the sort that succeeds.





There is not room to give the full

program but there were addresses by

Pomona Master E. D. Clark, of Osce-

ola, J. J. Totten, of Mccosta, Hon. Clay

McNitt, of VVexford, W. J. Alley, of

Clare, Ensi 'n Griflice and S. M. Bailor





 





 





how trap and any they owing-how strongly they m

and give bettori mservice

than any gate of



pipe, or who.“ half' the cult.

“CAN'T-SAG" Gate. are mulch lathe Int-gout gate factory in the world. You can

to 16 feet-d or 6 inch board





hutth





”muamfllflmfl





Farm Gate on 30 Days FreeTrial

mvnmmuo MONEY oowu— 1'11 Pay the FREIGHT





I want to send you one (or more) of my {mood “ CAN’T- SAG" Gate. to one on “your own farm— 30

and“ don '1: log. " Se.

loath-n you can make all wood gates-Inn longer





GUARANTEED FOR 5 YEARS





length gate you want—6 feet



a. artrun brace-



Self-lockin“..I hinge ”preventg ga being ruined by Itock. Gates ship _ed ready" to hang, but l

on





FREE-IQ Holley ant you to see for yourself that they‘ ‘cnn 't Iag’

made. Mm





get

Each board in double- bolte d between eight angle-lush: :1" ”ht

a gates extra anger-o





luggeat that mgouy order gm: the On ig money. I} ship ow steels





they mlcl save

anagram gum 0m 111“”.ch FREE on.

Imam" old Wong ! Roe econ drill to 01‘.wa prices“ will lurpr'ise you. ‘:88 d





Alvin V. Rowe. Pro...





 





ROWE MANUFACTURING CO..m7 Mam. 8L, GALESIURG, ILL. (7)





 





.;,§'.5§".‘*Qr~' ‘. ‘ . - ,





For Your Hand Lantern





Put a Columbia B 1ttery into your hand lamp

and you re ready for the dark. Steady, de—

endable, com cnient. Costs no more—last

onger. Buy them anywhere, but insist on the

name—Columbia. Maker” 8 name on every

battery guarantees the quality. Quarter cen-

tury repute. Used for all battery purposes.





Mado' 111 U. S. A. by

. National Carbon Company

Cleveland, Ohio





Convenient F ahnestock Spring Clip Binding Post!

——no extra charge.





,1





 





Please mention the Michigan Farmer when you

are writing to advertisers and you will do us a favor.





 

 





of Lake, and School Commissioner

filoxburgh, of Osceola. There were

recitations and songs galore by young

and 01d; there was a great dinner ror

more than one hundred; then more

ifolks came, and more talks, including

two by Mr. McClure, who spoke upon

i“Education for the Sake of Living,”

and ‘fPreventable Taxation.”



Altogether, 225 people enjoyed this

festive day together, when 1101 only

their social and mental life wa as stimu-

lated, but the local pride and 101alty

of a goodly section of our state was

encouraged and strengthened.



J1:.\'N11-: Bcr;r.r..





 





l





 





AMONG THE LIVE GRANGES.



'lngharh County Pomona Grange met

With W'heatrield Grange, Saturday.

February 20. The day was an ideal

one and a good 1.101111 was in attend

ance A sumptuous dinner, arranged

in keeping with the patriotic (lav, was

enjoyed by all.



In the absence of Vl'orthy Master

Young, the meeting “as called to or-

der by Overseer Homer Murphy, Jr.

Roll call of the Granges brought out

many things of interest as well as

need of considerable 11 01k on the part

of the county officers as well as mem-

bers, in order that this year may be

a prosperous one. The meeting was

then given over to the lecturer? who

gave the following program: Song,

“Stand b1 Arrrerica,” men’s trio of

Wheatfield Grange; paper, “American-

ism,” C. l‘ Ilarbt Williamston:1ecita-

tion, “George “’11 shington’s Hatchet,”

by Master George Steadman; piano

duet, Misses Frost and Sadlcr, of

W'heatfield Grange, which was beau-

tifully rendered, and followed by an

encore reading, “A Perfect Tribute,”

Mrs Lydra Collar. 0111 good fortune

placed on our prgo 1am Mrs Irish, who

has been for years a Pomona Lecturer

in the neighborhood of Tr'aVers11 City

After some remarks com. er hing Grange

work, she recited an original poem,

“When Our Boy was There,” the time

of which was duringr the Spanish- Am-

erican war. It was 1er'y pleasing, al-

though touching. A song,r by Miss Lois

Webb, 21 little lady of five years, who

also gave an encore. Reading \Iiss

Ledah Robinson, of Ingham Grange.

“The Teachers’ Insurance Bill,” out-

lined by Miss Carolyn Bray, of Oke-

mos Grange. A humomus reading in

dialect “as given by Mrs. Keeleri? of

Alacidon Grange, followed by a sec-

ond selection. An interesting talk on

use of commercial fertilizers, by J. J.

Oakes, of VVilliamston Grange. Pro-

gram closed by all singing “America.”

At close .of the program a fiifth de-

gree session was called and degrees

conferred on several members. Ad-

journed to meet with Telephone

Grange in Leslie, Saturday, Maren 20,

Where an interesting program for af-

ternoon and evening is promised—





 





 





 





 





 





Grace‘ Fisher, Lecturer.





' benefit. - 1





 





l- 11 lIlillllllllllllllllllllll'lllulllllllllllllulllbl"'1""llllllllllllllllllllllllllllllllllmll'lllll'lj

, EFarmers’ Clubs 2

ElllllllllllllllllllllllllllllIlllllllllillllllllllllllllllHill' 1'1.- .i1llllllllllllllllllllllllllllllllllllllllllllj





ddress all commonicdtions relative





. to the organization of new Clubs to





Mrs. J. S. Brown, H',0111=ll Mich

OFFICERS OF THE STATE ASSO-

CIATION OF- FARMERS' CLUBS.





President—ell. J. Robb, «Mason.

Vice-president——C. J. Reed, Spring

Arbor.



Secretary and Treasurer—Mrs. J. S.

Brown, Howe l.l



Drrectors—Alfr ed Allen, Mason; Jos-

eph Harmon, Battle 1 '1'11‘1k; C. B. Scul-

l_1,A1mont; (.‘.T.Ha111line,Alma: W'.

K. crafts, Grass Lake; Edward Burke,

St. Johns.





FACTORS lN SUCCESSFUL CLUB

WORK.





 





 





 





Farmers' Clubs are quite like people

in the matter of initiative toward a.

progressive growth. 1A great many

people are of an iridiuring mind and

temperament which leads them to

study the problems in hand and apply

new methods where reason tells them

such are needed to produce the most

Satisfactory results. Other people do

not seem to have this raculty of initia—

tive and plod alon: A in the way to

which they are accustomed until some

object lesson is brought forcefully to

1111111' attention 11l11'1-l1 illustrates the

desirability of Charmin, <' their methods

either in principle or m- detail. So it

is with Farrrrers’ t‘lubs; there are

some Clubs which take the initiative

in the variation of their work, oft-

times, of course, meeting with discour-

agements and failures, but generally

in the end accomplishing some results

llrat are well worth while and which

remain as object le>sons to guide oth-

111' similar organizamms t0ward the

most attractive lines of Club work. In-

lerest in l1 armer ’(_‘lub work as in any

other phase of life depends not so

much 011 the big undertakings as on

the minor features which lend them-

selves to the irrstrumtion and enter.

Iainmentment of members. One Club

will profit by condwting a boy and

girl contest of some sort, another Club

makes a neighborhood fair a feature

event, still another holds a succossful

Institute, and so on down through a

long list of special features which

prove an attraction 10‘ the members

and the people of 1111.... tornrnunlty.



In recent reports Irorn local Far-111-

ers’ Clubs in Minnesota some new

features are noted, one being a brass



band of seventeen pieces maintained

by the Farmers’ Club of Stirling town»

ship, Blue Earth county. So great was

the enthusiasm of the young men e11—

listed in this enterprise that each pro-

vided his own uniform and instru-

ment. In commenting upon this band

idea for Farmers’ ("lubs the report

noted states that the Farmers’ Clubs

of Minnesota are mart-hing forward to

success so steadily that music seems

a necessary accorrrpaniment. Perhaps

a little more music in our Michigan

Clubs would make Club work more

generally attractive to the people of

more farming comr::t:nities in the

state.



Another idea coming from Minne-

sota is the use of button badges which

are worn at joint 1111: etings and other

places where members assemble. The

advertising value of this plan is con-

sidered well worth while, and in the

case of joint meetings, a badge of this

kind serves to identify the wearer

with his particular organization.

Many other, feature-s .might be men-

tioned, but these .11zlll- suffice to em-

phasize the point that the interest in

Club work will everywhere be stimu-

lated if members will but use more

initiative in varying special features

of, Club work and whenany such fea-

ture has been successful'in the stimu-

lation of interest in local Club work,

it should be passed along for the ben-

efit of other Clubs to the end that the

movement may receive a. maximum





u
MARCH 13, 1915.





Farms and Farm Lands for Sale





FOR A LIST of the best farm bargains in the best

”an basal.” a: radius.“ Mmm’. Michigan.





GOOD FARMS





J. D. TOWAR.





IMPROVED FARM LANDS





in Manitoba and PSaskatchewan. close to R. .Schools

duOh re.hes Prices and terms reasons le. Apply

to CEO. BDWELL. Walker House. Toronto. Ontario





MICHIGAN FARMING LANDS





it . 1 GI dwin and Midland

5:an tflglng'angl Ed”: oasyte n a Clear-title. Write

for maps and articulars. STAFF iL‘LD BOETH R8.

15 Merrill Bu ding. Saginaw. (W. 8.). Michigan.





BARRY COUNTY mFARMSfigfifigggpwflmg





se ti n i the Sta ains.

ngte‘ioglistnA. BIINH'AmaTBIIiae. Hastings.

farm





WANTED~T0 hear from owner of

or Hunimproved land or sale.

C. C. BUCKING M. Houston. Texas.

wanted in exchan





for psrospemu

lili’i'ond Firm General Merchani isi i181 busineni do-

g.923000cash business per ear





d La East Lansing

gigunrties. "in“ California lands.

East Lansing. MIchI Igen.





and located ins.



thriving Michi an town. 0t or bus ness interest:

require time o resent owner. Her re sa realo oper-

tunity. Apply fini‘. care Michigan Farmer. roit.





Central and Western Michigan Farms.





Fertile. dark loam and clay. hardwood. clover. grain



and dairy farms. the best. Send for literature.



Wantto mite:I with reliable dealers.

GEORGIA° AV LIEW. Cadillac. Michi_g___an.





I NEED MONEY!





Do You Need An Bil-Acre Farm?

Only 4 miles from Gladwin. 5 miles from Beaverton.

Fine clay loam. fine lIcality. 2 telephones andB

D. 60 acres well improved balance fine unimproveld

land. This 80 acres is a part of my -acre farm

has only a new 4- room cottage house. no Iother build-

lugs. but youtili‘an ’I’Iuildoo vbvaifiseto suit. as Iahrzll alsake

tile rice on at we r atonce or a on are.



{3.6 GREYNOLDS. GLADWIN. Ml EGAN.





AUCTION





Registered Holsteins

Complete Dispersion Sale March 25.





30-lb. cow ani 3 beautiful daughters. 5-“).

daughters. Others with records u t024.751bs. 'ween

nd cad. all females but t ree calves. Every

an A. B. 0. record. nearly all

Nearly all anddau liters of

engervelt '8 Count

et thebest.





 





prodIicli'xgflanoimals with

out of ams.

Hen erveld DeKol and Pietertje

Do 01. An Exceptionalo o‘gportunit’n

Mason is 12 miles smthfi of anslng. ies north of

Jackson. electric cars from both cities every hour

Farm adjoining city limits. free transportationto and

from farm. All animals over six months old Tuber-

culine tested. C L. . V. L Auctioneer.

Liverpool sales on i pedigree Co. Managers.





HOBART W. FAY, Mason. Michigan.





BllililliillS’ DIREC'IIIIII.

CATTLE.





ABERDEEN-ANGUS





HERD FOUNDED IN 1900.

Strains resresented consist of Trojan Ericas. Bleck~

birds and rides. only. Black unlityt Ito. ahnil of

rare individuality and merit. eadst he herd

WOODCOTE STOCK FARM. Ionia. Mich.





‘YnsmnEs—One of the foremost dair breeds. The

most economical milk '1' ucers Calves

for sale. White Leghorncoc Duroc J ersey

swine. Michigan School for the Deaf. Flint.Michigan





 





Four Pure Bred Angus Bulls. Extra goodon One

show bull. Eight and nine months old. esI’rioed

reasonable. Inquire I". J. WILBER Clio. Mich.





 





our Registered Aberdeen Anxgus Bulls. from ten

nteeu months old. 3 reasonable.

GEO. HOATHAWAY & SON. Ovid. Michigan.





THE VILLAGE FARM,

Grass Lake, Michigan,

GUERNSEY CATTLE.





 





M'ILO D. CAMPBELL. CHAS. s. ANGEVINE.





FOR SALE

HOWARD of BEACH FARM





Born J uly 9. 19I4.

Sire. Horizon No. 28091. whose dam made 632 lbs. fat

in one year. Dam. Belvidera of Sarnia No. 46531. new

under test for Advance Register. Will make EIBBI'I

400 lbs. fat. Won first prize over Island in 1913.110wa

is a perfect Guernsey in color andi n fine condition.

He will please you or we will return your money and

pay return express.





PRICE FOR MARCH $100.

Other Good Bulls for sale.





CAMPBELL 6 ANGEVINE,





 





COLDWATER. MICH.

For Sale. Eff £122?” gi‘L‘JS'E'EJSW 3?;





JOHN EBELS. R. 1.. Ho and. Mlich igen.





EOISTBREU GUERNSEY COWS. For sale at

Watervliet Mich. mend up. Splendid animals

Address. J K. BLATCI-IPORD. Auditoriun Tower. Chicago. Ill.





HEREFORD; 3532'?“ :glvglidsnd





e

ALLEN BORS. Paw Paw. hfichigan.





FOR SALE





at reasonable prices some

fine young registered





[IN ”Holstein Bulls





cm 3 months to 15

months old, In.A B.

Dams of high butter

records.

ligsloII’s Iislshu' Fsres,

lrssdsvils. Iicligss





Hereford Bulls for Sale‘Xzfii'“ 1.5.111

w some Pollileg bull “edges e‘boult ”pd ill bu. ‘old.



m "5613AW margins Rinaldo}? '05.. I lpena. 551mm...

Bums".





10 sisters from 2 b “.311“. n.81 ssire

brother to Pontiac Korndyke. ”This?

dam h. 2.30 lb. m. I. 1. WWW





 





 





THE MICHIGAN FARMER





Do You Want A Bull?





Ready For Service.





From a grand daughter of The King of the

cuisines. Biredb by a bull that is moreC than a half

brother to the Champion HolsteinC ow of the

World. and whose dam is silo lb. 6% 5 fat dsu hter

of Pontiac Aggie Korndyke who has more :5)

daughters than. any other living bull.

write for pedigree.





EDWIN S. LEWIS, Marshall, Mich.





HATCH HERD.





Ypsilanti, Michigan,





Registered Holstein Frieslan Sires—G. -'

of the World’s Greatest Dairy Sire. They are out of

choice A. ..0 dams. Their sire is:



Half brother to the World's record cow 44. I5

gounds In 7 days. Average record or 50 dame in



is pedigree 31.25 lbs. in 7 days. Average

cent of fat three nearest dams 4. 37. Sires In ”I55:

three generations already have over 500 A. R. 0.

daughters. Prices reasonable so you can have the best.





‘25 DELIVERED. —Handsome bull calf by





b ed Pedl f ijhezd‘. lb sbumr Wilma 321??"

r s m um 8" 1‘ el s

noucs ONT FARMS. Detrgit. Icasigzn.“





HOLSTIEIN BULL CALF. born Oct. 29. Slre' sdam

Kl-lb. cow with 8 30-ib. sisters. Dam a first





calf heifer with record 14.651bs asa two- year-old.

Price 5. W. B. BEA DEB. Howell. Michigan.





HOLSiElii BULL c‘[VE8~3?nN‘5'i>l5ytt‘$tiimd‘i:;-iitg

Michigan. Long Beach Farm, Auguste. Kalamazoo Cc .ilIIcli.





iisgislmd iiolsisis 0aiils‘2“" 0““8? ’°;:f“°fi“..§

baar-{rlg herd bull. out 0192755 lbs





1?. JONES: R. No. 3. on drove, Mich.

Four Is she Holstein Inlis;§:€d§§§5::{;'°fmffifi

advance registry breeding. Price and 8125.

newer c. PIERSON, Hadley. Michigan.





If you do





 





 





 





 





 





 





 





Holstein Cattle‘g‘cfnfii. $2332





ELMER E. SMITH. Redford. Michigan.





ESPANORE FARM.

LANSING. MICHIGAN.





HOLSTEIN FRIESIANS





Herd Sire—Pledge 8 Hard Calamity Paul.

83 A. 11.0 da liters. incu uding a 32. 42 lb Jr. 4-year-

old and a 30.36 3--year -.old Two young bulls sired by

im. Also a few choice females in calf to him for sale.





CHASE s. OSBORN

ADAM E. FERGUSON, i Owners.





Reg. Holstein Bu"





all

White swine. (“pp





HOLSTEIN FRIESIANS.





Herd sire Maplecrest Kcrndyke Hengcrveld the only

sireh of any breed having a dam and grand dam that

each made more than Ian-lbs. of butter' In a car. and

he was sired by the only hull of any breed t at sired

three cows each making better than 1200 of butter

in a year. one but four years old. Maplecrest Korn-

dyke old Is in a class by himself.



A few fine young bulls sired by him from A.

cows for .s‘alle. also a few choice females in calf to



e





m for

D. D. AITKEN. FLINT, MICH.





‘ I I I

A BARGAIN” ONLY” $50... ““33

Holstein Bull Calf. Bes tbiood and bestA. R. 0. back-

ing on si.des % white. Perfect and hand-

some Individual. Bougemont Farms. Detroit. Mich.





High Class HOLSTEINSM his





is headed by Smithdsle Alcartrs Pontiac. whose dam

is the famous Alcartra Polk adot. Have few youn bulls

and females for sale at reasonable prices. Will buy

a few heifers about 15 months. not bred. Farm )4 mile

from court house. SETH B. RUBERT. Howell. Mich.





FOR SALE—Fine 3 year old Holstein heifer

redto grandson of Colantha

Johanna Ladl.) Also beautiful bull calf

GEO.D .CLARK. Vassar. Michigan.





 





 





calves and Herd Bull. Can

all wants in Reg. Chester

. Parhain. Bronson. Mich





 





 





 





 





The; Jersey





comes into maturityearly, ls

long—lived and is often found

makin records even to ad-

vance age. She stands

above all other breeds for

transmit production. Shall we mail

you free a good book on the Jersey?





MAWCMMCATHICLUI.

MILZHSLMWkCIU.





 

 

 

 

 

 





     





 





ufality sired

from hi h

1TH A PAlquoEli. Howell. Mic





J I. Bulls readfifor service. oextra

by acoba’s Fair manon.

producing dams. B





Jersey Bulls ior Sale... mi“ .."“‘h ”“1”“ mfid‘ffi‘gk

semi-omciel test. B.We nor. 11.6. Allegsn. Mich.





erseys. Registered bull caivele to 20 dollars. heifers

not re istered 15 tom dollars. Barred Bonk eggs.

PETE H. DOUMA.R .2. Holland. Michigan.





Filll SALE, WAIlslgisisrsii lsmy Gunfighfimfi?





RMAN I WATERM

Mendowland Farm. :-: An nn Arbor. Michigan.





BIDWELL SHORTHORNS

Registered Bulls For Sale.





Big and strong in rims condition for immediate

use. 16 to mcnt s old. Priced for uick sale.

Albion Stamp 85%?0 by Ch. Shenstone lblnc. in

service. Write or see them on farm at Lake Shore &

Michigan Southern Depot or five minutes walk from

Detrc Toledo a Ironton Depot.





BIDWELL STOCK FARM

Box D. Tecumseh, Michigan





SHORTHORN COWS

FOR SALE.





Two Shorthorn cows. 5 years old in June in calf.

Will calve next month by the Service Bull Adjutant

Duke No 375 52%. ows sired by‘Afl djutante 080.288

They are in fine condition. efi kfor 8213

will take them. Farm 2% miles northwest: of Bivers

Junction. Jackson 00.. P. 0. Onondaga. Mich. ll. .Darliug.





IIIIIIII snoIIIIIoIIII 4°“ b... .I... v 3





Gran May & Otis boil for

sale. DAVIDSON a HALL. Tecumseh. Miohi gnn.





-—Dairy or beef bred. Breeding stool: all

Shudhoms ages for sale at farmers prices. 0 . Crum.

Secy. Cant. Mich. Shortlicrn Bresders' Assn.. McBride. Mich.





 





. 0B SALE—Shorthorn Bulls. red and mans. by

sons of Avondale and Victor Linwood. both Interna-

tional winners. John Schmidt. ii.2 .Reed City. Mich.





DairyN Bred Shorthorns of Best Bates





J. B. HUMMEL. Mason. Michigan.





IHOHIHOHIS: 6 BHOICE lilillit BULLS FOR SALE





W. W. Kn NAPP. Howell. Michigan.





 





'0. I. c. SWIN





ZIP-341





—erte for new rice



list. just out. ave



er sex of Aug. furrow.



”arch and April Pigs.

.Dorr. Michigan.





otlflng fordsgle at meant but vigil take

or r an r. . a rsno a n. .

a p 1p .- .I..I£ Howell. Ovid. 11:12:.





on hand service boars. also

I am also bookin orders for

A.J . GORD N. B. No.2





e ordersIo

free and shipped on approval.





0 I Gig-Good thrifty stock for sale at all



I I times Choice sows bred ffdlsrring

furrow. 'rnn Dnarnn. Munith. u g .

O. I. C’s





ring pairs and trios. not

agin go“; state fair winners.

avonnam smc'iir rams. Wayne. Mich.





o I C.—% sows bred for Spring farrow. 75 Fall





I rge and owth iteyonr wants.

GLENWO hubriocx rfsn. yZeeland. Michigan.





01.0 Choice gilts bred for 530““ farrow.&8et1p pigs

Iserviceable boar weign ing rice no. he ong

bodied and big boned k (1. Alvin V. tt. Grass Lake. Mich.





f the he boned"0 t Bred S we

our“ JBISB 3 :nd fail I’vilyg‘sof ”do: for radio.

M. A. BRA kemoe. gham 00.. Michigan.





0- I. c Gilts bred fig, Ma‘s-ch“ad and yAgar" £11"-

I row“ r s p.

ANiiwfiansvaIigw Micyhigan





o I c’ --T]wc servicable boars sow coming two-yr -

8o bred for March farrow. fall pigs. all

stock registered. 8. J. HOWELL. St. Johns. Ml.ch





Duroc "says: A few choice bears and bred gilts.

AlsoJ 8. Le orns and Bud Rook Cockerels.

J. McNIOOLLyv Sta. ..R No.4 .Bay City. Michigan.





-—A few hoioe ilts

Duroc Jerseys bred m" A .u‘m

Maifsrrew. Fall igseithersex. 8.0. ST A LMAH.





QER B! LAW FARM. ShepherdI Mich his”

DUROC JERSEYS—A few‘ufgltgroareloand 12





CAREY U. EDMONDS. Haulage. Michigan.

.DURoc ems-is: Ii, ::II°W.I:.:.I:.:2.A::





does not suit you return sow after inspecKtionE at Kmfi

expense and et our money back.

FARM. S.L L. §VI G. PROPB. KinderhKoOokF MKich.





0. I. c. and Chester While Swini





50 Gilts bred for March and April furrow. bred to

White Hall Jr. second rizc aged boar Illinois State

Fair. and Allen. Jr. am ion at Wis. State l'air

and toJumbo and Wonder 03. Here area pair of

big ones and are smooth. pecial prices for the

month of February. Service males and fall iflh

either sex. Write your wants and come and v si the



octetsme herd in state. All stock shipped c. o.d .and





ROOLLINGL 2\’IEW STOCK FARM.

R. No 2, Cass City. Mich.



PECIAL on Durecs-I will sell 35 choicely bred



sows. 6 boars. with all Sinners. Send for cat-





aiog. I will ut you on mail ng list Sale March 17

19:5. Phone olinia. H. G. Keesler. (1.me In. Mich.





Dunno JERSEYEESZ‘LL- red ri hi; and p0, riced right.





W. C. TAYL lion. 1! h_Ԥr_s.__





RUROC JERSEYS.





From Prize-Winning Stock.

Write. or better still. come.





BrooiIIaier FIIIII.Ann Arbor,MIcII..n.F.il.1.





gblts for March and April





 





 





 





   





SHEEP.

UBOC JERSEYS— A g. boars ready for service.

11' PAYS TO BUY PURE-Th. BRED SHEEP 0F Ii) Allso Atgg'k giltsh bredn for June rfurrow toi prize-

‘Tbcebsepmsq w no u s or your ns

InnifiiONs on» But! tion. 3F.JJ)DBODZi)chutbONo.D1. Monroe. Mi





 





 

 





 





" ‘» A. '

. . / ' I ’0 0x hrite fmlnfigf Rug-y ce. list.

'1 0 nos.



.4” In .PARSONS.GrandLedQ Mich. at.





ilXFilflil-DWI SHEEP, I0 81001 Fill! SALE.





 

 





 

 





 





March iits bred to son of VII ": steer.

our“ J'“.r0bam IffonOR 1912 Rflash-s. Orders booked

for March pigs E. S. Monroe. Mich.

(yiéziitvcli Herd Dnroc Jersey Swine. Established 1888





GLANCE W'rite for description. prices and etc.

HART. PROP.. Lansing. Michigan.





 





M. n. GANSSLE Y. Lennon. Michigan. J. H.

—Y a I — 1

king." fioghrdlfn'lgh'iinmbrglfnblIghbaAfiszmseId‘dltuBglfl: DUMB JERSEY: gamma?! 'Plili‘r': 'Iigtntsrfi‘zifm





shire swine. Elmhurst Stock Farm. Almont. Mich.





Wool-lluiion Shropshirs Emmi?“ m, dfimmim





 





 





 





 





out stock quick. tlsia siredb lmn rted ram. Write

t.oday MAPLEWOOD TOOK A1 M.A .legan. Mich

H008.





 





“Top-Notch” Holsteins.





Extra large this young bull. 29% white. born Oct. 4. 1913.

Dam has ocfllal record offl .mbs.bntterln7days

117. 50 lbs. in IO dgs. Bire' s dam isa22.64 lb. 4 yr.-old

danfhtefi' of a30. lb.c



Me ERGON FARMS 00.. Howell. Michigan.





IIOLSTEINS Filil SALE





5 Good Bulls, ready for service.

10 Very Choice Bull Calves.

2 Two-year-old Heifers, bred.

1 Six-year—old grand- daughter of King

Segis, due in December. _





L. E. CONNELL. Fayette, Ohio.

FOR SALE Registered Holstein Bulls





ready for service. and bull calves. also females.

FREEMAN J. FISHBECK. Howell. Michigan.





Hoistsin-Friesian Breeder“h I... 332:3, {mtg

represented. D. D. AITKEN. Flint. Michigan.





Iltlllillin llillE llli Illllilll Itililill.

FEE III

Breeder of High Grade “Holstgin Catge. Lists and

prices upon application.





JERSEYS





write. MR 8. P.

Kalamazoo Mich.

0.1M J. o. d





 





 





—For list of stock for

sale and Jerse facts

H. WALKER.

If a breeder and a member

send list of stock for sale to the above





' ' —Jersoy Cattle. Yorkshire Hogs

hill. Flim‘iodd Oxford Sheep. Write for what” you

want. COLON C. LILLIE. Coopersville. Michigan.





THE WILDWOOD JERSEY HERD





Jersey Cattle. rich estys Wonder

11ml?“ one of the best sons of chy Majesty is at

likeda head of herd. His sons show ty





hte od i l and class and

rsane pr no a a

milk. hnWrite your wants. lTlvinrgglden. Oopsc. Mich.





ow of high testing



MAPLE Lane heRegister of Merit Herd—Tuberculin

tested byth Government. Forsale.bulls.bull

calves and heifer calves from B. of M. dams and grand-

dams. and Hood l'arm sire whose dam' s and grand-

desn' I records average 812 lbs. of butts. Irvin Fox. Allegan. Mich





FISHERTON FARM JERSEYS-T2332:





arm Pooie' 9th. from Scarlets fmrit

FISHERTON “has. Pontiac. Mlchigasfiam





3" ' ' 5" BRIO ”nears"

cavern. spnnvo os'rocu runs.

*- A'lmn county. mom“...

JERS EYS_“’:.‘£"° sou. bIlIIIADY FOR





LINE FRED JERSEY COWS ND' BBIFBRS. m





orduesocn. Iecalves i i tourist

nmox’rmfd‘w" arising:





 





 





 





Dqucs 8t Victorias‘go§3¥.?§£°§gfi'Af§;§

of Superba. Defender. Much Col. rigrlits'endeothers.

Afew yuan: boars 0hr Lowell Mich.





Berkshirel Hogs—Choline gilts8 bred to furrow in March





W. J. BAUMAN. Burr Oak. Michigan.





POLAND CHINAS‘fldmfssziecabw-





A. G. MIADE. Colby Ranch. Stanton. Michigan.





f th i t

POLAND CHINAS rzady fgr Eegvicyewéowggraiid

for spring farrow. A. A. Wood a Son. Saline. Mich.

IoIIIIII cums-gyms]: gum 'rmr Tm"

boars. L. w. BARNES s: SbNfi.i Ii'yron.y 'a'ii'giyim'





Bows and (3in bred for March and

Poland chill! April furrow Also fall igs.satisfactlou





 





 





 





 





 





and A ril. Also a number of Barred Plymouth .

Book 000 erels. Chase'sStock Fum.Ii..1Io 1.Marlette Mich. “u“nmmd' 6' w HO LTON K“ ““‘W' “m“

BERKS H I RES‘°”3£; eiérogmoogr LARGE "PE 1‘. C -3th.: Xuflfin‘ffii‘éfi i3:

choice. all guaranth G. H. HIDE .Almont. Mich. bred iiltl- W J HAGELSBAW Ausnatn. Mich-





 





IEBISHIHES: fifri‘i‘logiifigmdfii‘ ‘“ 3.“:





A. A. PATTUL 0. Deckerville. Michigan.





AMPSBIBE Swine—Breed stockf of all age

from most ular strains. rite for breeding.

Ins Ion invl . l'lo dM ere. 3.9 9Decatnr Ind





Hampshire swine. some good Bears for Breeding and some

Fall pigs both sexes at right prices. West Wind Farm.

Pontiac. Mich. 131. P. Hammond. owner. N. A. Wiser. manager.





 





 





CHESTER WHITES. August and September pigl. from



sirens-Chickasaw Bud. Modeler. Bronson King. Acernficate



John Gintling. Bronson. Michigan.



0 ' c F." H. ~0hoice gilts bred to one of the

boots in the State.





.THO PSON. Rockford. Michigan.





of registry with each pig.





 





 





o

30" WEIGHED 952 L38.

A 23 MONTHS 0





‘ lONiA GIRL





I have started more breeders toena-

cess thauan and’man8 living. I his":m thelargest and fin.

est had In very one an early developer,

ready forthcmarket at six months old. I want to

glass one hogin each comma nit toad ise my



erd “Write forn my plan.“fiow to Make Money- from



”O. '- IIIJAHII.IoIe.IOP PW





 





o. I. G's—STRICTLY BIO TYPE. For 13 yrs.





been breedi crsise and

“filth With quality. th" uhy Prince :n‘em of the largest





ce..2ud rise under

r Months beer at Mo. Inter State Fair 1‘31!A 900*





for III-1e at all times. i

uswm MAN 5 srocx FA"IIIi°h.'§:'i“II.rIqu.MIchI





o I c ~9Drine boars all sold. We have some

' ' l fine fall pigs read

was saunas s,soit Grand so. Mllchlgan.





o I C’.—0 A”! boar. Giltsabred folr 35.5.0.1 and

f‘rfii'. n . s

I pay mt... ’e. r. ANDREAS. 53mm: Ills.

I ~1havesutrefisel toflast ri

9:..‘253. in" 5".“ “A“ °'°“‘" 2“" ‘3

o n m 0

one 1%.me N viii: m





 





lgi Type Poland China Boers and (lilts lenty of

si se and eatfiualité‘. I know I can ease cu.

ROBERT M BTI E. . D. No. '1. East ngs. ich.





STRICTLY B. 'I‘. Polai Ila—Absolutely none largerr or

better. My breeding represents best herds in U S.



Bred gilts and fallnpigs at bargain prices. Satisfac-



tion guaranteed. rank D. Kruger. Revenue. Mich.





-Thetypeth t I . ih

EOLflDBEdHlNAeSithandsgeys-big xiii; dvu gr:

sppmo BROOIE ‘i'iARM. Time on... Michigan.





Largo Iirsin 1‘. ii.





 





 





—Can spare one of my herd boars.

sold for no fault. a few spring





and fall boars1 will be sold at bargain prices. a few

choiceb 71%“, better breeding.to tobe had ateny

price. ARTZ. Schoolcraft. Michigan.





 





HEAVY}: BONED POLAND CHINA SOWS. Bred

fall Pi‘fces bolth sexes. pairs not akin. Also older

boars. o.w Robert Nave. Pierson. Mich





 





Poland Chi-ass. either sex. all ages. Somethinggood

at up libw rice GBar’ains inbo arsyread for ser-

vice. P. D 8. Grand Rapids. Mich





THEFABMERS' BOG. —Butler' s Big Boned Prolific

Poland Chinas grow bi kee easy. mature early.

ready for market at to men Because we' ve

b them that way for more than’ I) years. 50 big

boned. long bodied. sow also 100 fall pigs at farmers

griees. Buy one anda m o more money on your



0 History Free. J. C. BUTLER. Portland. Mic.





boars by Big Smooth Jumbo. Greatest

nteflta .lbs'148 . st 11 Inc. These are are





big bone sold at farmers

all or write. Wm. Waffle. dCldWIIOI' hill”?





~Largesti in Michigan. Bred

hereT 0P. c- Gilts siredbyandhred

the great boar. Big Desmoines No.194417.wei

. at31 Gmen thaand out of sows that wei

bs. Gilt. of archd and A ril ferrow we

%0 to 3%1bs.00me and see. xpenses paid fuel: as

represented. I. LIVINGSTO Perms. Mich.





—Bred Its. s ring pi .

Mlle F0013 ire gist akig. Olt‘ifi'hfllifrledI sows in r

spring ferrow. BACON Ridsewsy. Mich iLIL.





Mule Foot Hogs, both sexes,” ‘“





Satisfaction gumnteed. LONG snos.. aim ”ICES.





so murmurs-39.35.28.316 gas: to:





Bosh-.1. I. Docks. ABS. Homer. _M__icl_.





YORKSHIRES





 





1c Type



I “:33:



ongb a

C





:mwm‘mrmemmus:
THE MICH-IGAN FARMER





 





 





 





Rheumatism





Just put a. few drops of Sloan’s

on the painful spot and the pain

stops. It is really wonderful

how quickly Sloan’s acts. N 0

need to rub it in—laid on lightly

it penetrates to the bone and

brings relief at once. Kills

rheumatic pain instantly.



Mr. James E. Alexander, of North

Harpswell, Ma, writes: “Many strains

in my back and hips brought on rheu-

matism in the sciatic nerve” I had it so

bad one ni ht when sitting in my chair,

that I had1 to jump on my feet to get

relief. I at once applied your Linimcnt

to the afiected part and in less then ten

minutes it was perfectly easy. I think





it is the best of all Liniments I have

‘ ever used.’.' '





‘ 81. MS

LINIMENT





Kills Pain





At all dealers. 25c.

Send four cents in stamps for a





TRIAL BOTTLE

Dr. lEarl S. Sloan, Inc.





   

   

   

   

   

   

   

   

   

 





   

   

   

   





3;! illlllllllllHilllllllllllllllllllllllllillllillll|lllllllllilllllllllilllllllllllllllllllllllllllllllllllilllllllllllllg‘

s . g

_ V} eterinary.‘ =-

3|lllli|iIllIiilllliilllllillllIIIllIllllliillllilllllIllililillillllllillllll|lllilllllllllll|Illllllllllllllilillllillifi





CONDUCTED BY W. C. FAIR, V. S.





Advice through this department is

free to our subscribers. Each com-

munication should state history and

symptoms of the case in full; also

name and addreSs of writer. Initials

only will be published. Many quer-

ies are answered that apply to the

same ailments. If this column is

watched carefully you will probably

find the desired information in a re-

ply that has been made to someone

else. When reply by mail is request-

ed. it becomes private practice, and a

fee of $1.00 must accompany letter.





 





 





Navel Infection—Have lost four of

my ten calves and those which died

were only sick two or three days. EV-

ery one of them had bowel trouble;

the cows carried their calves 270 days.

J. T., Osseo, Mich—If you will apply





ihealing remedies to navel of young





calves as soon as they are born you

will perhaps protect them from diarr-

hoea and scours. First the cord should

be tied one inch from the body, stub

painted with tincture iodine, then ap-

ply any good home-healing antiseptic

remedy twice daily.



Dog Has Mange.——I have a coon dog

that is troubled with mange, or some

other skin ailment which produces

great itching. The hair falls out in

patches and the disease seems to

spread. W. P., Pinckney, Mich—Ap-

ply one part coal-tar disinfectant and

20 parts water twice a day, or one

part sulphur and four parts lard three

times a week.



Indigestion—Barren Mare.—-—I have

a horse that is low in flesh, discharges

from nose, but his appetite is good. Is

his ailment catching? I also have an

old mare that is quite thin and fails

to get with foal. W. H. K., Walton,

Mich.——His teeth may need floating, or

he may have diseased grinder tooth

causing nasal discharge. Give 1 dr.

of ground nux vomica, 1 dr. powdered

sulphate iron, 1/“; oz. ground geniian

at a dose in feed three times a day.

Dissolve a teaspoonful of salt in a

pint of water and rinse out nostrils

twice a day. Give your mare 1 dr. of

ground nux vomica, 2 drs. of ground

gentian and 1A, oz. of Fowler’s solu-

tion ata dose three times a day. She





 





Dept. 22 Philadelphia, Pa.





 

   

 





 





 





a





may possibly be barren, and never

get with foal.



Diseased Molar Tooth—About two

months ago I bought a mare which

was in a run-down condition; she has

a good appetite, is fed ground corn

and cats with plenty of alsike and tim-

othy hay, but does not take on flesh.

She has a fetid discharge from right

nostril and when driven considerable

thick mucus comes from her head. R.

R., Roscommon, Mich.—Examine her





 





. i.

- .r j) . f ‘

‘ -v I

‘§A.é.‘.Ar

—— '— “‘K. §_- ' ">krs. } \\





 

 





 





l





 





Journal were reared at

the plow and they know

what’s what and how to.

help you.





You are invited to try it—-—It proves something to

you that more than 800,000 farmers already approve

the paper. Five years, $1. Any time you are not





The editors of the Farm *





,mouth and you will find the fourth up-





per molar tooth diseased which when

extracted she will perhaps get well.

Give her a teaspoonful of powdered

sulphate iron and a dessertspoonful of

Fowler’s solution at a dose three

times a day.



Indigestion—Have calf four weeks

old that is fed, 21/; qts. of fresh milk

from cow twice a day, but it is not

doing well. The calf is lively and ap-

parently healthy, and not troubled

with lice. Is cob meal a good food for

calves three months old? J. 8., Cedar,

Mich—Give your calf 15 grs. of hypo-

sulphite of soda and 20 grs. of ground

gentian at a dose in milk three or





 





 





satisfied you get your money back. ;

The Farm Journal :





182 wakington Square. Philadelphia





 





Built low-



wide tires prevent ruttinz



~light draft—saw? wlin‘kl anddrepairsb Write for

free 5 an wagon . .

“Mai-21:232.," e3e5 llm 80., Qulncy, Illa





 





 





 





BOOK ON





DOG DISEASES

.And How to Feed





. , Mailed free to any address by

Amonns the Author





Pioneer H. CLAY CLOVER, v. 5.

Don Romulus 118 West 31.: Street, New York





 





 





 





 





 





Michigan Livestock insurance (in.

Capital Stock—$100,000. Surplus—$100,000

Home Office—Charlotte, Michigan.





only Home Co. in Michigan.





COLON C. LlLLlE President.

H. J. WELLS, -:- Secretary-Treasurer.





 





.four times a day. You have not been





feeding calf often enough. Also give

it some ground oats and clover; add

ground oats and wheat bran to cob

meal, instead of giving it alone and

your calf will do better.



Capped Hock—For the past twelve

months my four-year-old gelding has

been troubled with capped hock. G.

E L., Lake Odessa, Mich—Apply

equal parts tincture iodine and spirits

of camphor every day or two.



Thirsty Mare—I have a six-year-old

mare that is fond of snow; right away





. after drinking water she will lick and





eat snow. She is in foal. J. 8., Ken-

ton, Mich—Place water before her. in

stable, also give her 14 oz. cooking

soda at a dose in feed three times a

day. Give her two tablespoonsful of

cider vinegar in drinking water three

times a day until her thirst mostly

leaves her.



Indigestion—We have a cow that

came fresh last fall; since then she

has not thrived and is thin. W. H.,

Bridgeport, Mich—Give her 1 dr. of

ground nux vomica, 1A oz. of ground

gentian, 1/1, oz. ground cinchona bark

at a dose in feed three times a day. A

change of feed will do her good.



Weak Heart—Old mare pants bad-

ly, coughs some and is out of condi-

tion. Would you advise me to breed

her to colt 20 months old, or would

you advise me to not breed colt to

mares before he is four years old? L.





 





 





A., Alden, Mich—Give % dr. ground





nux vomica, 1,4 oz. Fowler’s solution,





and lé oz. powdered licorice at a dose

in feed three times a day. Feed less





bulky fodder and. exercise her daily. ,





.Yes, breed her. ; Breed him to a. few

mares at two and three years of age.





Brood Mare Sweats in Stable—I

have a 12-year-old mare that sweats

during the night while standing in

stable. J. G., Bear Lake, Mich.~—Clip

her and give her 1 dr. of acetate pot-

asir, 1/2 dr. ground nux vomica, % dr.

powdered digitalis at a dose in feed

three times a day for two weeks; then

give 14 oz. of Fowler’s solution in feed

three times a day. Her bowels should

be kept open and active, this is best

done by giving well salted bran mash-

es, clover and roots.



Laminitis (Founder).—Our six-year-

old horse is sore and stiff; when walk-

ing he keeps fore feet well out in ad-

vance of body. B. T., Newaygo, Mich.

—Shoe him with rolling motion shoes,

clip hair off fore coronets and apply

one part powdered cantharides and

four parts lard and apply three times

a month.



Pimples—Surfeit.—l am a reader of

the Michigan Farmer and find some

very good advice in veterinary cole

umn. I bought a young mare one year

ago that has been trohbled with pimp-

les and a sort of breaking out, caus-

ing itchiness. When driven she shows

it most. T. F. W., Monroe, Mich.———

Give her 1 oz. of sulphate soda at a

dose in feed three times a day and

clip her.



Weakness—Have 20 twoyear-old

heifers that have lived on hay all win-

ter; one of them is down and unable

to get up without help and when plac-

ed in slings is hardly able to stand.

F. E. W., Spring Lake, Mich—Give

her 1 dr. of ground nux vomica, 1/,6, oz.

gentian, 1A; oz. ground cinchona at a

dose three times a day. Feed her

plenty of grain, clover and roots.



Hogs Cough—I have a bunch of

hogs that are growing well, but are

troubled with a cough; it is eight

weeks since I noticed them hacking.

E. J., Charlotte, Mich—Mix equal

parts ginger, licorice, cooking soda

and ground gentian together and give

each hog a. teaspoonful at a dose in

feed two or three times a day.



Elbow Tumor.—~My nine-year-old

mare has a shoe boil on elbow which

our local Vet. opened but failed to

cure. What had I better apply to take

it off? E. W. R., Lowell, Mich—Call

a competent Vet. and have him cut

off tumor, removing some loose skin

with bunch or he will not have a

smooth elbow when wound heals.



Chronic Azoturia.—I have six-year-

old mare of a nervous disposition

which has had three different attacks

of azutoria. She is also lame occa-

sionally in left fore foot. She has

been examined by three different vet-

erinarians who fail to locate her lame-

ness. I. F. R., Rivcrdale, Mich—Azu-

toria is usually caused by feeding a

horse too much grain without giving

them exercise; therefore, you should

be able to prevent future attacks by

giving the animal a few miles of ex-

ercise every day and feeding care-

fully. The lameness is in foot, and

doubtless incipient navicular disease.

Apply one part tincture iodine and

two parts camphorated oil to coronet

every evening.



Itchy Cow—I have a cow which

seems to lick herself a great deal and

when an opportunity presents itself

she rubs against posts, trees or fences

enough to make skin raw. The cow

standing next to her has commenced

to rub herself. J. M. H., Chase, Mich.

-—--Your cow may be lousy. Wash her

with one part kerosene and nine parts

soapsuds once a day for a week, then

apply one part bichloride mercury and

500 parts water twice a day. She

should perhaps be kept away from

your other cattle.



Pelvic Fracture.——I have a mare

which, after plowing hard one day last

August, showed lameness in left hip.

Has not worked for the past five

months and when in stable leans

against stall partition and when walk-

ing goes creoked. D. A., Flint,

Mich. Apply one part aqua ammonia

and two parts camphorated oil to hip

once a day. Her recovery is doubtful.



Loss of Appetite—Cough.——I have a





six-year-old mare that I bought ten

days ago, but she has lost her appe~

tits. I also have another horse that

coughs occasionally. but is not sick

F. 0., Milwaukee, VVis.——Give her 1

dr. fluid extract nux vomica and 1/2 oz.

Fowler’s solution at a dose in feed

three times a day. Give other horse

15 oz. licorice and 1/, oz. ginger at a

dose in feed three times a day.

Indigestion—Weakness. I have a

five-year-old mare that is not thriving;

two local Vets. filled teeth and gave

her medicine without doing her any

apparent good. She lacks life and

courage. C. T., Dundee, Mich—Give

her 2 drs. phosphate soda at a dose in





 





 





feed three times a day. Also give her .





1 dr. ground nux vomica and 1,5 oz. of

Fowler’s solution at a dose three

times a day.





 





make '--

stronger, more "-:-

durable walls — you

brace tile against tile—

the silo material that

lasts for generations.

Write us—lea‘rn more

about this construction

;_in the





.3, Lansing

i’féfi , Vitrified Tile





;.;: First Cost the Only Cost “-5.3;

{1? Reinforced throughout with twisted 33':

ff: steel—10% stronger than steel

_:_:;' twisted. Thin mortar line exposed‘,"

11-: between blocks—fluted end keeps 1.7;"

5,5; mortar from slipping—-gets solid grip.

; ; Write for low price offer and catalog. 1"»

J. M. PRESTON CO.



_ Dept. 309. Lansing. Mich.

Getour offer on Climax Silage Cutters ' 2:.‘5.

" _ and Bidwei





 





 





 





éDunhams’ Percherons

l are loday as tor the pasl Forty.

eight years the breed's Desi,





As a matter of fact you can

also get more here for your

money than elsewhere.

If you are interested in





Percherons





and want to getin touch

with the oldest concern

in the business-tile one that handles

the best class of horses, and whose

reliabilityis proven by the expcri-

ence of thousands of satisfied cus-

tomers. (‘ome and see us.



New illustrated catalog on application





burrows; Warns- nurse ,cvumv.._un_n2rs_-_





PERCHERON SALE. .





1

Farmers and Breeders Attention.'





In order to insure quick sales we, have decided to out

ourfrices. Your choice for SJWU. A lot of good ones

at S ‘JO-SSOO-SGCO.





A. A. PALMER & SONS,



R. R. Orleans. P. 0. Belding. Mich.

FOR SALE—One Pair oi‘ 0h. Belgian Geld's 5 yrs.



old, wt. 2800 lbs.: One Pair of 5 yr.

old Percherons. wt. 2990 lbs.: One Pair of Brown

Belgian Geldin s.wt. 2800 lbs.:Une Blue Roan Gelding.



yrs. old. wt. 1 0 lbs.: One Brown Gelding 5yrs. 0)



wt. 1500 lbs.: one Bay Blooky Mare 6 yrs. 0 (1, wt. 1500

lbs: One Red Roan Gelding, wt. lililOlbs. 7 rs. old:

One Black Mare. 8 yrs. old. wt. 1350 in l'oa to 2200

lb. Belgian Stallion. No. of other single Mares and

Geldings suitable for Farm or Draft urposes. also





 

 

 

 





 





 





 





one Bay Road Horse 4 yrs.. sired by Online. Horses



for all purposes at the right price. Quality considered.

STARKWEATHER STOCK FARM.



Northville. :-: '.-: Michigan.





LOESER BROS.





W'e have sixty head of imported Belgian

and Percheron stallions and mares, from

weanlings up. \Ve are also offering a car

lot of big drafty grade brood mares all in

foal, weighing 1600 to 1900 pounds.





LlGONlER, 1ND.





METZ BROS.,





Importers and Breeders of





Percheron Stallions and Mares





We have a fine selection of stallions and mares

ranging from I to 6 years old. rioes reasonable.

terms to suit purchaser. METZ BROS. Niles. Mich.





We have a lot of choice young

Stallions and Mares for sale

at bargain prices. Terms to





suit. FINDLAY BR08.. Falnrrove. Michigan.





Registered Percherons,

BROOD MARES. FILLIES AND YOUNG

STALLIONS at (prices that will surprise you.

L. C. HUNT & 0.. Eaton Rapids. Michigan.





 





 





 





' —Rog. Shetland Ponies, mo ti

Fig.0" Pony Farm spots. I signed stallion and yeah:

stock for sale. Dr. W. T. orrison. Pigeon. Mich.





SOUTH 8i. PAUL HORSE &. MULE COMPANY.





A 1 Union Stock $2195. Sinfith St. Pang. lwlnn.

t 8 0 00 OPSGH an l

.. iiifiiiiiiaeceveaawfl‘

H I

GET IN TOUCH WITH US. Y





PERCHERONS—Impoosnt. one or the heaviest

B d M 0.1110338?“ Iggtg. ifit head of stud.

.aresaago..ugS" 01' B.

cii’fis. oscooo s: sous. ,Mendon. iiichrgan





—R it dP

FOR SALE escort.ostentatious:-





spection invited. r. L. KING a so N, Char otte.Mioh:





FIrllE Ensgsrnnvnn lfnaognnou s'.ru.lraror\rs‘i

no I. tom 03'} n s

sound. WM. MacaonsN."i)unon. 3:530; Mini). '





Registered clydesdale Stallions for Sale.



. F. .A. PETZ. CAPAC. RICH] A

Reassessmerna.salsa-21W. ., to

sell cheapp. ”ii‘eriiis. rialhue its .fi.‘l'1°i¢ii)rflt..nlliotroit.
F ' mania, 1915.





TOPDresdngof Nitrate

ofSodaonWheatshould

give you a splendid in-

creaseii‘iyieldofheavienbetter

Wheat than you have been

producing. - ~

, To the farmers Who apply

I will send absolutely free

enough Nitrate of Soda to

try it. This offer is necessarily

limited, so write at once. To

l” the meaty-five farmers send-

_ , ing the best results from these

»- trials,I ofl’eras aprizeProf.

‘ Voorheesibook “Fertilizers,” a

standard wark of 327 pages,

handsomely bound.





I Send post card with name and com-

plete address, mentioning “is Jamal





WILLIAM. S. MYERS, Director

25 Madison Avenue, New York





 





   





CHEAPEST

and BEST FEED

For Cows





All of the sugar beet left after man's food

) has been soaked out by water. Clean,

eeome, pure, dried vegetable food.





 

 

 





 

   





(

who





   

 

 





 





   





teration. Don't

cornmeal,

carbohy-





Free_,from adul

buy bran, middlings,

barley,.oats or ot er

drate feed when on can-get

, a better feed ike Dried

Beet Pulp for less money per

ton. Ask your dealer





IRE HERON!

Milli“





 

 

 





   

 





 





 





, 2-4,.“ ~ .:._A‘f._





Their practical oopstmctio ‘ _ I M



. stands for lasting servieenllsd

5m” flamravrtmmwm‘“



~ n. ec y -'

the “ZYRO” Metal Silo





Absolutely Air-Tight .

ltcsnnot m-ack. shrinkoreollapee—is prae-

t1cally_trouble-proof. Many unique and '

exclusive features put the 'ZYRO” Silo '

in a class of its own. Write today for





FREE .mmsggo FACTS

3.313333%? “mt' dfiwmms’” ‘35 Wm” “M

.nyouthinlocbniiiugg- mu"!

Wm to:





0

_ THEN PAM 5 I





TILE 511.0.

ChaiuofKflnuAdsnfictoRioGnnd.

lad-lg- tnldu coon flu “a New, with!

.. _ you Ianuzdigyou mam“ a





Kill-0.90 Tut ‘ Silo C... Wales. Mich.





 





_ w .

r. so. J’T'Z‘LW‘A»





 





 





 





l

..

l

?





 





 





I O

Gio Tile -Siee| Reinforced





New 3::er o'r smooth 32;“.

, n w a .aus.

hrepnd time. lo repairing, painting nor at

Jun ado-“only correct. Absolutely gur-

vu-iss Urns lb:

FREE GUERNSEY BOOK

Bloom





containing valuable information deal

silo building. Agents wasted. on prso





Clancy Clay Co.

"M" DEHLEB HALF WEANEH





Ml

LATEST and BEST.





Prioka the csllnnd does not injure

cow. Agents wanted. Postpaid 50c.

Dehler Bros. M12. Coo. ISth St...& 5th Ave" Mollne,lli.





Michigan White Cedar





.. EEN E P0515"





908 “each Bid

Indianapolis. In ,





 





 





 





 





 





"G‘Eqkdl‘f‘liwm 099',"





, «I

. 'u’ll "l 1’ '-.





 





 





THE MICHIGAN FARMER





gunmmuuuumumunIImmmnmmmmmmlmnmummmmi





. Practical Science.





at llllllmlliillillillllllimiillliilllllilllilillilliillllllllllllliiillillmlllllllilllllllliiilliiilllfl





FOOD LAW ENFORCEMENT IN

AND FOR MICHIGAN.





llllllillllllllll





E

E

E





.J





 





BY FLOYD W. ROBISON.





(Continued from last week).

Buckwheat Flour Law.



Besides the gentral food law quite a

good many other special acts have

been passed by the Legislature from

time to time, dealing specifically with

individual classes of material. The

Legislature of 1903 passed an act in

relation to the manufacture and sale

of buckwheat flour, which act permit-

ted the admixture with buckwheat flour

of wheat, corn, rye, or other like sub-

stances, but compelled the labeling of

the product as a. buckwhtat flour com—

pound.



Law Governing Milk One of the First

Passed.



One of the earliest separate acts

passed by the Legislature was in 1873,

known as Public Acts No. 26, which

provided for penalties in the adultera-

tion of milk and milk products; an act

passed in 1887 to prevent the sale of

impure, unwholesome, adulterated, or

swill milk, which acts





lature frequently from that time on.

In all the statutes which have been

passed referring to the adulteration of

milk, and there are more covering this

commodity than any other commodity

known, none have yet anticipated the

giving of power to the inspector to

pass final judgment upon a product.

It would seem that ample time had

been shown for the Legislature to be-

ecme conscious of the need for plac-

ing judicial powers in the hands of an

inspector if there were need for that

to be done. The fact that no statute

gives the inspector such power is suf-

ficient, it seems to us to discourage the

use of such power by an inspector. We

do not believe there is any warrant in

law permitting an inspector of either

a state department or a board of

health to destroy food even though it

may not conform to his interpretation

of the law.



Standard for Butter and Cream.





The Legislature of 1913 passed a





;, very important act, known as act No.





244, to regulate the sale of butter and

cream in the state of Michigan. This

act establishes a butter-fat standard

for butter, which is a most desirable

addition to the food law. Under this

act any product which contains less

than 80 per cent milk fat cannot be

sold as butter, and any product which

contains less than 18 per cent of milk

fat cannot be sold as cream.

The Drug Law.

A standard for linseed oil was pro-

vided in act No. 210 of the Public

Acts of 1909, which likewise makes

unlawful the adulteration of this pro-

duct. The Legislature of 1909, in What

is known as act No. 146, passed the

first law, requiring the inspection of

drug products, the state has had. This

act is in conformity with the National

Food and Drug Act and attempts to

bring the same restrictions to the

traffic within the state that the Na-

tional Food and Drugs Act brings to

interstate traffic. ’

(Continued next week).





The growing of special crops pays

well when brains and salesmanship

are mixed with it. Some of those

which any farmer may attempt are on-

ions, potatoes, seeds, small fruits, or-

chard truits, early tomatoes, lima

beans, celery and flowers. Nothing of

this sort should be undertaken with-

out previous study and experiment.

They should be begun with caution

and increased as experience dictates.

It is worth considering. Many have

found it the road to permanently pros-





 





perous agriculture.‘





have been,

amended and added to by the Legis/





 





“Concrete in the Barnyard” contains informa-

tion of interest to every farmer. If you haven't

done any concrete work. you’ll want this book of

simple instructions. If you have already begun

building up your farm with permanent structures of

concrete. the detailed plans and directions in this book

will be of great help to you in further work. We are

always glad to give special information in addition.

whenever desired. Don’t be without this book.



Send for a copy today.





Universal Portland Cement Co.





CHICAGO. 208 South La Salle St. PITTSBURGH, Frick Bldg.

MINNEAPOLIS, Security Bank Building

Plants at Chicago and Pittsburgh

Annual Output 12,000,000 Barrels





 





 





Run on Kerosene—6c for 10 Hours





Ellis Engines develop more power on cheap lamp oil than other engines do on high-

priced gasoline. Will also operate successfully on distillate, petrol. ~

alcohol or gasoline. Strongest. simplest, most powerful en lnes



made; only three working parts. No cranking, no excessive weight,



no carbonlzing. less vibration. easy to operate.





Horlsontsl Engine





 





 





LLI S





NGINE





Have patent throttle. giving three on nes in one; fomfeed oiler: automobile type “

muffler; ball-bearing governor adjusts is while running and other exclusive features.

Every engine sent on 30 days’ approval with freight paid. 10~year arsntee. Write »_'

for 1915 catalog. Engine Facts. " showing New Models with speciaf‘xlrices.





 





 





ELUS ENGINE CO.. 2839 East Grand Boulevard. Detroit, Midi.

I

This Steel Document Box

Made of Bessemer Steel. 9 Fire and Burglar Proof

» Sent Anywhere in the U. S. Prepaid

Sara assuming: , ‘

Mort? es, Bonds Notes, Insur- '

nnoe clones and Private Pepe :

are too valuable to have pigeona

holed loosely about the house.

1: you keep them per-

manently unsafe deposit vault,





it is dangerous to carry them

meg” i: your pocket to and from





an .

This Steel Document Box is con-

structed of Bessemer steel and

heavily coated‘with black enamel.

You can’t cut it with an ax. Lid

fits closely into a grooved edge on, '

the bottom half._ in as are on

inside. it locks With an ndividual

key andJust fits our cost cket.

Size ll m. long, in. wide y2 in.

deep. It Insure. Safety and Saves Time and Worry. You should not let your papers so unprote

another minute. Send lor the box at once.



Send us one subscription to





Our FREE Steel Document Box Offer 1... rm... .......... to,





six months (26 issues) at 75 cents and we will forward immediately prepaid and FREE the Steel Document





Box shown above.



O O is a weekly, illustrated in

e armm usmess m "m a...

. $1.50 farm paper With over

_ ‘ ’ 100 000 subscribers and but

a few months old. It is not an ordinary term paper. It treats farming as 3 BUSINESS and the farmer as

n BUSINESS MAN. it helps you With the selling end to get the highest price for what you produce-—

it helps you run your business at a profit. _ , .



EXTRAORDINARY fuTUREs—Only farm pa with representative in Europe investi ti

future crop conditions for American farmers. weekly Market Letter, News Review and dolor-:3

War Map (War effects markets, markets determine success 0! farmer‘s business)—New Farm

Inventions and Discoveries that lower cost. and increase profits~Departments for entire

liming—a Boy and Girl’s Eaire—Patterns—Needleiwork—Home Maker’s Club—in short

g farm magazine t. at you need in your bIJSlnean





.--..Publlshed by w; o.’ sovcs, cos, chic-goal“;





,fill In This Coupon‘ and Mail

Now For FREE Document Box





III-IIIIllI-I-I-I-I-Il-I-I II‘

w. muons co. \

om. us. soak. Dearbom'Sh.‘Cl-ieago.lll.





Gentlemen—ficlosed please find 60 etc. for {months (16 issues!

subscription to Farming Business and Steel Document Box F
SAVE





Ruthslein’s Latest :Triu

I, ADJUSTABLE R

LEATHER TAPS





Make My “Steels”

" INDISPENSABLE





 

 

 

 





   





 





   





Every Man

and Boy for





 





 





 





 





 





 





 





 





 

 





 





“Steels" mean All-day-comfort to Every

an or Boy. Can be worn from

sun-up to sun-down





Health, Comfort'and

The Lightest — and





The‘VI/orld’s Greatest

Workshoe





Twelve years of untiring

effort and the expenditure of

a Fortune have enabled me

to produce a workshoe that

surpasses all others for Com-

fort, Lightness, Protection,

Practicability, Service and

Economy—Absolutely Water-

proof under all conditions—

in all seasons—from season to

season—for town or country.

,. It cost more than a half a

- million in cash to bring My

“Steels” to their present perfection and make this

offer and announcement to you today. I recently

spent one hundred thousand dollars to improve

my “Steels”——make them more comfortable—im-

proving every part of the shoe—~and to increase

my capacity to meet the tremendously increased

demand. My latest TRIUMPH Adjustable Leather

,Taps—make my “Steels” the Only Practical, Gen-





eral Purpose Workshoe.

Saved Millions for Workers





My “Steels” have saved to workers more than

twenty million in shoe expense alone, and many

Millions more in doctor and drug bills—in loss of

time from sickness or bad weather—because no

man nor boy need fear to wear my “Steels” in the

roughest storm—summer or winter—rain, snow,

sleet, slush or mud.



Now, My “Steels” will save countless Millions

more for the men and boys who see this advertise-

ment—who will wear my “Steels.”



My Steels—Best Health Insurance



Here is the only all-the-year-around workshoe

ever invented. The shoe for every season—~Cool

in Summer—VVarm in VVinter—Dry and Shapely

--r~always. They never Harden nor Waterlog, Scald

the feet, Warp, Twist, or Leak.



My “Steels” absolutely protect the wearer from

Rheumatism, Lumbago, Sciatica, Coughs, Sore

Throat and other “wet-foot troubles.”



My “Steels” are Foot-form-fittlng~always keep

their original shape. The Steel Sole is a Natural





\ 7—1."





stable filth and odors.





 





 





wear—Easy to clean





fr" -9. ‘

STEIN STEELSIIOE II - ‘ ..

. I Do I. I26, Baolno,Wls. Brlflsh Factory. Northampton. Encland





 





 





 

 

 





Easy to pick his steps—make him tireless , '

and sure-fOOted '





In all weathers~Protect the Healt

the year ’rou nd





 





 





 





>1 .





\k





on





 





‘ \Vxx’ay ~‘ix





“Steels" do not absorb barnyard or “Steels” protect the Man or Boy who can’t “Steels” keep the feet'dry and comfortlable “Steels" with Adjustable Leather Taps can





be worn at all times and places.

They do not sweat the feet





Economy Demand that You Wear “Steels”





Only Absolutely





Arch Support. Nothing to Rub nor Chafe. Sure

prevention and relief for Corns, Bunions, Cal-

louses, Chilblains, and all Foot Discomforts.



My “Steels” are altogether the Best Investment

you can make, Best for your Health~Best for

your Comfort—Best for your Pocket—book.





Leather-Tapped “Steels”—My Masterpiece

The Adjustable Taps of my New Model “Steels"





are of firm, solid, special Process Leather, firmlyt





attached to the wonderful sole of thin, wear-resist-

ing, springy steel that has made my “Steels” the

World’s Greatest Workshoe.



Leather Taps Instantly Replaced



Then, when worn, the Leather Taps are Instant-

1y Removed—~Instantly Replaced by anyone—at

home. The cost of New Taps is small~but 400,

for a full set of better-wearing, more solid leather

than is ever put into the best all-leather Work-

shoes.‘ They last three times as long as any other

taps. .



The Ideal General Service Workshoe



Here—At Last—is the Ideal Shoe for every Man

or Boy. Not alone for the Farmer—not alone for

the Dairy, Stock or Creamery Man—the Fruit or

Vegetable Grower—but for Everyone who Works

or Plays—Indoors or Out—in City, Town, Village

or Hamlet—Forest or Field or Range or Road or

Pavement—on Mountain or Plain—in Factory or

Mine—for Mechanic, Laborer, Soldier, Shopman,

Sportsman—for every man who Does Things—tor

Every Worker.



My “Steels” stand Alone—Supreme—The Great-

est and Best General Service Workshoe the World

has ever seen. ,



“Steels” in All Sizes for Men and Boys



“Steels” run in same sizes as ordinary leather

shoes and rubber boots—and in all heights. Sizes

for Men 5 to 12, 6, 9, 12 or 16 inches high—for

Boys, Sizes 1 to 4, 6 or 9 inches high.



You Must Try My “Steels”



You cannot begin to realize the True Value of

my “Steels”——you cannot know the height of Shoe

Comfort, Economy and Protection—until you try

and wear my “Steels.”





“Steels” for Boys





the Greatest All-around Shoe for





 





Keep your feet “powder dry” in any kind of





She knows what’s





II. 8. FAGTORY - - ' Raclne,Wls.





canadIan Fa‘clory. - Toronto, Ontarlo





Waterproof -— Workshoe





This Book FREE





Let me send this book to you by mail, postpaid,

Read it and learn more of this great shoe with the

~ ' sole of steel—the shoe with the light. springy,airy

’ ‘ step"-—the shoe that rests your foot naturally and





 

 

 

 

 

 

 





 





"It. comfortably—always holding its perfect shape-

In"""l""“|l“ , never a run-'down"heel,broken arch,warped sole.

Wu”?“liluiilmuii ‘ worn toe. tw1steduppers. or cracks or leaks. Before

, ,3..t.9.“:~...l. burn-12L you think of buying a pair of work—shoes. get this

great book of shoe facts and learn about this won-

derful, foot saving sole of seamless steel. Do not

think of turning this page until you have sent





 





i'"





 





for this free book.





You know, and I know, that the day of the

Leather Workshoe is passing—that you must find

something better—more Comfortable—more Last-

ing—more Economical—that leather workshoes

are getting lower in quality and higher in price

every year—that cheap workshoes are cheaply

made—~that even the most expensive will not last

one full season.



My,“Steels” are higher in grade and lower in

price than any other workshoe—three to five

times better value for less money.



Try “Steels" Ten Days at My Risk



I have spent a Fortune to\MAKE GOOD every

claim and every statement made for my “Steels.”

You cannot prove their worth to you unless you

try my “Steels.” You cannot profit by my years

{if effort if you lay aside this paper before writing

0 me.



I do not ask you to take my word nor the un-

stinted praise of the Million wearers of my

“Steels.” I’m Asking you to TAKE YOUR OWN

JUDGMENT—the evidence of your own senses.



Just TRY my “Steels”——just send the Coupon or

a postal—ask for my FREE BOOK—ask for

FREE DEMONSTRATION—~FREE TEN-DAY

TRY-ON—in your own home—on YOUR OWN

FEET.



DON’T lay this paper aside until you have done

what I ask—for your own good—for the sake of

your Health and General Prosperity. You already

know my reputation—ask any Banker—any Ex-

press Company or the Publisher of any Paper—

they’ll tell you I am absolutely reliable.





—-_----—-—-—=





 





f H 1th ' Send Postal or this Coupon I

he Eas , Li ht, Comfortable, Waterproo , ea y . T .



Shade for B3bys. g The “Knock—about” Shoe—the Sensi- I N- M- RUTHSTEIN The Steel Shoe Man,



ble, Long—wearing Shoe. The Greatest School—~the

Greatest Play Shoe

REAL BOYS. No more Wet Feet. No more hot, heavy

“arctics” 01‘ I‘llbbel“ b00tS- N0 more danger 0f 001(18 01" Ten-DayTry-OnOfl'erwithoutcost, riskorobligation tome. '

ickness.

zet, damp, sloppy. snowy weather. My “Steels” are best

to SHAPE YOUNG FEET and avoid the foot-troubles of

later life: Show this to Mother!

best for you. “Steels” will save her hours of worry.





Dept. 126, Racine, Wis.





Dear Sir—Please send me, postpaid, your free book I

“The Sole of Steel” and fullvparticulars of your Free





N ame. ......................... ' ............................................... I





Street or R. F. D. No ................................................... I





Town. ............................... State .................................





ALSO manufacturer of the “World Famous gloatific Shoe" FOR DRESS and GENERAL SERVICE L - - — n - l - - l I- l - ' J





 





,-,.~.—w—__.._-.4..,~_~ W‘ ..